CLUSTAL format seed alignment for MF_00366

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RPOZ_HAEDU      ----------------------MARVTVQEAADKIGNRFDLILTAARRA-RQLQLHV---
RPOZ_MANSM      ----------------------MARVTVQDAVEKIGNRFDLILTAARRA-RQLQLHV---
RPOZ_HAEI8      ----------------------MARVTVQDAVEKIGNRFDLILTAARRA-RQLQLNQ---
RPOZ_SHEON      ----------------------MARVTVEDAVEQIGNRFDMILVAARRA-RQIAVQG---
RPOZ_YERPS      ----------------------MARVTVQDAVEKIGNRFDLVLVAARRA-RQIQSGG---
RPOZ_WIGBR      ----------------------MARITVQDAVEKIGNRFDLVLVASQRA-REMQIFG---
RPOZ_COLP3      ----------------------MARVTVEDAVDKVGNRFDLVLVASRRA-RQIATGG---
RPOZ_PSEHT      ----------------------MARVTVEDAVDAIGNRFDLILVAARRA-RQIAVGG---
RPOZ_BLOPB      ----------------------MARITVQDAVEKVGNIFDLILVAARRA-RQMQIGG---
RPOZ_IDILO      ----------------------MARVTVEDAVDRVGNRFDLILLASRRA-RQLAN-G---
RPOZ_NEIG1      ----------------------MARITTEDCTGKISNHFDLTLVAARRA-RQLEN-G---
RPOZ_FRATT      ----------------------MARVTVEDCLDKVETRFDLVVLASMRANKILKNGY---
RPOZ_METCA      ----------------------MARITVEDCLDKVENRFQLVLLASKRA-RVLARHP---
RPOZ_ACIAD      ----------------------MARVTVEDCLDHVDNRFELVLVASKRA-RQLARQG---
RPOZ_LEGPL      ----------------------MARVTVEDCLEHVKNRFELVMVATKRA-RQIAVRG---
RPOZ_HAHCH      ----------------------MARVTVEDCLDHVDNRFELVMLASKRA-RQISQYG---
RPOZ_PSYA2      ----------------------MARVTIEDCLDNVDNRFELVLVASKRA-RQLAKGI---
RPOZ_PSEU2      ----------------------MARVTVEDCLEHVDNRFELVMLSTKRA-RQLATGG---
RPOZ_COXBU      ----------------------MARVTVEDCLEHVENRFDLVLKAAKRA-HILELGG---
RPOZ_BARQU      ----------------------MARVTVEDCIDKVDNRFELVLLAGHRA-RQISQG----
RPOZ_RHIEC      ----------------------MARVTVEDCIDKVENRFELVLLASHRA-RLISQG----
RPOZ_RHOPA      ----------------------MARVTVEDCIDKVDNRFDLVLLAAHRA-RMISSG----
RPOZ_RUEPO      ----------------------MARVTVEDCVDKVPNRFELVLLAAHRA-REISAG----
RPOZ_CAUVC      ----------------------MARVTVEDCVEKVPNRFALVLLSAHRA-RGISAG----
RPOZ_RHORT      ----------------------MARVTVEDCVLKIPNRFELVLVAGQRA-RDISAG----
RPOZ_NOVAD      ----------------------MARVTVEDCVDKVPNRFDLVLLAAERA-RAISGG----
RPOZ_ZYMMO      ----------------------MARVTVEDCIDKVHNRFDLILLAAQRA-RQISGG----
RPOZ_HYDCU      ----------------------MARVTVEDCLDQVENRFELVILSSKRA-RQLSNG----
RPOZ_PELUB      ----------------------MARVTVEDCIDKVESPYELVLVAKERA-VQLNSG----
RPOZ_NITOC      ----------------------MARLTVEDCIDNIDNRFLLVLAAAKRA-RQLAMG----
RPOZ_XANOR      ----------------------MARITVEDCLEVVNNRFELVMMASKRA-RQLANGV---
RPOZ_NITEU      ----------------------MARITVEDCLEVIPNRFDMTLAATVRA-RQVS--V---
RPOZ_NITMU      ----------------------MARITVDDCLKKIPNRFDMTLVATIRA-RQLS--V---
RPOZ_CUPPJ      ----------------------MARITVEDCLKHIPNRFELALAATYRA-RQLV--Q---
RPOZ_RICTY      ----------------------MARITAEDCNKIIPDRFRLVVLATRYA-KLLNYKV---
RPOZ_GEOSL      ----------------------MARVTVEDCLDKVDNRFLLVMLASKRV-KQLYKG----
RPOZ_PELCD      ----------------------MARITVEDCLQQIPNRFLLVMVAAKRT-KQLYKG----
RPOZ_ANADE      ----------------------MARVTVEDCLPMVDNRFALVLLATKRT-RQLMAG----
RPOZ_SYNAS      ----------------------MARITVEDALKVAGNRFALVLLAVQRS-KQLLRG----
RPOZ_BDEBA      ----------------------MARVTVEDCLEKVPNRFALVLMVAKRA-KQLLKG----
RPOZ_DESAG      ----------------------MARITVEDCMERVSNRFLLVQMAIKRV-KQFREG----
RPOZ_DESVH      ----------------------MARITVEDCQKRIDNRFLLVQMAIKRV-QQYREG----
RPOZ_EHRCR      ----------------------MARLTVEECMGRTNNKFKLVILASQRA-HDLNSGA---
RPOZ_EHRRW      ----------------------MARLTVEECMGRTNNKFKLVILASQRA-HDLNSGA---
RPOZ_ANAPZ      ----------------------MDSEESRCFSGYDGNRFKLVILASQRA-HELSSGA---
RPOZ_WOLPM      ----------------------MAESIVEKCIERVSNRFKLVLLASQRT-HDLNTGA---
RPOZ_WOLTR      ----------------------MAESVIEKCTEQVSNRFKLALLASQRT-HDLNTGA---
