CLUSTAL format seed alignment for MF_00365

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECF_HAEIN      ----MAISRLLVEKFRNLTAVDLDFDPCFNFLIGNNGSGKTSLLEAIFYLGHGRSFKSAV
RECF_PASMU      ----MAISRLLIENFRNLTAVDLEFDHGFNFLVGNNGSGKTSLLEAIFYLGHGRSFKSAV
RECF_ACTPL      ----MPLSRLIINNFRNLQSLDLELSPNFNFIVGHNGSGKTSLLEAIFYLGHGRSFKSHI
RECF_ECOLI      ----MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQ
RECF_SALTY      ----MSLTRLLIKDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGRAFRSLQ
RECF_PROMI      ----MILSRLLIRHFRNIEQADLPLADGFNFLVGPNGSGKTSILEAIYTLGHGRAFRSAQ
RECF_VIBCH      ----MPLSRLMIQQFRNIKACDIRLSAGFNFLIGPNGSGKTSVLEAIYLLGHGRSFKSSL
RECF_PSEAE      ----MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSAR
RECF_PSEPU      ----MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSTR
RECF_METCA      ----MALLKLDIADVRNIESASLSPGEGLNLLFGANGSGKTSLLEAIYLLSRGKSFRSPQ
RECF_HYDCU      ---MSKILQFQLQHFRNIEQASLTFGEGLNLIVGDNAAGKTALIEAIWTLASGRSFRTAK
RECF_BACHD      ----MHIERLTLKQFRNYDELDVSFEPNVNVIIGENAQGKTNVIEAIYFLALAKSHRTAR
RECF_BACSU      ----MYIQNLELTSYRNYDHAELQFENKVNVIIGENAQGKTNLMEAIYVLSMAKSHRTSN
RECF_STAAM      ----MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSN
RECF_LACLA      ----MKLKAIELKNFRNYEELKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSH
RECF_STRP1      ----MWIKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRA
RECF_ACHLA      -----MITSIELRNFRNLENYKVLINRPLVIIQGLNGVGKTSILESIYFAATTKSHRSSV
RECF_MYCLE      ----MYVRHFGLRDFRSWDHVDLELNPGRTVFFGPNGNGKTNLIEALWYSTTLSSHRVGT
RECF_MYCPA      ----MYVRHLGLRDFRSWAHADLELQPGRTVFIGSNGFGKTNLLEALWYSSTLGSHRVGT
RECF_MYCTU      ----MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWYSTTLGSHRVSA
RECF_MYCSM      ----MFARHLGLTDFRSWARVDLDLEPGRTVFVGPNGFGKTNLVEALWYSATLGSHRVAT
RECF_STRCO      ----MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSS
RECF_SYNY3      ----MYLKKLYLRAFRNYLEEEVEFSAQKTILVGNNAQGKSNLLEAVELLATLKSHRTSR
RECF_CHLMU      ----MRVHSLFLKDFRNYSELRLELGPEMNSIFGLNAQGKTNILEALYILSLGRSFRTSR
RECF_CHLTR      ----MRVLSLFLKDFRNYTDLRLELGPEMNSIFGLNAQGKTNLLEALYILSLGRSFRTSR
RECF_RICBR      -MKNIFLHSLIVENYRNFKNLELKTDNIPITIIGENGSGKTNILEAISLFYPGRGLRSAR
RECF_RICPR      -MKNIFLHSLTLENYRNFKNLELKTDNTPIILTGENGSGKTNILEAISLFYPGRGLRSSK
RECF_CAUVC      MASAALLS-LTLADFRSYERARLETGGRSVYLFGANGAGKTNLLEAISLLSPGKGLRGVS
