CLUSTAL format seed alignment for MF_00364

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NAGZ_SHIFL            -------------MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVR
NAGZ_ECOLI            -------------MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVR
NAGZ_SHIDS            -------------MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVR
NAGZ_SALTY            -------------MGPVMLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVR
NAGZ_YERPE            -------------MGPVMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVR
NAGZ_PECAS            -------------MGPVMLDVASYELDAEDREVLEHPLVGGVILFTRNFHDVAQLRELVR
NAGZ_PHOLL            -------------MGPVMLDVVGYELDNEEKEILQHPLVGGLILFTRNFYDVEQLRELVR
NAGZ_VIBCH            -------------MGPLWLDVAGYELSAEDREILQHPTVGGVILFGRNYHDNQQLLALNK
Q5E083_ALIF1          -------------MGPLWLDVEGYEIDAEERELLQHPTVGGLILFARNYHDPKQLAALTA
NAGZ_HAEIN            -------------MSSLLIDLKGKELEQEEVELLSHPLVAGLILFTRNFENREQIQELIR
NAGZ_MANSM            -------------MSTLLIDLKGQELLAEEAELLAHPLVAGLILFTRNFYDRSQIQALIK
NAGZ_HAES1            -------------MSILLIDLSSQELRQEEIELLEHPLVAGLILFSRNFYDIEQIRHLIR
NAGZ_HISS2            -------------MSILLIDLSGQELRQEEIELLEHPLVAGLILFSRNFYDIEQIRHLIR
NAGZ_IDILO            -------------MAQLMIDIAGTELTAEDKKLLAAPAVNGLILFTRNFASLEQLQELIR
NAGZ_SHEON            -------------MSYLMLDLLSLDVSEAEAEMLRHPQVGGLILFSRNFTSREQLIALVQ
NAGZ_SHESA            -------------MSYLMLDLLSLDVSEAEAEMLRHPQVGGLILFSRNFSSREQLIALVQ
NAGZ_SHEFN            -------------MSYLMMDLAGLTVSATETAQLQHPQVGGIILFSRNCENKNQLIELVK
K0E9F5_ALTMB          -----------------MLDCQAEELLPEEKEKLTHPVVGGVILFSRNYHDKRQLSALVQ
A5WC78_PSYWF          ------------MYGPLMIDVAGTELTAEDRDVLSCEQVGGVILFARNVETPEQVRRLCD
A0A0D7R7J0_ACIBA      ------------MIGALMLDIAGTELTQEDIELLQAPQVGGMILFARNIESPQQVRALTD
NAGZ_PSEAE            ------------MQGSLMLDIGGTWLTAEDRQILRHPEVGGLIIFARNIEHPAQVRELCA
NAGZ_XANCP            ---------------MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFASRTQVAELSA
NAGZ_XANAC            ---------------MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFASRTQVAELSA
NAGZ_XYLFA            ---------------MLLIGVAGTTLSAQEVDWLQDDAVAGVVLFKRNFASRAQIVELSA
NAGZ_XYLFM            ---------------MLLIGVAGTTLSAQEVDWLQDDAVAGVVLFKRNFASRAQIVELSA
H8KYA4_FRAAD          -----------------MIGLAGTGLAAVERSWLTAHGVSGVILFARNYTSREQLQALVE
A1WWH4_HALHL          ------------MLGPLMIGIAGGELPAQARELLRHPAVGGVVLFTRNFKNTQQLHDLTQ
NAGZ_NEIMA            ------MTVPCIPRGPVMADIAAFRLTEEEKQRLLDPAVGGVILFRRNFQNIAQLKELTA
NAGZ_NEIMB            ------MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAVGGIILFRRNFQNIEQLKTLTA
NAGZ_NEIG1            ------MTVPHIPRGPVMADIAAFRLTEEEKQRLLDPAIGGIILFRRNFQNIEQLKTLTA
NAGZ_CHRVO            ---------MNLPRGPVMVDIAGFALTEAERARLSHPLVGGVILFRRNFHNIEQLRALTA
NAGZ_BORPA            MSSKKK-TKPVLPPGPVMVDVAGTTLTKDEKRRLRNPLVGGVILFARNFTDRRQLCALTR
NAGZ_BORPE            MSSKKK-TKPVLPPGPVMVDVAGTTLTKDEKRRLRNPLVGGVILFARNFTDRRQLCALTR
NAGZ_AROAE            MTLQSDLPATVRPLGPVMLDVAGFALTEEERERLLDPLVGGVILFARNFRDSEQLQALTA
A4JCR6_BURVG          ---------MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFENRAQLSALTD
A2SA00_BURM9          ---------MKLPPGPVMLDVAGTTLTRDDARRLAHPHTGGVILFARHFESRAQLVALTE
Q13VN3_PARXL          ---------MKTIPGPVMLDVVGKTLNDDDKRRLAHPMTGGVILFARHYESRAQLIALTD
D0J1I6_COMT2          ----------MSMHAPLIIDIAGTSLTDVDRARLAHPLVGGIILFKRNWEDRSALVQLCA
A1WKD5_VEREI          ----------MTGHAPLILDLEGKELGAAERRRLAHPLTGGVILFARNWENRAQLLQLTR
Q47EF2_DECAR          --------MMHLPLGPLMIDITGTELTDLDRERLCHSLVGGIILFSRNYANQDQLLELCS
NAGZ_NITEU            -----------MSLGPLMLDIAGTELTETDRVRLSHPLVGGVILFARNYASPAQLAGLTA
B7J918_ACIF2          --MPVRNERRHPARGPLMVDIAGLRPTAAECAMLRQPAVGGVILFARNCADAGQVRALCA
NAGZ_NITOC            -----------MTLGPLMIDLKGVTLDSEERAWLGHSWVGGVILFSRNYESPEQIAALIK
NAGZ_METCA            -----------------MFDLVGPRLSADEREFLCHPAAGGLILFSRNYASPDQMLALVS
A9KE25_COXBN          -------------MGFAIIDLEGVALSPQERELLQHPQVAGVILFTRNYENPSQLRSLIQ
D3HP45_LEGLN          --------MPGSNSNLFMIDLEGTELSDIERKILKHPNLGAVILFTRNFANPEQLEKLTS