RPOZ_CLOAB      ------------------MNNSMISPSVVDLKAKTGDRYSLVVITSKRA-RQIIAG----
RPOZ_CLOPE      ------------------MNNSMINPSIVDLLKRVEDRYSLVILSAKRA-RQIIDG----
RPOZ_HELHP      -----------------MDTLRTEEIAAKALKRVHNDRYLLASLIFERV-KELGEG----
RPOZ_WOLSU      -------------------MQRMEEIAFKALNRVNNDRYLLANILFARI-DELSKG----
RPOZ_HELPJ      -----------------MKKERTESLVAQALKNIGNDRYMLDNLVFARV-KQLNAG----
RPOZ_CAMJR      ------------------MDKRIEEVAAKALEKMGNDRYRLSLVVAKRA-EQLANG----
RPOZ_CORDI      -----MSNVAENNDGVYDAPTGITAPPIDELLKHVSSKYALVIFAAKRA-RQINSYYQQA
RPOZ_CORGL      MSVTNVSNETNATKAVFDPPVGITAPPIDELLDKVTSKYALVIFAAKRA-RQINSFYHQA
RPOZ_CORJK      ----MENQDVNANESVFDPPVGITNPPIDELLTKVSSKYALVIFAAKRA-RQINDYFQTV
RPOZ_NOCFA      -----MSDTKTA--PAYDTPIGLTNPPIDELLERTSSKYALVIYAAKRA-RQINDYYNQL
RPOZ_STRCO      ------------MSSSISAPEGIINPPIDELLEATDSKYSLVIYAAKRA-RQINAYYSQL
RPOZ_THEFY      ------------MAGTPPVAEGITNPPIDELLEVVDSKYSLVTMAAKRA-RQINAYYAQL
RPOZ_CUTAK      --------------MTETTPEGIVNPPIDQLLEHVDSKYRLVLFAAKRA-RQINAYYSQL
RPOZ_LEIXX      ---------------MATSTNGIIDPPIDDLLSKVESKYALVIFASKRA-RQINDYYADL
RPOZ_TROW8      ----------------MEEDRGIADPPLDSLLSRSGSKYGLVIYAAKRA-RQIDQYYIDL
RPOZ_LACLA      ---------------------MMLEPSIDKLLDQVDSKYSLVVLEAKRA-HELR------
RPOZ_STRT2      ---------------------MMLKPSIDKLLDKVPSRYSLVILQAKRA-HELA------
RPOZ_ENTFA      ----------------------MLKPSIDSLLKEVPSKYSLVILASKRA-HELD------
RPOZ_LACPL      ---------------------MILYPSVDDLLKQVNSRYSLIMLASKRA-HELD------
RPOZ_LACSS      ---------------------MIVYPSIDKLLENVNSRYSLAVLASKRA-HQIE------
RPOZ_LACJO      --------------------MKITYPSIDKLLSRVNSRYSLSVLAAKRA-HEIQ------
RPOZ_BACLD      ----------------------MLDPSIDSLMNKLDSKYTLVTVSARRA-REMQ------
RPOZ_BACHK      ----------------------MLNPSIDSLLTKIDSKYTLVTVAAKRA-REMQ------
RPOZ_BACSK      ----------------------MLYPSIDNLLEKLDSKYSLVTVSARRA-REMKED----
RPOZ_OCEIH      ---------------------MMLEPSIDSLQKRIKSKYSLVTLSARRA-RQLS------
RPOZ_LISMO      ----------------------MLYPSIDNLLLKIDSKYSLVTVAAKRA-RYMQL-----
RPOZ_GEOKA      ----------------------MLYPSIDLLMQKVDSKYKLVTVVAKRA-RELQ------
RPOZ_STAEQ      ----------------------MLNPPLNQLTAKVNSKYLIATTAAKRA-RELDE-----
RPOZ_STAAB      ----------------------MLNPPLNQLTSQIKSKYLIATTAAKRA-REIDE-----
RPOZ_STAS1      ----------------------MLQPPLNQLTSKINSKYLIATTAAKRA-REIDE-----
RPOZ_CALS4      ---------------------MILYPSIVDLMEKVDSKYTLCALVAKRA-RQLV------
RPOZ_CARHZ      ----------------------MNQPSLDILMKKADSRYTLVVATAKRA-RQIT------
RPOZ_MOOTA      ----------------------MKQPSLDELEKRAGSKYALAVLAAKRA-RMLT------
RPOZ_SYMTH      ----------------------MIKPSLDQLMHLVDSKYTLVILAARRA-RDLQ------
RPOZ_DEIRA      ----------------------MAEKDIDKLLSLTDSKYRLSVVTAKRA-LQLRSG----
RPOZ_THEAQ      ----------------------MAEPGIDKLFGMVDSKYRLTVVVAKRA-QQLLRHR---
RPOZ_PROMP      ----------MNVSNNSNMDHNDLAKRGESLIRKSTNRYLTTVRIAFRA-KQRR------
RPOZ_PROM9      ----------MNVSNNAGIDSNDLAKRGESLIRKSTNRYLTTVRIAFRA-KQRR------
RPOZ_SYNSC      -------------MLSAGVDSKDLSKRGESLIRQSSNRYLTTVRIAFRA-KQRR------
RPOZ_SYNE7      ------------MLQRFDLDSQDLLFKAESLIVNSTNRYHVTLQIARRA-KQAR------
RPOZ_GLOVI      -------------MNQPVVETAELMRRVEQLVDAAANRYRITVQVANRA-KRRR------
RPOZ_SYNJB      ---------MASRKNQLAIDNDELMRRVEALINASKNRYRITVQVANRA-KRRR------
RPOZ_TRIV2      ----------MLKRSKFETTQSQIMHRAEDLISAASNRYRITVQVANRA-KRRR------
RPOZ_GRATL      -------MDNQNIKIYNHLKVHEIIYKTEELLNISDNRYKITIQIANRA-KRKK------
RPOZ_PORPU      ------------MNHHNSLDSSDITYKTEELLEATTNRYKITVQVANRA-KRRK------
RPOZ_GUITH      -----------MKKKYLSVNSNYVLYKTEELLDAASNRYKITVQIANRA-KRRR------
RPOZ_SYNY3      ------------MTKRSNLDSNHIIYRSEELLGAASNRYNITVRVAKRA-KENR------
RPOZ_THEEB      ------------MQKRLHYSSLEINRRAEELIQHSANRYRITVQIANRA-KQRRG-----
RPOZ_MESVI      ------------MRNKIPYDSKKILYDSELLLNSASNRYILTMKVANRA-NLRR------