RECF_RHIME      MPHKVFLTRLKLSDFRNYATLALDLDQRHVVLTGENGAGKTNLMEGVSFLSPGRGLRRAA
RECF_DEIRA      -MGDVRLSALSTLNYRNLAPGTLNFPEGVTGIYGENGAGKTNLLEAAYLALTGQTDAPRI
RECF_ACIAD      ----MQITRLNIERVRNLKAVALSGLQPFNIFYGANGSGKTSILEAVHLLATGRSFRTHM
RECF_XYLFA      ----MHITQLVLRHFRCFDAVDFFPLPGLNFFIGENGSGKTSLLEAVHLMGYGRSFRGRV
RECF_TREPA      ---------MTAINFRNLAHHTIDISSPEVFFVGNNGQGKTNILEVLYLAAYGNSFRTRT
                         .     *               : * *. **: .:*               

RECF_HAEIN      TNRIIS----YDEPHFTLFGQIQE-----SQHQWSIGLQKLRQGNTLVKINGEDGNKISD
RECF_PASMU      SNRIIS----YEQPHFILHAKIQE-----QAHQWSVGLQKLRQGNSVVKINGEDGNKIAD
RECF_ACTPL      SNRIIH----YQAEDFVLHARIDE-----GQHQWSVGIQKKRSGDTLLKINGEDGNKISD
RECF_ECOLI      IGRVIR----HEQEAFVLHGRLQG-----EERETAIGLTKDKQGDSKVRIDGTDGHKVAE
RECF_SALTY      PGRVIR----HEQEAFVLHGRLQS-----EERETSIGLTKDKQGDSKVRIDGTDGHKIAE
RECF_PROMI      ANRVIQ----HDENAFILHGRLSGLDE--ESRGYSIGLSKDREGNSTVRIDGSDGHKIAE
RECF_VIBCH      TGRIIQ----NECSELFVHGRICEHSLSSDQFELPVGINKQRDGSTEVKIGGQTGQKLAQ
RECF_PSEAE      LQPVIQ----YEEAACTVFGQVMLA----NGIASNLGISRERQGEFTIRIDGQNARSAAQ
RECF_PSEPU      LNPVIQ----YEQAACTVFGEVQLT----EGGTSNLGVSRERQGEFTIRIDGQNARQA-Q
RECF_METCA      SGRIIR----FDRPCLTVSGSIGR-----PGAGIAVGVRLGRS-EKEVRVGGRSCDSSAQ
RECF_HYDCU      PHQLIQ----QNQSELVLFGTLTE-----ADRIHKIGLA-RTSDKVTLKIDGELAKTQAD
RECF_BACHD      DKELIQ----WEAPFARIEGAFQKQN-----GPLSLHVVLS-GKGKKVKVNGLEQRRLSD
RECF_BACSU      DKELIR----WDKDYAKIEGRVMKQN-----GAIPMQLVIS-KKGKKGKVNHIEQQKLSQ
RECF_STAAM      DKELIR----FNADYAKIEGELSYRH-----GTMPLTMFIT-KKGKQVKVNHLEQSRLTQ
RECF_LACLA      DKELIS----WSQQEMKVSGVVEKAH-----ATVPLEVQLS-PKGRIAKANHLKENRLAD
RECF_STRP1      DKELIH----FDHSTVSLTGKIQRIS-----GTVDLEINLS-DKGRVTKINALKQAKLSD
RECF_ACHLA      EKDMIQ----YDKPYASVKLIEDSK---------LHEIVLT-PNGKRTTINKSEVRKISD
RECF_MYCLE      DIPLIR----AGTIRAIVSTIVVNEG-----RECAIDLEIAAGRANRARLNRSLVRGMRE
RECF_MYCPA      DAPLIR----AGADRAVVSTIVVNDG-----RECAVDLEIAAGRANKARLNRSPVRSTRE
RECF_MYCTU      DLPLIR----VGTDRAVISTIVVNDG-----RECAVDLEIATGRVNKARLNRSSVRSTRD
RECF_MYCSM      DAPLIR----AGAERAIVSTIVVNEG-----RELAVDLEITSGRANKARLNRSPVRSARE
RECF_STRCO      DAPLVR----MGAERAVIRAQVRQGE-----RQQLIELELNPGRANRARVNRSSQVKPRD
RECF_SYNY3      DQELVL----DGAANGQIKALLERQY-----SVAELEIDLRRSGRRNLRINQNQCRRQLD
