CLUSTAL format seed alignment for MF_00368

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL7_RHIEC       --------MA-----DLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAA-----
RL7_RICFE       --------MA-----DLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAA-----
RL7_SOLUE       --------MA-----DLNAIADQIQGLTLLEASQLVKMLEEKLGVSAAAAVAAPA-----
RL7_CHLTE       --------MS-----SIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAVMAGA-----
RL7_PORGI       --------MA-----DIKAIAEQLVNLTVKEVSELATILKEEYGIEPAAA--AVA-----
RL7_RUEST       --------MA-----DLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGG-AVM-----
RL7_SALRD       --------MA-----DIEELAEQLVGLTIQEANELANHLEEEYDIQPASAGVAVA-----
RL7_THET2       --------MAL----DIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAA-----
RL7_DEIRA       --------MAY----DKQALIDQLGQLTIMELADLIDGLKETWGVTAAVAVS--------
RL7_FUSNN       --------MAF----NKEQFIADLEAMTVLELKELVSALEEHFGVTAAAPVA--------
RL7_CHLAA       ---------MS----KIDSIIEMIEGLNVLELVELKKKMEEKWGVTAAAPVMAMGAAM--
RL7_DEHM1       ----------M----TIDEMMSAIKGMTVIELSELVKALEKEFGVSAAVAVAA-------
RL7_SYNAS       ------MADQI----TKEDVVKFIEGMTVLELSELVKELEERFGVSAAAPVAV-------
RL7_SYNFM       -------MSTI----SKEDVIKFIENMTVLELSELVKELEERFGVSAAAPVAM-------
RL7_PELPD       -------MAEI----TKQDVIEYIEKMSVLELSELVKELEEKFGVSAAAPVAV-------
RL7_PSELT       ----------M----NVEQIVEAIEKLTVAELAELVKALEEKFGVSAAAPIAVAA-----
RL7_FERNB       ----------M----TLEELVKAIEGLTVAELAELVKMLEERFGVSAAAPVMAAM-----
RL7_AQUAE       -------MATL----TIDEIVEAIKNMSVLEVAELVKRLEEEFGVSAAA-MVAAA-----
RL7_CLOBH       ----------M----KKEEIIQAIKEMTVLELNELVEACEEEFGVSAAAPVAVAG-----
RL7_ALKOO       ----------M----TIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVVVGG-----
RL7_PSYIN       --------MSI----TKDQIIDAVAELSVMEVVELITAMEEKFGVSAAAAVAGAA-----
RL7_PHOPR       MLISKRIVMSI----TNEQILDAVADMSVMQVVELIEAMEEKFGVTAAAAVVAGG-----
RL7_CHRSD       --------MAL----TQEDIINAVAEMSVMEVAELISAMEEKFGVSAAAAVVAGP-----
RL7_HALHL       --------MAA----SKDEILESIANMSVMEVVELIEAMEEKFGVTAAAAVAAAP-----
RL7_PSEF5       --------MSL----TNEQIIEAIGQKTVLEVVELIKAMEETFGVTAAVAAAGPA-----
RL7_BUCAI       --------MSI----TKEQILEAISEMSVMNVVDLITAMEEKFGVSASMSINSNN-----
RL7_BUCBP       --------MSI----TKEQILDAISEMSVMNIVELISDMEKKFGVSSIIPSSSTS-----
RL7_WIGBR       --------MSI----NKQQILDAVSEMSVLEISELVSMMEKKFGVSSINNNNINV-----
RL7_BLOFL       --------MSL----KKEEVLDAISEMSVMDIMQLISMIEKKFGVSAASSHISSV-----