RPOZ_CYACA      --------------MVDKRNHYFLLHKIEELLELSASKYKTTMEIANYA-KKTK------
RPOZ_CYAM1      ---------------------MKLLNQMELLLSTCKNRYVLTREVAEYA-KKTP------
RPOZ_RHOBA      ---------------------MLEELKEEEIVNKIGGRFKLSTLIQKRL-VQLNQ-----
RPOZ_THEMA      -----------------MEKIVKFDLKYDELLKKIPYKYAIPVVVAKRA-EAIREY----
RPOZ_TREPA      -----------------------MIFPMQQLIEFQGNIYEITCAATRRA-FQLAAV----
                                                      :                     

RPOZ_HAEDU      -------REPLV-PEEN-DKP---------TVIALREIEKGLINGSIMDQLENSDAVRQE
RPOZ_MANSM      -------REPLV-PEDN-DKP---------TVIALREIEKGLIDNNIMNAQERQEALEQE
RPOZ_HAEI8      -------SAPLV-PEDN-DKP---------TVIALREIEKGLINQDIMDAQEFQKMAKVQ
RPOZ_SHEON      -------KDPMV-EEMN-DKP---------TVIALREIELGLVNAHTLDADERQTVRERE
RPOZ_YERPS      -------KDALV-PEEN-DKV---------TVIALREIEEGLITNQILDVRERQEQQEQE
RPOZ_WIGBR      -------KSPMV-DKEN-DKY---------TVIALREIEQGLIEKQ--------------
RPOZ_COLP3      -------KDPLV-DVEN-DKP---------TVIALREIEAGLITTDIMNTSDRAQQIQQD
RPOZ_PSEHT      -------KRPLV-DPEN-DKP---------TVIALREIELGLVDSSSMDVIDREEQQHQE
RPOZ_BLOPB      -------KETLI-TKNNNDKY---------TVLALREIEEDLITKK--------------
RPOZ_IDILO      -------KEPLV-ETKN-EKP---------TVIALREIEQGLIDNERLDIEDQAAQKQQD
RPOZ_NEIG1      -------NTPLV-DDVRNNKP---------TVTALREIAAGHIGTELLTRNK--------
RPOZ_FRATT      -------SESME-NEKK-EKA---------TVVALREIAESE-ITPEQIL------RNEI
RPOZ_METCA      -------EEAKV-TWDN-DKP---------TVVALREIAEGH-ITPAYMKEKVKTDRYPI
RPOZ_ACIAD      -------IEPTV-EWDN-DKP---------TVVSLREIAEGH-VTKDILKQR--DQDYQT
RPOZ_LEGPL      -------DQPMV-EWEN-DKP---------TVVALREIAEGY-VTADIL-----DED---
RPOZ_HAHCH      -------KDPKV-EWEN-DKP---------TVVALREIAAGL-ITSEMLEQ---DED---
RPOZ_PSYA2      -------AEPLV-DVDN-DKP---------TVLALREIAAGK-ITRDILNQP--EHNFAT
RPOZ_PSEU2      -------KEPKL-AWEN-DKP---------TVMALREIAAGV-MDYSVIAE---AEIVED
RPOZ_COXBU      -------AEPMV-PRDN-DKP---------AVLALREIAAGYDVTREGQEQE--TEEVDV
RPOZ_BARQU      -------AQVTV-DRDN-DKN---------PVVALREIAEETLSPADLKEDLIHSLQKHV
RPOZ_RHIEC      -------ASITI-DRDN-DKN---------PVVALREIADETLSPDDLKEDLIHSLQKHV
RPOZ_RHOPA      -------SPLTI-DRDN-DKN---------PVVSLREIADQTISPEDLKEELVHSLQKFV
RPOZ_RUEPO      -------AAITV-DRDN-DKN---------PVVSLREIADETQSADDLRERLIEANQTQI
RPOZ_CAUVC      -------AALMV-DRDN-DKN---------PVVALREIADDVIDHEGLKEHLISTLQRVD
RPOZ_RHORT      -------SALTV-DRDN-DKN---------PVVSLREIADGTVDIPNLKEAVIQGLQKHV
RPOZ_NOVAD      -------AELTV-DRDR-DKN---------PVVALREIAEETVRPAVLKENLIQSLQRVL
RPOZ_ZYMMO      -------AELTL-DRDR-DKN---------PVVALREIADELITPVQLREALLNDLQQVH
RPOZ_HYDCU      -------AEPTL-DWDK-DKP---------TVMALRELAENTI---------------NK
RPOZ_PELUB      -------LEPTL-DRDN-DKN---------TVISLREIAADTIKVSDLTDSAIHKLRKHV
RPOZ_NITOC      -------ATPTV-PWDK-DKP---------TVVALREIAEGHIDVGVMDTASAREHAKES
RPOZ_XANOR      -------QPLIE-NAAASDKP---------TVMALREIAARRIDNALIDEVEKAERERAE
RPOZ_NITEU      -------GSTPM-IDSERDKP---------IVIALRELAQKKYGE-----EILNTLR---
RPOZ_NITMU      -------GGSPM-VEPARDKP---------TVIALREISQGLVGT-----DILTTGPI--
RPOZ_CUPPJ      -------GHTPK-VE-AKDKP---------TVVALREIASGQVGI-----EMLKKVPT--
RPOZ_RICTY      -------ETNQI-KKEKRDKP---------PVISLRRIAAGKVSVPQLEQDLINSLRTSS
RPOZ_GEOSL      -------ARPLI-DNRGANKN---------VVISLREIAAGKVGYELTS---RRSR----
RPOZ_PELCD      -------GQPLI-ENKSNNKR---------VVHCLREIAAGKVDYEIPA---RKA-----
RPOZ_ANADE      -------ARPLQ-AAS-KNKP---------PVLALREIATGKVRFDRSV---RDALSGKF
RPOZ_SYNAS      -------ARPLT-NVR-NNRE---------IVAALREIADNKVYFSHPEYLMGAKEDFKL
RPOZ_BDEBA      -------AEATV-STR-SNKY---------IVSSLREVAMGNVGYQDSL---DANEAIRQ
RPOZ_DESAG      -------YEPLV-PSK--NKE---------IVTALREIAAAKVVPEDELSAAAAENR---
RPOZ_DESVH      -------YEPLV-DSK--NKE---------VVTALREIAAGKVMPEDLALYRPAEGEEMP