RECF_CHLMU      LTEAIR----FGSSHFFIEAVFSQNQ-----VFHTLSIQVD-KRGKKILFDGAPITKLSA
RECF_CHLTR      LTDAIR----FGASHFFIEAVFSHKE-----VFHTLSIQVD-KKGKKILFDGAPITKLSE
RECF_RICBR      LADICR------ESEDHCSVRALLQSKLGLAEFSTQIKRIS---NRRTTEYNNSKIANNE
RECF_RICPR      LTDICK------TSEDYCKVKTLLQSKLGLAELSTHIKRSS---NRRITEYNASKIANNE
RECF_CAUVC      LAEVGRRLPGEAVGRAWAVAAEVQSGEDAPVRIGTGVEQGG-AARRTVRLEGETVPP-GR
RECF_RHIME      YADVAR----VGAPDGFSVFAAVD-GMEGSVEIGTGTQGTEEGQSRRLRINGTAARTVDE
RECF_DEIRA      EQLIQA-----GETEAYVRADLQQGG--------SLSIQEVGLGRGRRQLKVDGVRARTG
RECF_ACIAD      PKHYIQ----QNAQDAIIFAQSLSEK---------IGMQKLLSGEQLIKVNGDTVATQGQ
RECF_XYLFA      RDGLIR----HGSENLEIFVDWQETDL--INARRRRAGLSHYGQEWIGRLDGQKIMHLAT
RECF_TREPA      ESELYA----THARSNEYRVKVMYRG-----EYTHTVQIFSKNGKKRIEKNLKKIRTKKE
                                                                            

RECF_HAEIN      LAHLLPMQLITPEGLTLLNGGPSYRRAFLDWGLFHHQTSFYSAWSNLNRLLKQRNAALAQ
RECF_PASMU      LAHLLPMQLITPEGLTLLNGGPVYRRAFLDWGLFHHHNHFHLAWVNLNRLLKQRNAALQQ
RECF_ACTPL      LAHLLPMQVITPEGLTLLNGGPTFRRAFLDWGLFHQYTEFYSCWANLKRLLKQRNAALHQ
RECF_ECOLI      LAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNAALRQ
RECF_SALTY      LAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEAGFFTAWSNLKRLLKQRNAALRQ
RECF_PROMI      LAKLLPMQLITPEGFTLLNGGPKYRRAFIDWGCFHNEPRFFAAWSDLKRVLKQRNAALRQ
RECF_VIBCH      LAQILPLQLIHPEGFELLTDGPKQRRAFIDWGVFHTEPAFFDAWGRFKRLSKQRNALLKS
RECF_PSEAE      LAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRNSWLRH
RECF_PSEPU      LAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALRQRNSWLRH
RECF_METCA      LIRLFPAVLIHPASVALLEGPPRWRRQMLDWGVFHVEQGYLDLLRRFSRTLEQRNAVLRG
RECF_HYDCU      MSAKLPVQLLTPESHRLLEEGPKARRQFMDWGCFHHNADFIHLWRHYQRALKQRNHALKK
RECF_BACHD      YIGAVNVVMFGPEDLNLVKGSPQIRRRFLDMELGQMSPVYLHQLAMYQKILLQRNHLLKQ
RECF_BACSU      YVGALNTIMFAPEDLNLVKGSPQVRRRFLDMEIGQVSPVYLHDLSLYQKILSQRNHFLKQ
RECF_STAAM      YIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQ
RECF_LACLA      YIGQLKILMFAPENLELVKGSPATRRKFMDIELGQIHAVYLYDSMRYNRALKERNAYLKF
RECF_STRP1      YIGTMMVVLFAPEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKS
RECF_ACHLA      YIGQLRVVMFAPEDLMLIKGSPSERRYFLDMELMQVSKTYLRNLNSYKKILKQRNALLKK
RECF_MYCLE      VVGVLRAVLFAPEDLALVCGDPANRRRYLDDLATVRQPVIAAVRADYDKVLRQRTALLKS
RECF_MYCPA      VLGVLRAVLFAPEDLALVRGDPSERRRYLDDLATLRRPAIAAVRADYDKVLRQRTALLKS