RL7_BAUCH       --------MSL----TKEQILEAVAKMSILDITELISMMEQKFGVSSINTIVPTS-----
RL7_MANSM       -----MIVMSL----TNEQIIEAIASKSVSEIVELISAMEEKFGVSAAAVAAAAP-----
RL7_XYLFA       --------MSL----TNEKIVEAIAEKSIMEVMELVKAIEDKFGVSAAAPVMVSG-----
RL7_METCA       --------MAV----SKEDILETISNMTVMEIVDLISAMEEKFGVSAAAAVAVAP-----
RL7_COXBU       -------MAQL----SKDDILEAVANMSVMDVVDLVKAMEEKFGVSAQAAIAVAG-----
RL7_HAHCH       --------MAL----SKDDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAVAA-----
RL7_RUTMC       -------MAKL----TNEDILNAIADMSVMNVVELVSAMEEKFGVSA-APVAAPP-----
RL7_BORAP       --------MAL----NKEDILTWLEGAKTMEVVELVTAIEEKFGVTAAVATSVGG-----
RL7_ACISJ       --------MAF----DKDAFLTALDSMTVLELNDLVEAIEEKFGVSAAAMAAPAA-----
RL7_METFK       --------MAL----SKAEILDAIASLTVLELSELIKDLEEKFGVSAAAAAVAVA-----
RL7_DECAR       --------MAI----SKEDILEAVGSLTVMELNDLVKAFEEKFGVSAAAVAV--------
RL7_NITSB       --------MAC----TREDVIEYISNLSVLELSELVKEFEEKFGVSAQPTVVAGA-----
RL7_WOLSU       --------MAI----TKEELLDYIGGLSVLELSELVKAFEEKFGVSAAPTVVAGA-----
RL7_TREDE       -------MAAL----TNEQIIEAIGEKTILELSELIKAMEEKFGVTAAAPVAVVA-----
RL7_LEIXX       -------MAKL----STDELLEAFKDLTLIELSEFVKKFEETFEVTAAAPPVAVAA----
RL7_TROWT       --MKEDGMAKI----TTDELIESFKEMTLIELSEFVSKFEEVFKVTAAAP-VAAAA----
RL7_MYCGI       -------MAKL----STDELLDAFKEMTLLELSEFVKQFEETFDVTAAAPVAVAAA----
RL7_SYNWW       -------MSKV------QEVIDIVKQMTVLELSELVKALEEEFGVSAAAP-VAVAA----
RL7_STRT2       ---MEEITMAL----NIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAD----
RL7_LACDA       --------MAL----DTANIIEQLKGASILELNDLVHAIEEEFGVTAAAPVAAAG-----
RL7_LACSS       --------MAL----DVNAIVDQLKESSILELNDLVKAIEEEFGVSAAAPVAAAGA----
RL7_OENOB       --------MAF----DKDAIIASLKEASILDLADLVKAIEDEFGVSAAAPVAAAG-----
RL7_ENTFA       --------MAL----NIENIVAELETATILELSELVKAIEEKFDVSAAAPVAVAGP----
RL7_UREP2       -------MSKL----TIEQFIAAIKEMSMLELNDLVKAIETEFGVSAAA-PVAAAA----
RL7_MYCGA       -------MAKL----TKEQFIESLKEMTIVEINDVIKAIEEAFGVSAAA-PIAAAA----
RL7_MYCGE       -------MGKL----DKKQLIESLKEMTIVEIDEIIKAVEEAFGVTATP-IVAAGA----
RL7_MYCPE       -------MAKL----SAKDIIDSLKEMSMLEIKDLIEAIETEFGVSAAA-PVAVAA----
RL7_ACHLI       -------MAKL----TKQAFVEALKEMSLLEIKELVDGLKEEFGIDPSAVAVAAGP----
RL7_MYCPU       -------MAKL----TKETFIASLKEMNIQEVMELVQAMKDEFGIDPSAVAVAAGP----
RL7_TREPR       ----------M----SNDDIVSRIASMTALELSDLVGLLEQRFNISRIAPAPCQP-----
RL7_CHLAB       --------MTKVTTQSLETLVETLSSLTVLELSALKKLLEEKWDVTAAAPVMAVAAG---