                                         .  .          *      .:::* *:      :  *  

NAGZ_SHIFL            QIRAASRNHLVVAVDQEGGRVQRFR-EGFTRLPAAQSFAA-LLGMEEG------------
NAGZ_ECOLI            QIRAASRNRLVVAVDQEGGRVQRFR-EGFTRLPAAQSFAA-LSGMEEG------------
NAGZ_SHIDS            QIRAASRNHLVVAVDQEGGRVQRFR-EGFTRLPAAQSFAA-LLGMEEG------------
NAGZ_SALTY            QIRAASRNHLVVAVDQEGGRVQRFR-EGFTRLPAAQSFFA-LHGLEEG------------
NAGZ_YERPE            QIRAASHERLVVAVDQEGGRVQRFR-DGFTRLPAAQYFAA-INDAATA------------
NAGZ_PECAS            QIRAASHERLVVSVDQEGGRVQRFR-DGFTRLPAAQAFAA-LNSVSEA------------
NAGZ_PHOLL            QIRKASRHRLVIAVDQEGGRVQRFR-EGFTCLPAAQSFAG-LSDNLNG------------
NAGZ_VIBCH            AIRQAAKRPILIGVDQEGGRVQRFR-EGFSRIPPAQYYAR-AENGVE-------------
Q5E083_ALIF1          SIRKAAGRPILIGVDQEGGRVQRFR-DEFTLIPPAQAYAE-MDNGLE-------------
NAGZ_HAEIN            SVRQRVKKPLLITVDQEGGRVQRFR-DGFTMLPSMQAFQETLSATE-Q------------
NAGZ_MANSM            DIRRRVKKPLLITVDQEGGRVQRFR-EGFTQLPAMQSFAAMISDPALQ------------
NAGZ_HAES1            SVRQKVKKPLLITVDQEGGRVQRFR-QGFTQLPAMQSFACLLSDPQEQ------------
NAGZ_HISS2            SVRQKVKKPLLITVDQEGGRVQRFR-QGLTQLPAMQSFACLLSDPQEQ------------
NAGZ_IDILO            EARAAAAKPLLIAVDHEGGRVQRFR-EGFSAIPSMGSLQK-IENEDER------------
NAGZ_SHEON            QIRQI-RPEILIAVDHEGGRVQRFR-EGFTLIPAMGDILPAAKGDMALA-----------
NAGZ_SHESA            QIRQI-RPEILIAVDHEGGRVQRFR-EGFTLIPAMGDILPAAKGDMVIA-----------
NAGZ_SHEFN            SVRSI-RPELLIAVDHEGGRVQRFR-EGFSLIPAMGDILPAAKGDLTLA-----------
K0E9F5_ALTMB          DIRRFAKRPVLIAVDHEGGRVQRFR-EGFTAIPAIGDILRQSE-HQDES-----------
A5WC78_PSYWF          EIHQQ-QPDIIIGVDQEGGRVARLR-QGFTPLPAMGKLGDLFDSDPCGA-----------
A0A0D7R7J0_ACIBA      HMRQV-RPDILIAVDQEGGRVQRLK-SGFTLLPAMGRFGELYITQPQKA-----------
NAGZ_PSEAE            AIRAI-RPDLLLAVDQEGGRVQRLR-QGFVRLPAMRAIAD----NP-NA-----------
NAGZ_XANCP            AIRAAAPRPQLICVDQEGGRVQRFR-EGYSALAPLQSFGALYATDP------------EG
NAGZ_XANAC            AIRAAAPRPVLICVDQEGGRVQRFR-EGFSALAPLQSFGAQYAQDP------------EA
NAGZ_XYLFA            ALREATPRPLLLAVDQEGGRVQRFH-EGYSALPPLQGVGALYARDP------------EA
NAGZ_XYLFM            ALREAAPRPLLLAVDQEGGRVQRFY-EGYSALPPLQGIGALYVRDP------------EA
H8KYA4_FRAAD          SIREIAGEDFLIAVDHEGGPVQRFR-EGFTALPALASLGAAWDRAP------------GE
A1WWH4_HALHL          SIHAVREPPLLVAVDQEGGRVQRFR-EGFTPLPAASWFGRLYDLDP------------DQ
NAGZ_NEIMA            EIKALRTPELIIAVDHEGGRVQRFI-EGFTRLPAMNVLGQIWDKDG-----------ASA
NAGZ_NEIMB            EIKALRTPELIIAVDHEGGRVQRFI-EGFTRLPAMSTLGEIWDKDG-----------ASA
NAGZ_NEIG1            EIKALRTPELIIAVDHEGGRVQRFI-EGFTRLPAMNVLGQIWDKDG-----------ASA
NAGZ_CHRVO            EIRALRTPHLLIAVDHEGGRVQRFL-DGFTRLPPMRVLGEAWDAD------------RDQ
NAGZ_BORPA            AIHKARKEPLLIAVDHEGGRVQRFRDDGFTALPPMQELGKLWDRDP------------LA
NAGZ_BORPE            AIHKARKEPLLIAVDHEGGRVQRFRDDGFTALPPMQELGKLWDRDP------------LA
NAGZ_AROAE            EIHALRSPALIIAVDHEGGRVQRFRTDGFTRIPSMRCLGRLWERDH------------VA
A4JCR6_BURVG          SIRAVR-EDILIAVDHEGGRVQRFRTDGFTVLPAMRRLGDLWDRDV------------LL
A2SA00_BURM9          AIRAIR-DGILIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDV------------LH
Q13VN3_PARXL          SIRAIR-EDLLIAVDHEGGRVQRFRTDGFTVLPAMGKLGTLWDSDV------------LH
D0J1I6_COMT2          DIKAVK-PDLLISVDHEGGRVQRFRTDGFTHLPPMRAFGEMWMDDGGKGRKYREGSGAMR
A1WKD5_VEREI          AIEAVR-ADLLICVDHEGGRVQRFCGDGFTRLPAMRTLGAMWMDDG-RG---APGSGALR
Q47EF2_DECAR          AIHTLRSPSLLIAVDHEGGRVQRFR-DGFTRLPPMATLGKLWDRDP------------QA
NAGZ_NITEU            EIHALRYPSLLIAVDQEGGRVQRFR-DGFARLPPMRVLGEICDRNP------------DR
B7J918_ACIF2          ELHALRTTPLLVGIDQEGGRVQRLR-AGVTRFPPMATLGRLADRDG-----------LER
NAGZ_NITOC            AVHALKEPRLLVAVDHEGGRVQRFR-DGFTLLPPASLLGKLYDRDQ------------RQ
NAGZ_METCA            EVRSLR-PDMLIAVDHEGGRVQRFR-EGFTRLPPASAYLEVAGEAG--------------
A9KE25_COXBN          TIKKI--RPLFVAVDQEGGRVQRFH-RGFTDLPSMRYFGECYQHDPLQ------------
D3HP45_LEGLN          EIHAL-NPDIFIATDHEGGFIQRFLRHGFRALPAARVYGDVYDLSPEAG-----------
                        .       .:  *:*** : *:       :..                          