RPOZ_EHRCR      -------CPVIK---YKNGKN---------TVIALKEIAAKQLDVSSLFNLSVQRCRKYM
RPOZ_EHRRW      -------SPVVK---HKNSKN---------TIIALTEIANEQLDVHLLFNLAVQRCRKYM
RPOZ_ANAPZ      -------ATLVD---RQGDKN---------TVVALREIASNQLDLSTVFGLAVQRCRKYL
RPOZ_WOLPM      -------SNPIQAAKFKGHKN---------TIVSLHEIAGKQVDTHELFSLLVGRCKEYM
RPOZ_WOLTR      -------SNPVQSARFKGHKN---------TIISLYEIAERQVDTHELFSLLVSRCKEYM
RPOZ_CLOAB      -------EEPLVDIE--SNKA---------LTIAINEVDQDKIKFDLPIEGIN-------
RPOZ_CLOPE      -------AETFVDVE--SNKP---------LTIAINEIDEGFVNYKDTEEK---------
RPOZ_HELHP      -------AKPLVDMDVKTYKL---------PDIAMREIAEGKVELTSIEDRE--------
RPOZ_WOLSU      -------AKPLVNMDVKKHKL---------TDIAMTEVAEGKIALSQIDQL---------
RPOZ_HELPJ      -------AKTLVNMDPKRHKL---------VDIAIREIAEGKIDIDRIDERN--------
RPOZ_CAMJR      -------ATPLVDFDKNKNKL---------ADIALYEIAENKITLEGLVETNR-------
RPOZ_CORDI      DEG-VFEFVGPLVTPEAQEKP---------LSIAMREIEAGLLDHEE-----G-------
RPOZ_CORGL      DEG-VFEFIGPLVTPQPGEKP---------LSIALREINAGLLDHEE-----G-------
RPOZ_CORJK      DEG-VFEFVGPLVTPDVHEKP---------LSIALREINRDLLEHTE-----G-------
RPOZ_NOCFA      GDG-ILEYVGPLVEPGLQEKP---------LSVALREIHADLLEHSE-----GE------
RPOZ_STRCO      GEG-LLEYVGPLVDTHVHEKP---------LSIALREINAGLLTSEA-----IEGPAQ--
RPOZ_THEFY      GEG-LLEYVGPLVETQPQEKP---------LSIALREIREGLLTAET-----QEEA----
RPOZ_CUTAK      AEG-LLENVGPLVETTNQEKP---------LSIAMREIQAGVVEAHE-----MDAEEIAA
RPOZ_LEIXX      HEGSLFDNVGPLVDSSVDDKP---------LSVAMHEINEDRLVLKP-----IAAAE---
RPOZ_TROW8      HEGSFYAHVGPLVSVDADDKS---------LTVAMREIAEDKLDLKS-----SAAE----
RPOZ_LACLA      ------DKERPTKE-FKAVKN---------TLRALEEIADGTVKIHPSPELKRETLVEKR
RPOZ_STRT2      ------AGAEPTQE-FSSVKY---------TLQALEEIESGNVIIHPNPEAKRKLARLKV
RPOZ_ENTFA      ------EGVQPTVESFDSVKS---------VGRALEEIEAGTVISDPNPEEKRERLRIER
RPOZ_LACPL      ------AGAAPMLSEYKSVKT---------IGRAMEEIAAGDLMIDPD----ETDKD---
RPOZ_LACSS      ------AGDLKMLSEYKSPKT---------VGMAMEEIAAGNVTIDPDSLMLEKDAEKMD
RPOZ_LACJO      ------AGAPLALKHYKSDKA---------VGEALEEIAAGKVTIDPEH---REDIG---
RPOZ_BACLD      ------MNKDAQIENPKSHKF---------VGKALEEIDAGLLTFE------KENR----
RPOZ_BACHK      ------LANNCVVEKPVSHKC---------VGKALEEIDMEALSYVP-----SEDKVTE-
RPOZ_BACSK      ------SARVPLVEKPKSYKF---------VGIALEEIVNDQLTKRVP----KEEQ----
RPOZ_OCEIH      ------ETNQPLVEKSKSHKF---------VGMALEEIEAGKLYIEN-------------
RPOZ_LISMO      ------ENDKGVLPSYQSDKF---------VGKALEEIHAGKLVLQ------NDDK----
RPOZ_GEOKA      ------DGAELMVKKPVSKKF---------VGQALEEIAGDKVELVE------EEK----
RPOZ_STAEQ      ------RRETALLDQYQSAKP---------VGKALEEIADGKIEP-----VVPKEYLG--
RPOZ_STAAB      ------QPETELLSEYHSFKP---------VGRALEEIADGKIRP-----VISSDYYGKE
RPOZ_STAS1      ------KPESALLTKYISEKP---------VGKALEEIADGVVFPDE---LFLKTY----
RPOZ_CALS4      ------AGDK-KLVDIDSDKP---------VTIATEEVYRGLITYER-----PQKYGIK-
RPOZ_CARHZ      ------AGESSKLKHI-SNKP---------VTIALHEIGNDLITYQR-----LKSSQNK-
RPOZ_MOOTA      ------ESQF-AAQYPKGTKP---------VTIALMEIAAGKIKYEW-----GKKKA---
RPOZ_SYMTH      ------DGKH-QMVESKSNKP---------VTIALEELAAGKLFFER-----GKPTPLG-
RPOZ_DEIRA      -----APSVLPVEQRVRTHNL---------VTQAMRELATGQLTVGTNLIDEQRFHQDYV
RPOZ_THEAQ      ----FKNTVLEPEERPKMRTLEGLYDDPNAVTWAMKELLTGRLFFGENLVPEDRLQKEME
RPOZ_PROMP      ------FDDFDGLLEESAIKP---------VQRSIIELSDEQDQPDLLPG----------
RPOZ_PROM9      ------FDDFDGLLEESTIKP---------VQRSIIELSDEQDQPDLLPG----------
RPOZ_SYNSC      ------FDDFDGLLEESSVKP---------VQRAIVELSDEQDQPDLLPG----------
RPOZ_SYNE7      ------YEEMENLSEETGIKP---------VLRAILEMSDELNQPEIIGG----------
RPOZ_GLOVI      ------YEDLND--DDGNFKP---------VLRAIFEMSDEMNEPEIIGD----------
RPOZ_SYNJB      ------YEDPDDI-EDGWMKP---------IRRAVIEMSDELTEPEIIGDE---------
RPOZ_TRIV2      ------YEEFESA-EDSMMKP---------VLRAIIEMSDELTQPEIIGEI---------
RPOZ_GRATL      ------YEDLDII-DDPTIKP---------IIRSILEMVDEITQPEIISD----------