RL7_PARUW       --------MSK---KKTEELVDALSELTVLEMAELKTLLEDKWGVKAAAPV-AVAAP---
RL7_LIBAF       --------MSN-----IESIVEKLSSLTLLQAAELSKRLEEEWGVSAAAPV-AVVAS---
RL7_LEPIN       --------MST------EALLEQIGKLTLVEAADLVKKMEDKFGISAAAPVAVAAVG---
RL7_TRIEI       --------MSA----KTDEILEQLKSLSLLEASELVKQIEDAFGVSAAAPAGGMMM--PM
RL7_SYNJA       -------MASE----RVQKILEELKALSLLEASELVKAIEEAFGVSAAAPAGGMVMAAPV
RL7_SYNPX       --------MSA----KTDEILESLKSLSLLEASELVKQIEEAFGVSAAASAG-VVM----
RK12_PORPU      --------MST----KVENILEELKSLNLLEAAELVKQIEETFDVDASA-ASGGVM---M
RK12_CYAPA      --------MSS----KTDEILEQLKGLTLIEAADLVKAIEEAFGVDASAPVGGGMV---M
RK12_PHATC      --------MSE----KIDQIVEDLKTLTLLEASELVTKIEETFGVDASAAASGGVV---M
RK12_GUITH      ---------MN----KVQNIIDQLKDLTLLEAADLVKQIEETFNVSATAAAAPINM---V
RK12_GRATL      --------MNT----KITNIIEDLKSLTLLEAAELIKQIEETFDVDASITSQSQAI---V
RK12_CYACA      ---------MD----KIDEIVEKIKLLSLLEASELVKRIEDTFQVNVSNIQPVTGL---S
RK12_CYAM1      --------MST----KINSLLEEIKSLTLLEAAELVKQMETTFGIDASAVA--------T
RK12_CHLVU      --------MST----KTNEILDILKSITLLEAAELVSQIEETFGVDASAPVGGGFM---A
RK12_PROWI      --------MSA----TTLEILEKLKAITLLEATELVSQIEKTFGVDASAPAVSGLR---P
RK12_TUPAK      ---------MT----TVEQIIDQLKTLTLIESSELVKQIEETFGVDASAPVGGAIM---M
RK12_OLTVI      ---------MS----TTSEIIEKLKTLTLLEAAELVSQIEETFGVDASAPVGGGMV---M
RK12_TETOB      ---------MS----TVNEIIEKLKTLTLLEASELVSQIEETFGVDASAPVGGGVM---M
RK12_NEPOL      --------MST----ITNQIIEQLKSMTLLEAAELVSQIEETFGVDASAPAAGAVM---V
RK12_EUGGR      --------MST----ETDEILERLKKITLLEAYELVKQIENTFGVDATIALSASNT---N
RK12_CHAVU      --------MEEKEQVDLNQLLNAIKSLTLQEIKIFTDKLQDELGISSDNLYSSRGIL---
RK12_EUGLO      ---------MDKLSEFCSKFVENVMKMTVNQLNKVTKELAKKITIDSNFKSVTDNNS---
RK12_HELSJ      ----------MTFNKKINEIITLLSDLNILELNSLINEIRNQFQIPDIVSTIQTGNK---
                                   .   .   .  :   .         :               

RL7_RHIEC       --VGGAAGGAAAPAEEEKTEFDVILTDAGA---NKINVIKEVRA-ITGLGLKEAKDLVEG
RL7_RICFE       --AGAAAPAAEAAAE--KTEFEIVLMAAGD---KKVEVIKVVKD-ITGLGLIEAKKLVDE
RL7_SOLUE       --AGGGAAAAAPAAEE-KTEFTVVLTGAGA---NKINVIKAVRE-VTSLGLKEAKDLVDG
RL7_CHLTE       --VMAAPAGEAAAAEE-KTEFDVVLKSAGA---NKINVIKVVRA-ITGLGLKEAKDMVDG
RL7_PORGI       --VAAAPGAAGAAAEEEKTSFDVVLKSAGA---AKLQVVKAVKE-QCGLGLKEAKDLVDA
RL7_RUEST       --VAAGGDAAGGAAEEEKTEFDVVLKNAGA---SKINVIKEVRG-ITGLGLKEAKELVEA
RL7_SALRD       --ADGGGGADGDAEEEEQTAFDVVLTGIGG---NKIQVIKEVRS-ITGMGLKEAKSLVDE
RL7_THET2       --APAAGAAAAPAEE--KTEFDVILKEAGA---KKLEVIKELRA-ITGLGLKEAKDLAEK