NAGZ_SHIFL            -GKLAQEAGWLMASEMIAMDIDISFAPVLDVG-HISAAIG-ERSYHADPQKALAIASRFI
NAGZ_ECOLI            -GKLAQEAGWLMASEMIAMDIDISFAPVLDVG-HISAAIG-ERSYHADPQKALAIASRFI
NAGZ_SHIDS            -GKLAQEAGWLMASEMIAMDIDISFAPVLDVG-HISAAIG-ERSYHADPEKALAIASRFI
NAGZ_SALTY            -GRLAQEAGWLMASEMIAMDIDISFAPVLDVG-HISAAIG-ERSYHADPAKALAMATRFI
NAGZ_YERPE            -AQLAQEAGWLMAAEMMAMDIDISFAPVLDIG-HVSAAIG-ERSFHSDPQQARIMAECFI
NAGZ_PECAS            -QRLAEEGGWLMAAEMIAMDIDISFAPVLDIG-HQSAAIG-ERSFHEQPEMALAVAQSFI
NAGZ_PHOLL            -TQLAEEAGWLMASEMIAMDIDISFAPVLDLG-HQCAAIG-ERSFHEDPEQAKMMAEHFI
NAGZ_VIBCH            ---LAEQGGWLMAAELIAHDVDLSFAPVLDMG-FACKAIG-NRAFGEDVQTVLKHSSAFL
Q5E083_ALIF1          ---LAKTAGWLLCAELVAHDIDLTFAPVLDNG-FDCKAIG-NRAFGDDINTIVKYSTAFM
NAGZ_HAEIN            -VSFAKEAGWQMAAEMIALDIDLSFAPVLDLG-HECRAIG-DRSFSSDVKSAVNLATAFI
NAGZ_MANSM            -LTTAKEAGWLMAAEMTALDIDLSFAPVLDLG-HECKAIG-DRSFCEEVEPAVRLASAFI
NAGZ_HAES1            -QEMAWRAGWQMAAEMTALDIDLSFAPVLDLG-HQCKAIG-DRSFHYEEKKLIELAEKFI
NAGZ_HISS2            -QEMAWRAGWQMAAEMTALDIDLSFAPVLDLG-HQCKAIG-DRSFHYEEKKLIELAEKFI
NAGZ_IDILO            -QRAARDLGWLMAAEVQAVGIDISFAPVLDVD-DCSDVIG-DRAFSAVPSEISKLASSFI
NAGZ_SHEON            -KRWACELGFLMAIELLACDIDLSFAPVLDLN-GISQVIG-KRSFSANPDEVIALARSFI
NAGZ_SHESA            -KRWACELGFLMAIELLACDIDLSFAPVLDLN-GISQVIG-KRSFSAKPEEVIALAQSFI
NAGZ_SHEFN            -KQWAKECGFLMAVELLACDIDLSFAPVLDVN-GISEVIG-KRSFSAVPDEVSALAQQFI
K0E9F5_ALTMB          -AAYAKACGLVLAYELKTLDIDFSFAPVLDIN-GVSQVIG-DRAFSDNADDVIRLAAYLI
A5WC78_PSYWF          -LSLAYDCGYLMAAEVMAVGIDISFAPVLDIN-GVSQVIG-DRSFHARTEAIVALSSQFM
A0A0D7R7J0_ACIBA      -LELAEQCGWLMATEVLAVGIDFSFAPVLDLN-AISDVIG-DRGFSKNIEDIAPLAGAFM
NAGZ_PSEAE            -EELAEHCGWLMATEVQAVGLDLSFAPVLDLDHQRSAVVG-SRAFEGDPERAALLAGAFI
NAGZ_XANCP            ALAQARAHAQLMASEVRASGVDLSFAPVVDLARG-NRAIG-DRAFSDDPQVVASFTRAYV
NAGZ_XANAC            ALAAARAHAQLMASEVRASGVDLSFAPVVDLGRG-NRAIG-DRAFSDEPQIVATFTRAYV
NAGZ_XYLFA            ALELAFEHAWLMASEVRASGVDLSFAPVIDLGRG-NRAIG-NRAFSDDPHVVAAFARAYV
NAGZ_XYLFM            ALELAFEHAWLMASEVRASGVDLSFAPVVDLGRG-NRAIG-DRAFSDDPHVVAAFAQAYV
H8KYA4_FRAAD          AVQLAEEHAWLMASELRACGIDFSFAPVADLARG-NAAIG-RRAFHADPEVTAELVQAYM
A1WWH4_HALHL          ARQSAHRAGWVMAAELRACGVDLSFAPVLDLDGGVSHVIG-SRALHREPAAVARLGHAWM
NAGZ_NEIMA            AETAARQIGWVLATELSACGIDLSFTPVLDLDWGNCAVIG-NRSFHRNPEAVARLALALQ
NAGZ_NEIMB            AETAAGQVGRVLATELSACGIDLSFTPVLDLDWGNCPVIG-NRSFHRNPEAVARLALALQ
NAGZ_NEIG1            AETAAGQVGRVLATELSACGIDLSFTPVLDLDWGNCAVIG-NRSFHRNPEAVARLALALQ
NAGZ_CHRVO            ALKLAETVGYVLAAELSACGIDLSFTPVLDLDWERCAVIG-NRAFHRDPEAVSALAEALQ
NAGZ_BORPA            AMRLATEAGYVLAAELRACGVDLSFTPVLDLDYGVSKVIG-NRAFHHDARVVTMLSRALA