RPOZ_PORPU      ------YEDVDII-DDPQIKP---------VIRAILEMVDEITQPEIISD----------
RPOZ_GUITH      ------YEDIDLL-EEVTLKP---------IVRAVLEMAEEISQPEIISD----------
RPOZ_SYNY3      ------SEDFDSI-DDPNMKP---------AIRAIIEMSDELTRPEIISDN---------
RPOZ_THEEB      ------LEASEDL-DDLPLKP---------VIRAIIEMSDEVAQPELLADS---------
RPOZ_MESVI      ------YEEFETM-NHSSIKP---------IARTIIEMVDDKNFLVVKKK----------
RPOZ_CYACA      --------NRNAN--KSNIKP---------VILAILEISGELKLNDINKLTN--------
RPOZ_CYAM1      --------SPNA------------------VILAIWLMARKTK-----------------
RPOZ_RHOBA      -------GSRALVSVDTHDKM----------SIVLQEIVQDKIFLNMENEIETVDDLDAI
RPOZ_THEMA      -------ARPFVITDDENY-----------VSIAFMELSLNYIRIKNEEILKALIPKVK-
RPOZ_TREPA      -------CDPVL--DELGGKV---------VSAAAQQVFSGTVDYRIEPQELG-------
                                                     :                      

RPOZ_HAEDU      VAEQEAISFLTDIQTNAYFYSFNDG-----------------------------------
RPOZ_MANSM      KVELNAVSLLSE------------------------------------------------
RPOZ_HAEI8      ETEEAAVALITE------------------------------------------------
RPOZ_SHEON      AAEIAAVAAIAEGRSL--------------------------------------------
RPOZ_YERPS      AAEIQAVTAIAEGRR---------------------------------------------
RPOZ_WIGBR      ------------------------------------------------------------
RPOZ_COLP3      TAELDAVAAIVGGQQEELS-----------------------------------------
RPOZ_PSEHT      AAELAAVAAIVGGNQ---------------------------------------------
RPOZ_BLOPB      ------------------------------------------------------------
RPOZ_IDILO      AEELRAVDALRGIE----------------------------------------------
RPOZ_NEIG1      ------------------------------------------------------------
RPOZ_FRATT      EG----------------------------------------------------------
RPOZ_METCA      ERPMPAPRDDLADLDDDI------------------------------------------
RPOZ_ACIAD      SSLDLALSANSLNLEGFSFQ----------------------------------------
RPOZ_LEGPL      ------------------------------------------------------------
RPOZ_HAHCH      ------------------------------------------------------------
RPOZ_PSYA2      SSLDLALSGDHSF-----------------------------------------------
RPOZ_PSEU2      EPLFAAFEDESNEAV---------------------------------------------
RPOZ_COXBU      DRNVLAETAKMNKAVASQKESEV-------------------------------------
RPOZ_BARQU      EVDEPEMANEFLSHSGEAETVFATTSE---------------------------------
RPOZ_RHIEC      EVDEPEPDPASMIAAGGAAAADSEEQDD--------------------------------
RPOZ_RHOPA      EVDEPEPDTVPLIGSAGA-SVDADDTE---------------------------------
RPOZ_RUEPO      EVDEPEEDQMALLMGAES------DRP---------------------------------
RPOZ_CAUVC      EHTEAEEEAETLALLADP------------------------------------------
RPOZ_RHORT      EIDEPEEDDFDAMGLDRDLMPGVALAED-----------------------------DDT
RPOZ_NOVAD      PDDDDEVDEIGSLSQSAEALRITAAAP---------------------------------
RPOZ_ZYMMO      LDDDDVPDEVGSLSASAEALRLTAETP---------------------------------
RPOZ_HYDCU      EVVMSDPDTPPFFG----------------------------------------------
RPOZ_PELUB      EQVDDGTDDDEIIGDDFESMYKGEISKSGTPILPSKRARKIPEKIQVSSDDLEELTAKAE
RPOZ_NITOC      QVSEEEVREES-------------------------------------------------
RPOZ_XANOR      REALEWAAAEVVADEDMSKNDD--------------------------------------
RPOZ_NITEU      ------------------------------------------------------------
RPOZ_NITMU      ------------------------------------------------------------
RPOZ_CUPPJ      ------------------------------------------------------------
RPOZ_RICTY      MIEPLVNQDESEDVEEKFEYLPEVYIGEDYSDLDDQIFINENGEDYETDK----------
RPOZ_GEOSL      ------------------------------------------------------------
RPOZ_PELCD      ------------------------------------------------------------
RPOZ_ANADE      DKEKVNIPAGQTRTLR--------------------------------------------