RECF_MYCTU      VVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVLRQRTALLKS
RECF_MYCSM      ILGVLRAVLFSPEDLSLVRGDPGDRRRYLDELATTRRPALAGVRADYDKVVRQRTALLKT
RECF_STRCO      VLGIVRTVLFAPEDLALVKGDPGERRRFLDELITARSPRMAGVRSDYDRVLKQRNTLLKS
RECF_SYNY3      FLGCLNAVEFSCLDLDLVRGAPDCRRQWLDTLLTQLEPLYAHLLGQYQHIVKQRNALLKS
RECF_CHLMU      LVGLFPVILFSVKDTTIIEGSPAERRRFLDLLLAQASEKYTGQIALYHKALDQRNAAIKT
RECF_CHLTR      LVGLFPVILFSIKDIAIIEGSPSERRRFLDLLLAQASDKYTEHISLYHKALDQRNASIKA
RECF_RICBR      LSKFTSMVWLTPQMEGIFTSGTSDRRKFFDRIVYNFDPKHAELVSKYEHYMQERNKILAE
RECF_RICPR      LSKFTNMVWLTPQMEGIFTSSSTDRRKFLDRIVYNFDTKHAALLNKYEYYMHERNKILAE
RECF_CAUVC      LADHVRPIWLTPAQDRLFLEAASERRRFFDRLVFAGEPAHAANANGYDKAQRERMRLLVD
RECF_RHIME      LTDHLRVLWLTPAMDGLFTGPSADRRRFLDRLVLSLDPEHGRRASEFDRAMRSRNRLLSE
RECF_DEIRA      DLPRGGAVWIRPEDSELVFGPPSGRRAYLDSLLSRLSARYGEQLSRYERTVSQRNAALRG
RECF_ACIAD      LAKLLPLQHLDPQSTDIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNMLLKT
RECF_XYLFA      LCAALAVITFESSSYQLINSNAELRRRFLDWGLFHVEPDFLDLWRCYTHVLKQRNSLLKQ
RECF_TREPA      LISSIPCILFFHNDLDFVVGTPERRRFFLDQSLSMCNPLYLEYLQKYHALTKTKNREIKE
                         :      :.   .  **  :*                       :   :  

RECF_HAEIN      NQ------------PYSAIKIWDVELAKLAHQVSEWRAEYAEALSPEIE--QTCQLFLPE
RECF_PASMU      AT------------HYQALEIWDRELVKLAHQVSEWRAQYAEALRPEIE--QTCRLFLPE
RECF_ACTPL      VR------------SYAELKPWDIELAKLAEIVSQMRASYAEGLRPEIE--KTCQFFLPE
RECF_ECOLI      VT------------RYEQLRPWDKELIPLAEQISTWRAEYSAGIAADMA--DTCKQFLPE
RECF_SALTY      VS------------RYEQLRPWDKELIPLAEQISTWRAEYSSAIAQDMA--DTCQQFLPE
RECF_PROMI      AS------------SYRQLLPWDKELILLTEQISQWRAEYTEDIAKDIE--ETCQLFLPE
RECF_VIBCH      AQ------------SYRELSYWDQELARLAEQIDQWRESYVNQLKNVAE--QLCRTFLPE
RECF_PSEAE      GKL-----------DPASQAAWDRELSLASDEIDAYRRSYIQALKPVFE--ETLAELVSL
RECF_PSEPU      GTL-----------DPASQAAWDRELCLRSAEIDEYRRNYIKALKPVFE--RTLSELVEL
RECF_METCA      DA------------PGSSLAAWSGELARWGTMIAELRSSYLDRIRMHFG--EMVSALLGR
RECF_HYDCU      RL------------PASQIQLWDAQLVDAAEKIDVIRADYITRLTPYLV--EFCQALMPE
RECF_BACHD      LFGKA-------NSD-PMLDVLTDQLIEVAVEVTKKRFEFIQLLQRWAE--EIHQAISRG
RECF_BACSU      LQTRK-------QTDRTMLDVLTDQLVEVAAKVVVKRLQFTAQLEKWAQ--PIHAGISRG
RECF_STAAM      LQLGQ-------KKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAK--PIHAGITND