NAGZ_BORPE            AMRLATEAGYVLAAELRACGVDLSFTPVLDLDYGVSKVIG-NRAFHHDARVVTMLSRALT
NAGZ_AROAE            ALESARCAGYVLAAELLAHGVDLSFTPVLDLDYGCSRVVG-DRAFHRDPLVVAALAQSLV
A4JCR6_BURVG          ATKVATAVGYILAAELRACGIDMSFTPVLDLDYGHSKVIG-DRAFHRDPRVVTLLAKSLN
A2SA00_BURM9          ATKAATALGYVLASELRACGIDMSFTPVLDLDYGRSKVIG-DRAFHRDPRVVALLAKSVN
Q13VN3_PARXL          ATKVTTAVGYILAAELRACGIDMSFTPVLDLNYGQSQVIG-DRSFHRDPRVVTLLAKSLN
D0J1I6_COMT2          AMNAATAAGYVLGTELRACGVDFSFTPVLDLDYGESSVIG-DRSFHRDPRVVATLARSLM
A1WKD5_VEREI          ATNAATAIGHVLGAELRACGVDLSFTPVLDLAWGRSSVIG-DRALHRDPRVVALLAKSLM
Q47EF2_DECAR          ALVATRQTGYVLAAELRARGVDYSFTPVLDLDYGPSRVIG-DRAFHRQPDAVIALAAALG
NAGZ_NITEU            AHHLASQAGYVLAAELKACGVDLSFTPVLDLDYGQSCVIG-DRAFHREPQVVADLACALM
B7J918_ACIF2          ALVAAEDWGLLLGTELRALGVDLDFTPCVDLDRGISAVIG-DRAIHRDPVWVGAIAAALW
NAGZ_NITOC            AQRLAMITGWLMAVELRAVGVDFSFSPVLDLDRGVSAVIG-DRAFHGEPDAVIALARAYI
NAGZ_METCA            -LAAAETAGWLMAAELRAVGVDFSFAPVLDVDSGISTVIG-DRAFARTPEEVTAAARAFA
A9KE25_COXBN          ARKHLENALKTVVHELKEVGIDVNMTPVLDIDQGKNEIIG-ERSFSGDPRVVEALGSVVI
D3HP45_LEGLN          -IKLARQYGEVMAKDLLTCGVDLSLAPVLDLHDMSPIIAHLDRSFHHDPDAVTALANAFI
                                 :  ::   .:*  ::*  *            *.                

NAGZ_SHIFL            DGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPRPQAEIRAKDMSVFSSLIRENKLDAIM
NAGZ_ECOLI            DGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPRPQAEIRAKDMSVFSSLIRENKLDAIM
NAGZ_SHIDS            DGMHEAGMKTTGKHFPGHGAVTADSHKETPCDPRPQAEIRAKDMSVFSTLIRENKLDAIM
NAGZ_SALTY            DGMHDAGMKTTGKHFPGHGAVTADSHKETPCDPRPETDIRGKDMSVFRTLISENKLDAIM
NAGZ_YERPE            RGMHSAGMKTTGKHFPGHGAVTADSHKETPHDNRPLAEIRTHDMVIFRELIQRKLLDAIM
NAGZ_PECAS            RGMHSAGMKVTGKHFPGHGAVSADSHKETPRDPRPLAEIRAHDMLIFKALIQSQQLDAIM
NAGZ_PHOLL            KGMHSAGMKSTGKHFPGHGAVNADSHKETPCDDRPLEVICHHDMSIFRDFIQRNLLDAIM
NAGZ_VIBCH            RGMKAVGMATTGKHFPGHGAVIADSHLETPYDERE---TIAQDMAIFRAQIEAGVLDAMM
Q5E083_ALIF1          QGMKSAGTSTTGKHFPGHGGVIADSHLETPYDNRNN--IFELDMAIFKAQIEAGILDAMM
NAGZ_HAEIN            DGMHQAGMASTGKHFPGHGHVLADSHLETPYDDRTKEEIFSGDLQPFQQLISQNKLDAIM
NAGZ_MANSM            DGMHQAGMATTGKHFPGHGHVLADSHLETPYDERPSAVIFERDIQPFQQLIAQNKLDAVM
NAGZ_HAES1            QGMRQIGMSATGKHFPGHGHVLADSHLETPYDDRAKELIFAQDIRPFQSLIKQGLLDAVM
NAGZ_HISS2            QGMRQIGMSATGKHFPGHGHVLADSHLETPYDDRAKELIFAQDIRPFQSLIKQGLLDAVM
NAGZ_IDILO            EGMHEAGMACTGKHFPGHGSVQADSHIAIPEDDRTLEQIRAHDLKPFLSLIQK--LDGIM
NAGZ_SHEON            EGMAQAGMGAVGKHFPGHGSVAADSHIAQPIDEREGEVIFNQDILPFKELIFNGKLSGIM