RPOZ_SYNAS      IADDTTEFIGDEDYVE--------------------------------------------
RPOZ_BDEBA      IEKDLNK-----------------------------------------------------
RPOZ_DESAG      -AE---------------------------------------------------------
RPOZ_DESVH      VAE---------------------------------------------------------
RPOZ_EHRCR      EKFINSDEPYIAHKPKNNVDIFQASAVAGNS-----------------------------
RPOZ_EHRRW      EKFINSDDSYVVHKSKDNIDIFQKNATSNFD-----------------------------
RPOZ_ANAPZ      EEFAGSRG--IAGHS-SHVSPSRSSRHTGLG-----------------------------
RPOZ_WOLPM      KGNMNNVYSSNTSKLANLLNFSD---NTDLD-----------------------------
RPOZ_WOLTR      KGNLSNTYSSNTSKLEKLLNFSNDQFNTDAD-----------------------------
RPOZ_CLOAB      ------------------------------------------------------------
RPOZ_CLOPE      ------------------------------------------------------------
RPOZ_HELHP      ------------------------------------------------------------
RPOZ_WOLSU      ------------------------------------------------------------
RPOZ_HELPJ      ------------------------------------------------------------
RPOZ_CAMJR      ------------------------------------------------------------
RPOZ_CORDI      ------------------------------------------------------------
RPOZ_CORGL      ------------------------------------------------------------
RPOZ_CORJK      ------------------------------------------------------------
RPOZ_NOCFA      ------------------------------------------------------------
RPOZ_STRCO      ------------------------------------------------------------
RPOZ_THEFY      ------------------------------------------------------------
RPOZ_CUTAK      QAAAAQEAPAIELDDPFADLADPNA-----------------------------------
RPOZ_LEIXX      ------------------------------------------------------------
RPOZ_TROW8      ------------------------------------------------------------
RPOZ_LACLA      ELERLQAKMKEQLIKEQIAKEEAEEEAKQKNSRAAKAAAAE-------------------
RPOZ_STRT2      IQARLAAEEEERKIKEQIAKEKEEGDKI--------------------------------
RPOZ_ENTFA      EERKRQREQEQKELENRLRDEKN-------------------------------------
RPOZ_LACPL      ------------------------------------------------------------
RPOZ_LACSS      KLSQKDGE----------------------------------------------------
RPOZ_LACJO      ------------------------------------------------------------
RPOZ_BACLD      ------------------------------------------------------------
RPOZ_BACHK      ------------------------------------------------------------
RPOZ_BACSK      ------------------------------------------------------------
RPOZ_OCEIH      ------------------------------------------------------------
RPOZ_LISMO      ------------------------------------------------------------
RPOZ_GEOKA      ------------------------------------------------------------
RPOZ_STAEQ      ------------------------------------------------------------
RPOZ_STAAB      ------------------------------------------------------------
RPOZ_STAS1      ------------------------------------------------------------
RPOZ_CALS4      ------------------------------------------------------------
RPOZ_CARHZ      ------------------------------------------------------------
RPOZ_MOOTA      ------------------------------------------------------------
RPOZ_SYMTH      ------------------------------------------------------------
RPOZ_DEIRA      RQRQAQLQAQLNAERERERD----------------------------------------
RPOZ_THEAQ      RLYPTEEEA---------------------------------------------------
RPOZ_PROMP      ------------------------------------------------------------
RPOZ_PROM9      ------------------------------------------------------------
RPOZ_SYNSC      ------------------------------------------------------------