RECF_LACLA      DKD---------KIDKNFLSVLDGQLAEHGNKIMLERQNFIDKLEVHAK--KIHEQLTHG
RECF_STRP1      AQ----------QIDAAFLAVLDEQLASYGARVMEHRIDFINALEKEAN--THHQAISNG
RECF_ACHLA      NRN---------LTDYTFLNILGEQLYDVGIQIFDERQKFIEALNQKFK--TIQTKYKD-
RECF_MYCLE      LAAARYRSDQG---VLDTLDVWDTRLAEHGAELMAARIDLVNQLAPEVE--KAYQLLAPG
RECF_MYCPA      LSGARHRGDRG---ALDTLDVWDSRLAEYGAQLMAARIDLVNQLAPEVE--KAYQLLAPG
RECF_MYCTU      VPGARYRGDRG---VFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVK--KAYQLLAPE
RECF_MYCSM      AAGARYRGDRS---VIDTLEVWDGHLAAHGAALVASRVKLVEELQPEVE--KAYQLLAPA
RECF_STRCO      AALARRHGGRTM--DLSTLDVWDQHLARAGAELLAQRLDLIASVQPLAD--KAYEQLAPG
RECF_SYNY3      LRQQWETGLALGEESTASLSLWDQQLVEMGTRVVRRRARGLARLAPLAQ--EWHGRISGG
RECF_CHLMU      QDY-------------KTIAAWNSPLIAYGSLVALLRYECAKKLHKIFQ--NLWDNTLK-
RECF_CHLTR      QNQ-------------KAISAWNSPLIAYGSLVAFLRNECTKKLNTIFQ--TLWDNTLK-
RECF_RICBR      DMW-----------DNNWLKTIEEKMADTSIYIANNRLKTLEFMQQAID--DLENEFPKA
RECF_RICPR      DIR-----------DNNWLKIIEEKMADISNNIANNRLKTIRFIQQAID--DIENEFPKA
RECF_CAUVC      AAETGA------PADAAWLTALEARLAEFGALLAQARARTLLALQAEID-GRGDRPFPLA
RECF_RHIME      FR-----------PDPAWLSAIEREMAGLGISMALARQEMLGLLSALVERSRSDGTFPSA
RECF_DEIRA      GEE-------------WAMHVWDDVLLKLGTEIMLFRRRALTRLDELAR--EANAQLGSR
RECF_ACIAD      KRQ----------LSLAELEPWNKMLSEYGEMLHSQRLVTVERWKDFFQ--QDLAQLLPD
RECF_XYLFA      KEE------------LAMLEAWDQKLSEVGEQLTFRRFQYLERLKQRVI--PLISRITPN
RECF_TREPA      KR-------------VQLLDALDTQIATVGFDLVQWRTQLVRDFNVIFT---KYYERLGD
                                         :      :   *                       

RECF_HAEIN      LEIN--VSFHQGWEKNAD-------------YYEILQQNFERDRALNYTFSGPQKADFRF
RECF_PASMU      LEIS--VSFHQGWEKDSD-------------YADLLVRHFERDRAIGYTVSGPQKADFRF
RECF_ACTPL      LEIG--VSFHQGWEKGTD-------------YAEILAQGFERDKAMGYTMIGPQKADFRF
RECF_ECOLI      FSLT--FSFQRGWEKETE-------------YAEVLERNFERDRQLTYTAHGPHKADLRI
RECF_SALTY      FSLT--FSFQRGWEKETD-------------YADVLERSFERDRMLTYTAHGPHKADFRI
RECF_PROMI      FTLK--VSFQRGWDKETD-------------YAQLLERQFERDKVLSYTSLGAHKADLRI
RECF_VIBCH      FDID--LKYYRGWEKDQP-------------YQSILEKNFERDQQLGYTFSGPNKADLRI
RECF_PSEAE      DDLT--LSYYRGWDKDRD-------------LLEVLASSLLRDQQMGHTQAGPQRADLRI
RECF_PSEPU      DGLT--LSYYRGWDKDRE-------------LQEVLASSLLRDQQMGHTQAGPQRADLRL