NAGZ_SHESA            EGMAEAGMGAVGKHFPGHGSVAADSHIAQPIDEREAEAIFNQDILPFKDLIAMGKLSGIM
NAGZ_SHEFN            IGMNEAGMAAVGKHFPGHGSVAADSHIAMPVDPRTKEQVEAFDMQPFKHLIGSQQLQGVM
K0E9F5_ALTMB          QGLKAVNMPAIGKHFPGHGSVAPDSHVALPVDEREFDEIRSTDMVVFERLIERALLDGVM
A5WC78_PSYWF          RGMKAAGMATTGKHFPGHGSIAPDSHVADVIDNRSFEQIKAVDLQPFIQCQPW--LDALM
A0A0D7R7J0_ACIBA      RGMKKAGMANTGKHFPGHGSVKADSHVAAAIDSRSYDEIYNHDMQSFIKLMPE--LDALM
NAGZ_PSEAE            RGMHAAGMAATGKHFPGHGWAEADSHVAIPEDARSLEEIRRSDLVPFARLAGQ--LDALM
NAGZ_XANCP            QALHAAGMGATLKHFPGHGTVLEDTHVDHASDPRPLDVLLAEDLVPFVAGIDA-GADAVM
NAGZ_XANAC            QALHGAGMAATLKHFPGHGTVLEDTHVDHASDPRPLEVLQAEDLVPFVAGIEA-GADAVM
NAGZ_XYLFA            QGMHAAGMPVTLKHFPGHGSVLEDTHVDLAVDVRPLETLECEDLVPFAAGIAA-GADAVM
NAGZ_XYLFM            QGMHAAGMPVTLKHFPGHGSVLEDTHVDLAVDVRPLETLESEDLVPFAAGIAA-GADAVM
H8KYA4_FRAAD          RGLHLGGTAAVLKHFPGHGSVQADTHVAMAVDPRPLELIRRDDLRPFAEAIMM-RAEAVM
A1WWH4_HALHL          RGMRQAGMAAVGKHFPGHGSVEADSHVALPCDDRSLAEIARRDLVPFQRLAAS-GLPGVM
NAGZ_NEIMA            KGLEKGGMKSCGKHFPGHGFVEGDSHLVLPEDGRSLSELEAADLAPFRIMSRE-GMAAVM
NAGZ_NEIMB            KGLTKGGMKSCGKHFPGHGFVEGDSHLVLPEDWRSLSELETADLAPFRIMSRE-GMAAVM
NAGZ_NEIG1            KGLAKGGMKSCGKHFPGHGFVEGDSHLVLPEDGRSLDELEAADLAPFRIMSRE-GMAAVM
NAGZ_CHRVO            QGLGRGGMMSCGKHYPGHGYVEGDSHHLMPQDDRTLAQIEQDDLVPFARLADA-GMGAVM
NAGZ_BORPA            QGLALAGMAACGKHFPGHGFVGADSHHEIPVDPRPLARILKDDAAPYAWLGDL-VMPAVM
NAGZ_BORPE            QGLALAGMAACGKHFPGHGFVGADSHHEIPVDPRPLARILKDDAAPYAWLGDL-VMPAVM
NAGZ_AROAE            SGMADAGMGCVGKHFPGHGYAEADSHVEIPVDEREFDAIWTEDIAPYRHRLGR-QLAGVM
A4JCR6_BURVG          HGLSLAGMANCGKHFPGHGFAEADSHVALPTDDRPLDAILEGDVAPYDWL-GL-SLSAVI
A2SA00_BURM9          HGLALAGMANCGKHFPGHGFAQADSHVALPTDDRPLDEILANDAAPYDWL-GL-SLSAVI
Q13VN3_PARXL          HGLALAGMSNCGKHFPGHGFAQADSHVAMPIDDRSLDEILRDDAAPYDWL-GL-SLGSVI
D0J1I6_COMT2          QGLLQAGMGNCGKHFPGHGFVKADSHVDIPVDKRSLTAILDEDAAPYPWL-SS-VLTAVM
A1WKD5_VEREI          HGLLQVGMAHCGKHFPGHGFARADSHTGLPVDRRSLRAILADDAAPYQWL-SS-TLASVM
Q47EF2_DECAR          EGLRQAGMGSCGKHYPGHGYVIPDSHVELPVDDRAFEAM-QEDIAPYRNL----PLDGVM
NAGZ_NITEU            NGLQSAGMAAVGKHFPGHGAIRADTHVETAIDTRSYTDIEKEDLIPFRRMIDA-GLSGIM
B7J918_ACIF2          KGMARTGLQGVAKHFPGHGAVAADSHLDLPLDDRPFSAI-QEDLQPFAALIAA-GIPAIM
NAGZ_NITOC            RGMAWAGMAAVGKHFPGHGSVVADSHTALPVDKRSWRQIREGDLLPFEHLARA-GLPAVM
NAGZ_METCA            TGMRRAGMAAVGKHFPGHGGVAGDSHLVLPEDRRELEELLARDLLPFSALIRE-NLEGIM
A9KE25_COXBN          DTLHANRMPAVAKHFPGHGGVTADSHQALPIDERDPEAILQCDWLPFSALSSR--LDAIM
D3HP45_LEGLN          EGMNTVGMPAVGKHFPGHGRISSDSHTTMPVSTASFDQLKSRDLKPFIELISNERLSAIM
                        :         **:****    *:*     .          *   :          .::