RPOZ_SYNE7      ------------------------------------------------------------
RPOZ_GLOVI      ------------------------------------------------------------
RPOZ_SYNJB      ------------------------------------------------------------
RPOZ_TRIV2      ------------------------------------------------------------
RPOZ_GRATL      ------------------------------------------------------------
RPOZ_PORPU      ------------------------------------------------------------
RPOZ_GUITH      ------------------------------------------------------------
RPOZ_SYNY3      ------------------------------------------------------------
RPOZ_THEEB      ------------------------------------------------------------
RPOZ_MESVI      ------------------------------------------------------------
RPOZ_CYACA      ------------------------------------------------------------
RPOZ_CYAM1      ------------------------------------------------------------
RPOZ_RHOBA      VAASEAPELDPSDL----------------------------------------------
RPOZ_THEMA      ------------------------------------------------------------
RPOZ_TREPA      ------------------------------------------------------------
                                                                            

RPOZ_HAEDU      ---------------------------------------------
RPOZ_MANSM      ---------------------------------------------
RPOZ_HAEI8      ---------------------------------------------
RPOZ_SHEON      ---------------------------------------------
RPOZ_YERPS      ---------------------------------------------
RPOZ_WIGBR      ---------------------------------------------
RPOZ_COLP3      ---------------------------------------------
RPOZ_PSEHT      ---------------------------------------------
RPOZ_BLOPB      ---------------------------------------------
RPOZ_IDILO      ---------------------------------------------
RPOZ_NEIG1      ---------------------------------------------
RPOZ_FRATT      ---------------------------------------------
RPOZ_METCA      ---------------------------------------------
RPOZ_ACIAD      ---------------------------------------------
RPOZ_LEGPL      ---------------------------------------------
RPOZ_HAHCH      ---------------------------------------------
RPOZ_PSYA2      ---------------------------------------------
RPOZ_PSEU2      ---------------------------------------------
RPOZ_COXBU      ---------------------------------------------
RPOZ_BARQU      --EESCSFDCMSEEDLLAGIEGLVIPEKSDDY-------------
RPOZ_RHIEC      -LPETITFDQMSEEELLAGIEGLVPPEKSDDY-------------
RPOZ_RHOPA      -----VAMERMTEEELLKGLEGLAPPEEQPEEDE-----------
RPOZ_RUEPO      ------VEDDMSEERLLRALMEAQGQG------------------
RPOZ_CAUVC      ------SHMQMSELELVRALQSDRDGGQEERY-------------
RPOZ_RHORT      LEADGLTIHDGADSDLDLSDDAGQDTDEADED-------------
RPOZ_NOVAD      ------VRNTS------------LGADYDG---------------
RPOZ_ZYMMO      ------ARNQTSSRRAAAAAAAAAAVDYD----------------
RPOZ_HYDCU      ---------------------------------------------
RPOZ_PELUB      PEVDVDAELEVGDEETAVSLDQIAEAETEAETTEVNSDDSETTNS
RPOZ_NITOC      ---------------------------------------------
RPOZ_XANOR      ---------------------------------------------
RPOZ_NITEU      ---------------------------------------------
RPOZ_NITMU      ---------------------------------------------
RPOZ_CUPPJ      ---------------------------------------------
RPOZ_RICTY      ---------------------------------------------
RPOZ_GEOSL      ---------------------------------------------
RPOZ_PELCD      ---------------------------------------------
RPOZ_ANADE      ---------------------------------------------
RPOZ_SYNAS      ---------------------------------------------
RPOZ_BDEBA      ---------------------------------------------
RPOZ_DESAG      ---------------------------------------------