RECF_METCA      TDVE--LVVRPGWRAGWS-------------YADALAASQPTDRRLGYTEPGPQKGDFAV
RECF_HYDCU      ITVSPECHYRPGWPKTAES------------YRQLLADNFAKDTLQGHTQYGSHRADIKF
RECF_BACHD      KEKLVITYEPSVHVSE-----QLNLSKLREGFYQAYEQKKERERQRGTTLFGPHRDDLVF
RECF_BACSU      LEELTLKYHTALDVSD-----PLDLSKIGDSYQEAFSKLREKEIERGVTLSGPHRDDVLF
RECF_STAAM      KEALSLNYLPSLKFDY-----AQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISF
RECF_LACLA      KENLKIIYNQNVKTD----------------FSKELLSRQDHDIFRHQTSVGPHRDDLQF
RECF_STRP1      LESLSLSYQSSVVFDK-----KTN---IYQQFLHQLEKNHQKDFFRKNTSVGPHRDELAF
RECF_ACHLA      -FEVEMLYEPNVTKE---------------NFLKHLKTKQKQDIMYETTTAGIHKDDFKL
RECF_MYCLE      SRTASISYRASLDIGGIAGVGSSDRALLQADLLAGLSTRRNVELERGICLVGPHRDELEL
RECF_MYCPA      SRAASIGYRSSLGAAASAEVNAGDRDYLEAALLAGLAAHRDAELERGMCLVGPHRDDLEL
RECF_MYCTU      SRSASIGYRASMDVTGPSEQSDIDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLIL
RECF_MYCSM      SRPAAIRYRSSVEAIEDAP-GPESVEFYEAALLDALARRRDAELERGVCLVGPHRDDLEL
RECF_STRCO      GGPVALEYKPS------APGEAHTREDLYEQLMAALAEARKQEIERGVTLVGPHRDDLLL
RECF_SYNY3      NETLTVTYQPNVTWVG------DDPEVVHQAFLEKLAQRRSAELHLGTTVVGPHRDEVGF
RECF_CHLMU      -ETLSLRYESSLITTE-----SPTLNDIASNYYEQLRLANTKDFELGYTTVGPHRDELII
RECF_CHLTR      -ETLSLRYESSLITEE-----SPTLNDIASNYYEQLRIANTKDLDLGYTMVGPHRDELLL
RECF_RICBR      ELSIDGMVEQKIL--NGEED-------VVGFIAAELHKTRDKDKLLGRTSFGVHKSDFLV
RECF_RICPR      DLSIDGIIEQKIL--NVEGD-------IVNFIITELYKTRSKDKLLGRTSFGIHKSDFLV
RECF_CAUVC      RLGLTGEWERMALEGAPFAE-------IELKLAQALASARARDGAAGRALTGPHRGDLAI
RECF_RHIME      SLSLAGFLDDCA--GIPAFE-------LEERYLAMLAEGRARDAAAGRTLDGPHRSDLLI
RECF_DEIRA      KTLALTLTESTSPET----------------YAADLRGRRAEELARGSTVTGPHRDDLLL
RECF_ACIAD      LQIELEYSPGFHSEVG---------------LWQDLLNYHNKDVERRYTEYGPHRADLRL
RECF_XYLFA      LKIHGLNFNHGWRRHELP-------------LIDALFISRERDYQYGYTSLGPHRSDWTP
RECF_TREPA      LAQVRIEYKPSWSDSS------------VEEIVHSLYKRRKHDLAMGMSMSGPHRDKIHF
                                                          :        * :: .   

RECF_HAEIN      KAQGLPV-EDVLSRGQLKLLMCALRLAQGEHLMKE-KQRHCIFLIDDFASELDQYKRALL
RECF_PASMU      KANGLPV-EDVLSRGQLKLLMCALRLAQGEHLMKQ-KERHCIFLIDDFASELDQYKRALL
RECF_ACTPL      RANGLPV-EDVLSRGQLKLLMCALRLAQGEYLVAQ-KERQCLFLIDDFASELDPIKRELL
RECF_ECOLI      RADGAPV-EDTLSRGQLKLLMCALRLAQGEFLTRE-SGRRCLYLIDDFASELDDERRGLL