NAGZ_SHIFL            PAHVIYSDVD-PRPASGSPYWLKTVLRQELGFDGVIFSDDLSMEGAA----IMGSYAERG
NAGZ_ECOLI            PAHVIYSDVD-PRPASGSPYWLKTVLRQELGFDGVIFSDDLSMEGAA----IMGSYAERG
NAGZ_SHIDS            PAHVIYSDVD-PRPASGSSYWLKTVLRQELGFDGVIFSDDLSMEGAA----IMGSYAERG
NAGZ_SALTY            PAHVIYRAID-PRPASGSPYWLKTVLRQELGFDGVIFSDDLSMEGAA----IMGSYAERA
NAGZ_YERPE            PAHVIYTEAD-ARPASGSAYWLQEILRQELGFEGIIFSDDLSMEGAA----IMGSYAERG
NAGZ_PECAS            PAHVIYTEAD-PHPASGSSYWLKTVLREELGFDGIIFSDDLSMEGAA----VMGSYPERA
NAGZ_PHOLL            PAHVIYPQVD-KHPASGSSYWLKSVLRQQLGFNGVIFSDDLSMEGAA----MMGSYVERG
NAGZ_VIBCH            PAHVVYPHYD-AQPASGSSYWLKQVLREELGFKGIVFSDDLSMEGAA----VMGGPVERS
Q5E083_ALIF1          PAHVIYPEYD-SSPASGSSYWLKDVLRKQLSFNGLVFSDDLSMEGAT----IMGGPAERS
NAGZ_HAEIN            PAHVIYSQCD-SQPASGSKYWLKEILRKKLNFQGTIFSDDLGMKGAG----VMGNFVERS
NAGZ_MANSM            PAHVIYRHCD-SQPASGSKYWLQDILRQKLGFDGTVFSDDLGMKGAG----FMGDFVARS
NAGZ_HAES1            PAHVIYTQCD-NQPASGSSYWLKEVLRQQLGFQGAIFSDDLGMKGAG----FMGDFVARC
NAGZ_HISS2            PAHVIYTQCD-NQPASGSSYWLKEVLRQQLGFQGAIFSDDLGMKGAG----FMGDFVARC
NAGZ_IDILO            PAHVIYPQID-PQPAGFSEFWLQQILRSELQFNGTIFSDDLSMQGAT----VAGDMEQRA
NAGZ_SHEON            PAHVIYPKVD-PNPAGFSSYWLKQILRKELGFNGVIFSDDLGMKGAS----FAGDYVGRA
NAGZ_SHESA            PAHVIYPKVD-PNPAGFSSYWLKQILRKELGFNGVIFSDDLGMKGAS----IAGDYLGRA
NAGZ_SHEFN            PAHVVYSNID-PNPAGFSSYWLQTILRQQLGFDGVIFSDDLGMKGAS----FAGNYLGRA
K0E9F5_ALTMB          PAHVIYNQVC-DKPAGFSTKWLQDILKQDLGFGGAVFSDDLSMHGAS----VAGSYVERA
A5WC78_PSYWF          PAHVIFSQVD-DKPAGFSKVWLQDIAREQLGFNGVLFSDDLSMKAAH----VAGDVSARV
A0A0D7R7J0_ACIBA      PAHVIYDQVD-PNPAGFSPFWIQEVLRNRLKFNGVLFSDDLSMQAAC----VAGGADARI
NAGZ_PSEAE            PAHVIYPQVD-PQPAGFSRRWLQEILRGELKFDGVIFSDDLSMAGAH----VVGDAASRI
NAGZ_XANCP            MAHVVYPQVA-PEPAGYASRWIEQILRGQLGFRGVVFSDDIGMAASF----SAGGVAGRV
NAGZ_XANAC            MAHVVYPQVA-PEPAGYSQRWIEQILRGQMGFRGVVFSDDIGMAASF----SAGGVAGRV
NAGZ_XYLFA            MAHVVYPNVA-PEPAGFSAHWIEVILRGRMGFRGVVFSDDIGMAAVR----GVGSVAGCV
NAGZ_XYLFM            MAHVVYPNVA-PETAGFSAHWIEVILRGRMGFRGVVFSDDIGMAAVR----GVGGVVGCV
H8KYA4_FRAAD          MAHVVYPDVD-GRPAGYSRRWIGEVLRGELGFKGIVFSDDISMAAAG----EAGDVAARV
A1WWH4_HALHL          AAHLVVPDVD-DRPAGFSPRWIGDILRRRVGFLGAVFSDDLGMRGAE----TAGTMFDRV
NAGZ_NEIMA            PAHVVYPQVD-TKPAGFSEIWLKQILRRDIGFKGVIFSDDLTMEGAC----GAGGIKERA
NAGZ_NEIMB            PAHVVYPQVD-TKPAGFSEIWLKQILRRDIGFKGVIFSDDLTMEGAC----GAGGIKERA
NAGZ_NEIG1            PAHVVYPQVD-TKPAGFSEIWLKQILRRDIGFKGVIFSDDLTMEGAC----GAGGIKERA
NAGZ_CHRVO            PAHVLYPAVD-SQPAGFSKVWLTDILRGRIGFDGVIFSDALDMAGAA----GAGTYVQRA
NAGZ_BORPA            PAHVIYPKVD-AQPAGFSRRWVSEILRERLGYDGVVFSDDLTMEGAS----VAGDILARA
NAGZ_BORPE            PAHVIYPKVD-AQPAGFSRRWVSEILRERLGYDGVVFSDDLTMEGAS----VAGDILARA
NAGZ_AROAE            PAHVIYPRVD-PNPAGFSRFWLQDILRGRVGFGGVIFSDDLTMEGAT----VVGDILARA
A4JCR6_BURVG          PAHVIYTQVD-PRPAGFSRVWLQDILRGRLGFTGAIFSDDLSMEAAR--EGG--TLTQAA
A2SA00_BURM9          PAHVIYTQVD-SKPAGFSRVWLQDVLRGRLRFAGAVFSDDLSMEAAR--EGG--TLAQSA
Q13VN3_PARXL          PAHVVYPKVD-SKPAGFSRIWLQDILRNKLRFEGAIFSDDLSMEAAR--QGG--TLTEGA
D0J1I6_COMT2          PAHVIYPKVD-KRPAGFSGKWLKDILRARLRYDGAIFSDDLSMEGARRIDGALISYTDAA
A1WKD5_VEREI          PAHVLYPRVD-SRPAGFSQRWLQDILRRQLRFAGAIFSDDLGMEGARCIDGRRVSHTDAA
Q47EF2_DECAR          AAHVIYNCMD-CNTAVFSNKWIS-YLRNDIKFNGAVFTDDLSMAGAG----VVGGMLSRV
NAGZ_NITEU            AAHVIYPAID-QHSAGFSSRWLQRILRHDLGFEGCIFSDDLGMQAAR----NYGSITRRA
B7J918_ACIF2          PAHCLYPRVDGEHPAGFSPRWLQDVLRKEMGFTGVVVSDDLSMAGAH----GAGGVAARV
NAGZ_NITOC            PAHVRYASVD-SRPVGFSPFWLETVLRGQLGFQGAIISDDLSMAGAA----EVGDMSARM
NAGZ_METCA            PAHVLYSRID-ARPPCFSPFWLQTILRERMNFDGAIFSDDLSMAGAA----VAGDYAARA