RPOZ_DESVH      ---------------------------------------------
RPOZ_EHRCR      --DGLENSSNSRDDNPLGRDNFFSTPENRNNTNS-----------
RPOZ_EHRRW      --ELGANSLNVENSKFLDGDNFFLTQKE-----------------
RPOZ_ANAPZ      --KSFVDNKSTYSASFLDQDKFLSGGKDDGIEGF-----------
RPOZ_WOLPM      --ASQESQDYEVDGEIDDEINDQDG---DEEVSV-----------
RPOZ_WOLTR      --VDQESTDIQ-DDEVENEMSNQDSEDIDDEVDNEE---------
RPOZ_CLOAB      ---------------------------------------------
RPOZ_CLOPE      ---------------------------------------------
RPOZ_HELHP      ---------------------------------------------
RPOZ_WOLSU      ---------------------------------------------
RPOZ_HELPJ      ---------------------------------------------
RPOZ_CAMJR      ---------------------------------------------
RPOZ_CORDI      ---------------------------------------------
RPOZ_CORGL      ---------------------------------------------
RPOZ_CORJK      ---------------------------------------------
RPOZ_NOCFA      ---------------------------------------------
RPOZ_STRCO      ---------------------------------------------
RPOZ_THEFY      ---------------------------------------------
RPOZ_CUTAK      ---------------------------------------------
RPOZ_LEIXX      ---------------------------------------------
RPOZ_TROW8      ---------------------------------------------
RPOZ_LACLA      ---------------------------------------------
RPOZ_STRT2      ---------------------------------------------
RPOZ_ENTFA      ---------------------------------------------
RPOZ_LACPL      ---------------------------------------------
RPOZ_LACSS      ---------------------------------------------
RPOZ_LACJO      ---------------------------------------------
RPOZ_BACLD      ---------------------------------------------
RPOZ_BACHK      ---------------------------------------------
RPOZ_BACSK      ---------------------------------------------
RPOZ_OCEIH      ---------------------------------------------
RPOZ_LISMO      ---------------------------------------------
RPOZ_GEOKA      ---------------------------------------------
RPOZ_STAEQ      ---------------------------------------------
RPOZ_STAAB      ---------------------------------------------
RPOZ_STAS1      ---------------------------------------------
RPOZ_CALS4      ---------------------------------------------
RPOZ_CARHZ      ---------------------------------------------
RPOZ_MOOTA      ---------------------------------------------
RPOZ_SYMTH      ---------------------------------------------
RPOZ_DEIRA      ---------------------------------------------
RPOZ_THEAQ      ---------------------------------------------
RPOZ_PROMP      ---------------------------------------------
RPOZ_PROM9      ---------------------------------------------
RPOZ_SYNSC      ---------------------------------------------
RPOZ_SYNE7      ---------------------------------------------
RPOZ_GLOVI      ---------------------------------------------
RPOZ_SYNJB      ---------------------------------------------
RPOZ_TRIV2      ---------------------------------------------
RPOZ_GRATL      ---------------------------------------------
RPOZ_PORPU      ---------------------------------------------
RPOZ_GUITH      ---------------------------------------------
RPOZ_SYNY3      ---------------------------------------------
RPOZ_THEEB      ---------------------------------------------
RPOZ_MESVI      ---------------------------------------------
RPOZ_CYACA      ---------------------------------------------
RPOZ_CYAM1      ---------------------------------------------
RPOZ_RHOBA      ---------------------------------------------
RPOZ_THEMA      ---------------------------------------------
RPOZ_TREPA      ---------------------------------------------