RECF_SALTY      RADGAPV-EDTLSRGQLKLLMCALRLAQGEFLTRE-SGRRCLYLIDDFASELDDARRGLL
RECF_PROMI      RANGTPV-EDMLSRGQLKLLMCALRLAQGEYFTRK-NGQRCLYLLDDFASELDANRRQLL
RECF_VIBCH      KVNATPV-EDVLSRGQLKLMVCALRVAQGQHLTEL-TGKQCIYLIDDFASELDSLRRQRL
RECF_PSEAE      RLAGHNA-AEILSRGQQKLVVCALRIAQGHLINRA-KRGQCVYLVDDLPSELDEQHRMAL
RECF_PSEPU      RLAGNNA-ADILSRGQQKLVGMRI-IAQGHLVSQA-RRGHCIYLVDDLPSELDDQHRRAL
RECF_METCA      LVGGRPA-RDYLSRGQLKLLTYALLLAQAGLLEAD-QPGRVCLLVDDIASELDSRNQERL
RECF_HYDCU      RFNGQEA-LMILSRGQQKLFVCALLLAQATLYQQH-SQNPVIMLIDDLPAELDAKHRETL
RECF_BACHD      FVNDKDV-QTYGSQGQQRTTALSLKLAEIELMKET-VGDYPILLLDDVLSELDDYRQSHL
RECF_BACSU      YVNGRDV-QTYGSQGQQRTTALSLKLAEIDLIHEE-IGEYPILLLDDVLSELDDYRQSHL
RECF_STAAM      DVNGMDA-QTYGSQGQQRTTALSIKLAEIELMNIE-VGEYPILLLDDVLSELDDSRQTHL
RECF_LACLA      FINEINV-ADFGSQGQQRTVALSIKLAEIDLIFEE-TGEYPILLLDDVMSELDNHRQLDL
RECF_STRP1      YINGMN--ANFASQGQHRSLILSLKMAEVSLMKAL-TGDNPILLLDDVMSELDNTRQTKL
RECF_ACHLA      LYKGLNA-KDSASQGTSRLIVIELKLALLEWIKEV-TKTDAILLLDDVLSELDLER-QNL
RECF_MYCLE      RLGDQPA-KGFASHGESWSLAIALRLAAYELLRAD-GNEP-VLLLDDVFAELDAARCRAL
RECF_MYCPA      WLGEQVA-KGFASHGESWSLALSLRLAAFELLRAD-ESDP-VLLLDDVFAELDAARRRAL
RECF_MYCTU      RLGDQPA-KGFASHGEAWSLAVALRLAAYQLLRVD-GGEP-VLLLDDVFAELDVMRRRAL
RECF_MYCSM      RLGDQPA-KGFASHGESWSMALALRLGAYELLCSD-GVEP-VLLLDDVFAELDTSRRRAL
RECF_STRCO      KLGSLPA-KGYASHGESWSYALALRLASFDLLRAE-GNEP-VLVLDDVFAELDARRRERL
RECF_SYNY3      VLDDTPA-RTYGSQGQQRTLVLALKLAELSLIETV-IGEPPLLLLDDVLAELDLDRQGQL
RECF_CHLMU      TLNDLPV-SKFSSEGQKHSLLAVLRFAECVYLQEE-FLIHPLLCMDDIHACLDQNRLDQL
RECF_CHLTR      TINDLPV-AKFSSEGQKHSLLAVLRFAECVYLQEE-FCIHPLLCMDDIHACLDQQRLDQL
RECF_RICBR      KHKHKNILAKFCSTGEQKAILIAIILAEM-NYAIKLTKTAPILLLDEVFVHLDDRRRNYL
RECF_RICPR      KHQKKNILAKFCSTGEQKAILIAIILAEI-NSTIKLTKITPILLLDEIFVHLDDKRRQYL
RECF_CAUVC      FHVEKDRPAAECSTGEQKALILNLVLAQAARLSRAESAPNPVILLDEVAAHLDLTRRAAL
RECF_RHIME      RHREKDIEAERCSTGEQKALLVGLVLAHA-RLVGDMTGHAPVLLLDEIAAHLDQGRRAAL
RECF_DEIRA      TLGDFPA-SDYASRGEGRTVALALRRAELELLREK-FGEDPVLLLDDFTAELDPHRRQYL
RECF_ACIAD      KTALGDA-DDVLSRGQKKLLMMALKLSQIAMLHAS--NKETVVLLDDLTAELDSNAQRRL
RECF_XYLFA      QFASIPG-VHVLSRGQGKLITLMCLLAQAQDFFDQ-RGEWPILALDDLASELDQKHQWRV
RECF_TREPA      TRSQALF-IPQASTGQRRLVSLVLRMSQAVFYTGV-TGKLPVLLMDDVLLELDPEKRERF
                            * *           .                 :*:.   **      .

