CLUSTAL format seed alignment for MF_00363

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YNEF_BACSU       ---------------------------------------MTLWVGILVGVVALLIGVALG
Y1676_OCEIH      --------------------------------------MSTIWV-VLIAIAALVAGVALG
Y1306_LISMO      -----------------------------------------MWIYILVGIICLLAGLAGG
Y2350_ALKHC      ----------------------------------------MNWMILLWITLGIVIGIAIG
Y1343_STAAM      ---------------------------------------MATWLAIIFIVAALILGLIGG
Y1026_STAES      ---------------------------------------MAIWVAIILIVIALIAGLIGG
Y335A_MYCGE      ------------------------------------MNDLALALGLGIP-LSLLVGMILG
Y482_MYCPN       ------------------------------------MNDLALALGLGIP-LSLLVGVIIG
Y040_MYCPE       -----------------------------------MALAIGLCLGLGIP-ISLIIGAVIG
Y265_UREPA       MNFSSFIFKVSDVFKSVIHEASDVVTKADLDNANAHTHSLAVGLGIGIV-LFLIAGLIIG
Y146_MYCPU       -----------------------------------MSIGLAVGLIVGLSILFFIIGGVVA
Y1650_STRA3      ---------------------------------------MSTTIWILLIIVALFGGLVGG
Y1601_STRA5      ---------------------------------------MSITIWILLIIVALFGGLVGG
Y359_STRP1       ---------------------------------------MSTAIWILLLIVALGVGVFGG
Y1882_STRPN      ---------------------------------------MDLLLAIVLIVLAFLGGALGG
Y1719_STRMU      ---------------------------------------MNTFLWILLVIIALLAGLVGG
YNBE_LACLA       ---------------------------------------MNLILAILLMVVCLLAGFFLG
                                                            : :      :  *   .

YNEF_BACSU       FFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK---------
Y1676_OCEIH      FFIARKYMMSYLKKNPPINEQMLRTLMMQMGQKPSQKKINQMMRAMNNQSGKE-------
Y1306_LISMO      FFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQEKEKPKKAKK
Y2350_ALKHC      FFIARKTMMSYLKKNPPINEQMLRVMLMQMGQNPSQKKINQMMKAMQKQQSK--------
Y1343_STAAM      FLLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK-
Y1026_STAES      FLLARKYMKDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKNMNQKM------
Y335A_MYCGE      YFISIKIFKKQMRDNPPITENQIKAMYAKMGRKLSETQVKEIMRSIK-NQK---------
Y482_MYCPN       YFISIKIFKKQIRDNPPITENQIKAMYAKMGRKLSETQVKEIMRSIK-NQK---------
Y040_MYCPE       YYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK---------
Y265_UREPA       YFISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEIYNRAV-KQK---------
Y146_MYCPU       FFVTRRLFQKQLKENPPINEKMIRAMFLQMGVKASESRIRQVMRSMQ-QAK---------
Y1650_STRA3      IFIARKQIEKEIGEHPRLTPDAIREMMSQMGQKPSEAKVQQTYRNIVKHAKTAI-KTKK-
Y1601_STRA5      IFIARKQIEKEIGEHPRLTPDAIREMMSQMGQKPSEAKVQQTYRNIVKHAKTAI-KTKK-
Y359_STRP1       IFIARKQIEKEIGEHPRLTPEAIREMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK-
Y1882_STRPN      MYLVRKQIEKEFADNPRLNAEAVRTLLSANGQKPSEAKVQQVYHQIIRQQKAALANNKKK
Y1719_STRMU      TFIARKQMEKYLEENPPLNEDVIRNMMSQMGQKPSEAKVQQVVRQMNKQQKAAKAKAKKK
YNBE_LACLA       TWFSQRQTKKLLMDNPPLNEDAVRLMMGSMGRKPSEVQVQQVLRQIRAAAKQSD-TNKK-
                   .  :     : .:* :. . :: :    * : :: ::.:                   

YNEF_BACSU       -
Y1676_OCEIH      -
Y1306_LISMO      -
Y2350_ALKHC      -
Y1343_STAAM      -
Y1026_STAES      -
Y335A_MYCGE      -
Y482_MYCPN       -
Y040_MYCPE       -
Y265_UREPA       -
Y146_MYCPU       -
Y1650_STRA3      -
Y1601_STRA5      -
Y359_STRP1       -
Y1882_STRPN      K
Y1719_STRMU      K
YNBE_LACLA       -