A9KE25_COXBN          PAHIIYPAFD-EKPATFSRYWLQDMLRQRLNFRGVIISDDLTMQGAA----VIGDYPTRA
D3HP45_LEGLN          PAHVTYKAVDANKPAGFSAIWLQEILRHELGFTGLILSDCLSMTGAD-----IGNLKTRA
                       **          .   :  *:    :  : : * :.:* : * .               

NAGZ_SHIFL            QASLDAGCDMILVCNN-----------RKGAVSVLDNLSPIKAE--------RVTRLYHK
NAGZ_ECOLI            QASLDAGCDMILVCNN-----------RKGAVSVLDNLSPIKAE--------RVTRLYHK
NAGZ_SHIDS            QASLDAGCDMILVCNN-----------RKGAVSVLDNLSPIKAE--------RVTRLYHK
NAGZ_SALTY            QASLDAGCDMILVCNN-----------RKGAVSVLDNLSPIKAE--------RVTRLYHK
NAGZ_YERPE            QASLDAGCDMILVCNN-----------RQGAVSVLDNLSPIKAD--------QLTRLYHS
NAGZ_PECAS            QAALQAGCDMILVCNH-----------REGAISVLDNLSPVKAE--------QLTRLYHQ
NAGZ_PHOLL            QTALNAGCDMILICNN-----------RDGAVSALDNLPLTKVE--------KLSELYHR
NAGZ_VIBCH            HQALVAGCDMILICNK-----------REAAVEVLDNLPIMEVP--------QAEALLKK
Q5E083_ALIF1          QQALDAGCDMVLMCNN-----------RKSAVEVLDNLAIQSVA--------KADALLKT
NAGZ_HAEIN            KKALNAGCDLLLLCNE-----------REGVIQVLDNLKLTENQPHFMARQARLQSLFKR
NAGZ_MANSM            EKALSAGCDLLLLCNE-----------PEGVVQVLDNLKLEENPPHFAARQRRLQSLFKK
NAGZ_HAES1            TQSLQAGCDLLLLCNE-----------PEAVVQVLDRFKPQESQNKRIIRQTRLNKLFKK
NAGZ_HISS2            TQSLQAGCDLLLLCNE-----------PEAVVQVLDRFKPQESQNKRIIRQTRLNKLFKK
NAGZ_IDILO            VAALKAGCDMILVCND-----------RAGAVQVLDADLPATEPES----AQRVNRMLMS
NAGZ_SHEON            KAALDAGCDMILVCND-----------NPGVMTLLNGFVWPEAAPQ------HPASLLKP
NAGZ_SHESA            QAALDAGCDMILVCND-----------NPGVMSLLNGFVWPASAPQ------HPASLLKP
NAGZ_SHEFN            KAALDAGCDMILVCND-----------SVGVNALLTEFDWPAAEPT------HTALSLKG
K0E9F5_ALTMB          EAALEAGCDMVLACNN-----------PKGAEAILDGLEKRFANPS------HNDLQKRE
A5WC78_PSYWF          TAALEAGCDMALVCND-----------REAALQAIQTSAQLPKPNQ-----TRLEAMRSQ
A0A0D7R7J0_ACIBA      QAALAAGCDMGLVCND-----------RSAACTALDGITNLELPNQ-----ERLERMRGR
NAGZ_PSEAE            EAALAAGCDMGLVCND-----------RASAELALAALQRLKVTPP-----SRLQRMRGK
NAGZ_XANCP            HAHLDAGCDVVLVCHP------------ELVAESLQAVAGR----TLNTA--ALIGLIGR
NAGZ_XANAC            HAHLDAGCDVVLVCHP------------ELVAESLQAVQGR----SLNTA--ALIGLIGR
NAGZ_XYLFA            HAHLDAGCDVVLVCHP------------ELVNDALSAVAGR----RSNTA--ALIGLIGR
NAGZ_XYLFM            HAHLDAGCDVVLVCHP------------ELVNDALSAVAGR----RSNTA--ALIGLIGR
H8KYA4_FRAAD          GAHLDAGCDLVLACFP------------EVVPDAIAAVADRV---CLSAE--RLAPLRGA
A1WWH4_HALHL          DACLGAGCDVALVCDP------------AEAEALLGEASGDRWLDPTSAL--RLVRMHGR
NAGZ_NEIMA            RISFEAGCDIVLVCNR-----------PDLVDELRDDFRIPD--NPALAQ--RWQYMANT
NAGZ_NEIMB            RISFEAGCDIVLVCNR-----------PDLVDELREDFRIPD--NPTLAQ--RWQYMANT
NAGZ_NEIG1            RISFEAGCDIVLVCNR-----------PDLVDELRDGFTIPD--NQDLAG--RWQYMENS
NAGZ_CHRVO            DAALAAGCDMVLVCNQ-----------PEEADAMLAALAPPP--QPQLAE--RLERMAGK
NAGZ_BORPA            EAALGAGCDMVLVCNR-----------PDLADELLDRLQVQH--PAASVE--RIRRLMPR
NAGZ_BORPE            EAALGAGCDMVLVC-R-----------PDLADELLDRLQVQH--PAASVE--RIRRLLPR
NAGZ_AROAE            RAAFGAGCDVVLVCNR-----------PDLAVDLLDRWAPDI--APESRA--RIEALRSR
A4JCR6_BURVG          DAALAAGCDMVLVCNQ-----------PEAAEVVLNELSARP--SPESVR--RIKRMRAR
A2SA00_BURM9          QAALEAGCDMVLVCNQ-----------PDAAERVLDELRTTA--SRESSR--RIKQMRPR
Q13VN3_PARXL          TAALQAGCDMVLICNQ-----------PDEAEKVLDALRFTP--SKESQR--RLKRMRPR
D0J1I6_COMT2          LTALNAGCDMVLLCNQSLGLGEHVDELLDGMDAALRDGRWVP--DIDSES--RRVSLLPD
A1WKD5_VEREI          IAALDAGCDLVLLCNQ--GQGLAVDELIAGLEQAQARGRWQP--SLVSES--RRLALRPA
Q47EF2_DECAR          ETAYAAGCDMLLVCNA-----------PDVVGDVLENWKPEI--DLRRGK--RVEALIPK
NAGZ_NITEU            EQALQAGCDMVLVCND-----------ADAADELLGSLHWEF--SAASLA--RVECMRGQ
B7J918_ACIF2          DAALTAGADLLLVCND-----------PEGAETAIAHVRSRD--ALPTGD--RLERLAGN