RECF_HAEIN      AERLQQSGSQVFVTAITQRQLKEMQVE---NKKMFSVHNGIINALN------
RECF_PASMU      AERLKQSGSQVFVSAITETQLKQMQPQ---QHRTFRVEEGCIAPL-------
RECF_ACTPL      AHRLRESGSQVFVTAITKDQLNQMQWQESEQDSLFQVQQGMLTK--------
RECF_ECOLI      ASRLKATQSQVFVSAISAEHVIDMSDE---NSKMFTVEKGKITD--------
RECF_SALTY      ASRLKATQSQVFVSAISAEHVIDMSDE---NSKMFTVEKGKITD--------
RECF_PROMI      AERLKSTQAQVFVSAITSGQVKDMLDV---NSRLFSVEHGKIEVKP------
RECF_VIBCH      ADSLKGTGAQVFVSSITESQVADMLDE---SSKTFHVAHGVIEQG-------
RECF_PSEAE      CRLLEDLGCQVFITCVDPQLLKDGWRTDT-PVSMFHVEHGKVSQTTTIGSEA
RECF_PSEPU      CRLLEELRCQVFITCVDHELLREGWQTET-PVALFHVEQGRITQTHDHRE--
RECF_METCA      LSLVKSTGLQSFVTFSGATQGVAAVVGR--TARVFHVEQGRIRTGS------
RECF_HYDCU      LKLLNLLDIQHILTSTAQDLIPVLEPE---KAKIWRIQHGELIEQQ------
RECF_BACHD      LHAIQHRV-QTFVTTTNVDGIDHQTLQEATIYEVEQGSLKKKG---------
RECF_BACSU      LHTIQGRV-QTFVTTTSVDGIDHETLRQAGMFRVQNGALVK-----------
RECF_STAAM      LSTIQHKV-QTFVTTTSVDGIDHEIMNNAKLYRINQGEIIK-----------
RECF_LACLA      IETSLGKT-QTFITTTTLDHLK-NLPENLSIFHVNAGTIEQEQ---------
RECF_STRP1      LETVIKENVQTFITTTSLDHLS-QLPEGIRIFHVTKGTVQIDSDIH------
RECF_ACHLA      FMSQLSKNHQVFITTALPINGHIDFQKIVLQEGETINAK-------------
RECF_MYCLE      ATVAESAE-QVLVTSAAQEDIPVGWDAKWVTVDLRDSDSGRVSVVYP-----
RECF_MYCPA      AAVAESAE-QVLVTAAVLEDIPTGWQARRLFVELRDTDAGRVSELRP-----
RECF_MYCTU      ATAAESAE-QVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP-----
RECF_MYCSM      ATVAGSAE-QVLVTAAVGEDIPEDWDARRVEIRMVEDDGGRVSMVAS-----
RECF_STRCO      AELVAPGE-QVLVTAAVDDDVPHVLAGARFTVAE-----GTVERV-------
RECF_SYNY3      LMAIEDRF-QTLITTTHLSRFDDRWRRSAQILKVNAGQLEERWPSEID----
RECF_CHLMU      FQLSTSLG-QTVTTSTICPNHLDSNSSIFHVTQAQVSLVTSNFL--------
RECF_CHLTR      LQLSNSLG-QVVTTSTICPDHRSTTSCIFHVTQAQVSLVAPQSL--------
RECF_RICBR      TEFFISINLQLWVTATDLKGIEEFGNKSQLIKL-------------------
RECF_RICPR      MGFFNALNIQLWVTATDLDGIENFANKAQLIKL-------------------
RECF_CAUVC      ADELTALKLQAFLTGTDESLFDHLKGRALGVRVGDAGLTTLEDE--------
RECF_RHIME      FDLVDGLGGQSFMTGTDRAMFDALGERAQYLAVANGRVSG------------
RECF_DEIRA      LDLAASVPQAIVTGTELAPGAALTLRAQAGRFTPVADEEMQAEGTA------
RECF_ACIAD      IERLSQLGSQVFITTLDHQAVTQHLDGLSISYQLYNVDHGQVHAV-------
RECF_XYLFA      LEMLAEIPAQVLITGTEIPQGLKPYFSVGAMFHVEHGAITRMF---------
RECF_TREPA      MMSLPPYD-QLFCTFLPGEAYRRYGREKTRVYFVSEGACHE-----------