NAGZ_NITOC            QAALSAGCDMALVCND-----------PDGYALLLDELKGDP--YPQTSP--RLLRLYGR
NAGZ_METCA            LAALEAGCDMLVVCNT-----------PEATASILEALENRT-ASPGSTR--RLAAMCGR
A9KE25_COXBN          AQALEAGCDLLTICNS-----------REGVIAILDSLLHYR------------------
D3HP45_LEGLN          EEALNAGCDMLIVCHQ----------PRHILLELLQNVAFPQSDESAMRIIQFKSQMFRF
                           **.*:   *                                              

NAGZ_SHIFL            G----SFSRQELMDSARWKAISTRLNQLHERWQEEKAGH--------
NAGZ_ECOLI            G----SFSRQELMDSARWKAISTRLNQLHERWQEEKAGH--------
NAGZ_SHIDS            G----SFSRQELMDSARWKAISARLNQLHERWQEEKAGH--------
NAGZ_SALTY            G----SFSRRELMDSARWKTASAQLNQLHERWQEEKAGH--------
NAGZ_YERPE            G----QFDRQTLMASSRWQQANKALTALSERWDAHKQTLGQ------
NAGZ_PECAS            G----SFSRRELLDSPRWKLANQALTSLSERWQAHKNGEK-------
NAGZ_PHOLL            GG---QYSLNELKNSERWQQANKALTALYEQWQDCAR----------
NAGZ_VIBCH            Q----QFSYSELKRLERWQQASANMQRLIEQFSE-------------
Q5E083_ALIF1          Q----HFDRKTLLGTREWKEANELITRAYDGWKS-------------
NAGZ_HAEIN            R----VINWNDLISDQRWRLNYQKLADIQSRWLDIQAAKND------
NAGZ_MANSM            K----AFSWNELTKTRRWLENSKKLTALQQSWLDSK-----------
NAGZ_HAES1            Q----RIDWQTLRNQRDWLENHKKLTALQQDWLAYKGYDN-------
NAGZ_HISS2            Q----RIDWQTLRTQRDWLENHKKLTALQQDWLAYKG----------
NAGZ_IDILO            SN---AVSLEELKRTQRWEQAQRWL----------------------
NAGZ_SHEON            NM---AQTALALENSARWENAKQLAEQIQLAQQAKV-----------
NAGZ_SHESA            NA---AQTAIALENASRWENAKQLAEQIQLAQQAKV-----------
NAGZ_SHEFN            NT---AQASQALEQQTRWQAAQLLAMDITRIAQSL------------
K0E9F5_ALTMB          RV---MALYDRVMPAGLNDKYDSAVELVKRLSER-------------
A5WC78_PSYWF          LPTWQGSLEATCAQFDYWAVAKQNITQAFFNEPLVAAQATDPTDYKR
A0A0D7R7J0_ACIBA      IPQIQ--VGETLSLGNDWQAVKTAIEE--FKNSL-------------
NAGZ_PSEAE            -----GYANTDYRQQPRWLEALSALRAAQLID---------------
NAGZ_XANCP            ----GALGWDGLLADAP----TTSLSASFGTLA--------------
NAGZ_XANAC            ----GALGWDGLLAGTDA-SFTTPLSAHFGTTA--------------
NAGZ_XYLFA            ----GALGWDGLLADVRYGSIQSRLLERFGTST--------------
NAGZ_XYLFM            ----GALGWDGLLADVRYGSIQSRLFERFGTST--------------
H8KYA4_FRAAD          ----VASTWAGLLDNPQRQRFIARVTALESLS---------------
A1WWH4_HALHL          ----PAPGWPELRADGAYQTAVCELTEGVPGFGAPG-----------
NAGZ_NEIMA            L---GSAAAQAVIQTADFQAAQAFVAGLASPQDTAGGVKVGEAF---
NAGZ_NEIMB            L---GSAAAQAVMQTADFQAAQAFVAGLASPQDTAGGVKVGEAF---
NAGZ_NEIG1            L---GHEAVQAVMQTMGFQAAQAFVAGLASPQDTAGGVKVGEAF---
NAGZ_CHRVO            S---RAEDWQRLIATPDFAAAQAAVRQLAMPKDALAGPQVGEAH---
NAGZ_BORPA            F---AAPDWDTLQNDSRYQHARRLQSQIVSG----------------
NAGZ_BORPE            F---AAPDWDTLQNDSRYQHARRLQSQIVSG----------------
NAGZ_AROAE            P---QAADPFALELHPVYRQARDVVAGLVEDTA--------------
A4JCR6_BURVG          G---KALKWDKLIAQPEYLQARGLLTSVLA-----------------
A2SA00_BURM9          G---KALEWRKLMREPRYLNAQSLLRSTFA-----------------
Q13VN3_PARXL          G---KALKWSKLVAEPQYLQAQALLRSAFA-----------------
D0J1I6_COMT2          T---EPQAWDDLMRQPAYLQALDLLP---------------------
A1WKD5_VEREI          T---RAPDWDALMHQRAYRQARSALEVHD------------------
Q47EF2_DECAR          T---PAVPWQVLQADPAYQAAQKTIAELMA-----------------
NAGZ_NITEU            H---MIHSMAQLHEMERFLQAADEISKIDPAGISVSL----------
B7J918_ACIF2          A---ATAALSAADRVRCLQQIEELRALAPGYTD--------------
NAGZ_NITOC            ----YPLTRSQLYHNPAWQRAVQMLAAYGEF----------------
NAGZ_METCA            ----SRIDRDALLASSEWRNAVDRIHSFNDSAQ--------------
A9KE25_COXBN          ----NPESQQRLLSFSRFTTGG-------------------------
D3HP45_LEGLN          SHSEKNQVVPSLSHTLLGQQEHHTDCTSQNLQFNTSKTI--------