RL7_DEIRA       --GGGAGAASPAAEE--KTEFDVVLIDAGA---SKINVIKEIRG-ITGLGLKEAKDMSEK
RL7_FUSNN       --VAAAGGATEAAEE--KTEFDVVLKSAGG---NKIAVIKEVRA-ITGLGLKEAKDLVDN
RL7_CHLAA       PVAAAGDGAAAAAPVEEKTEFDVILKEAGP---NKIQVIKVVRE-LTSLGLKEAKDLVEG
RL7_DEHM1       --PAAGGAAVAAAAEEEKTEFNVILKDVGA---NKINVIKAVRE-LTSLGLKEAKDMVEA
RL7_SYNAS       -AAVAGAAGEAAAPAEEKTEFDAILTGFGD---QKIQVIKVVRA-ITGLGLKEAKDLVEG
RL7_SYNFM       -AAMPAGAAEAA-PVAEQTEFSVVITGVGD---KKIQVIKEVRA-ITNLGLKEAKDLVEK
RL7_PELPD       -AAAGPATADAA-AAEEKTEFDVILKAAGA---NKINVIKVVRA-LTSLGLKEAKDLVDG
RL7_PSELT       --AAAPAAGAQQAQAEEKTEFDVLLKGFGS---NKIGVIKVVRE-ITGLGLKEAKDLVEK
RL7_FERNB       --PVAGAAAPSAAAAEEKDSFDVLLKSFGA---KKVEVIKVVRE-ITGLGLKEAKDLVEK
RL7_AQUAE       --PAAGAAAGAPAQAEEKTEFDVILKSPGK---NKIQVIKVVRE-ITGLGLKEAKELVDN
RL7_CLOBH       --AGAAAGAGAA---EEKTEFDVVLADAGS---EKIKVIKAVRE-VTGLGLKEAKALVDG
RL7_ALKOO       ----PVAGAAVE---EEQTEFDVVLENAGA---SKINVIKVVRE-LTGLGLKEAKEAVDG
RL7_PSYIN       --GPAE-------VVEEQTEFDVIMTTFGE---NKVKAIKAVRA-ATGLGLKEAKDAVES
RL7_PHOPR       --AAAE-------AAEEQTEFDVILTAVGA---QKVQVIKAVRG-ATGLGLKEAKAVVDS
RL7_CHRSD       --GAGG----EGEAAEEQTEFDLVLTGAGD---KKVNVIKVVRE-ITGLGLKEAKGAVDG
RL7_HALHL       --AAGGGGGDEGGAAEEQTEFDVILSSHGD---NKVGVIKAVRG-VTGLGLKEAKEVVEG
RL7_PSEF5       --AAAA-------VVEEQTEFNVMLTEAGE---KKVNVIKAVRE-LTGLGLKEAKAVVDG
RL7_BUCAI       --HNEKDLRE------EKTEFDIFLKVIGP---NKVSVIKTVRS-ATGLGLKEAKDLVES
RL7_BUCBP       --TQNIETAE------AKTEFDVLLKSIGG---NKVSVIKAVRS-ATGLGLKEAKDLVES
RL7_WIGBR       --NKVDESVE------EKSEFDVLLLEIGK---NKISVIKSVRS-ALSLGLKESKDLIES
RL7_BLOFL       --ENVVTESEST--QVEQTEFTVILSSIGG---NKIPVIKAVRS-ITGLGLKEAKDLVES
RL7_BAUCH       --SPAETVEE-------KTEFDVVLTNIGA---NKIAVIKAVRG-VISLGLKEAKDLVES
RL7_MANSM       --AAGAAAAE------EKTEFDVVLKAAGA---NKVAVIKAVRG-ATGLGLKEAKDLVES
RL7_XYLFA       --SAAAAAPVE-----EQTEFTVTLKEAGA---KKVEVIKAVRA-VTGLGLKEAKDLTEA
RL7_METCA       --VAAGAAAPAV---EEKTEFDVVMTSFGA---NKVNVIKAIRE-ITGLGLKEAKDLVEG
RL7_COXBU       --PVAGGEAAAA---EEKTEFNVKMVSFGD---NKIGVIKAIRT-ITGLGLKEAKDLVES
RL7_HAHCH       --APA-ADAAAV---EEKTEFDVVLQSAGE---KKVNVIKVVRG-ITGLGLKEAKDLVDG
RL7_RUTMC       --VVADTIDDVV---VEKDEFDVMLTSFGK---KKVAVIKMARS-ITGLGLKEAKDMVES
RL7_BORAP       --AASTGSTDS----EEQTEFDVILMSFGD---SKINVIKEVRS-ITGLGLGEAKALVES
RL7_ACISJ       --GGAAGGG--AAAAEEKTEFNVVLADAGA---NKVAVIKAVRE-ITGLGLKEAKDLVDG
RL7_METFK       --APAAGGGDAGAAAAEKTEFDVILASAGD---NKVNVIKAVRE-LTSLGLKEAKDLVDA
RL7_DECAR       --AGPAGAG--AAAAEEQTEFTVMLTGAGD---KKVEVIKVVRA-ATGLGLKEAKDLVDG
RL7_NITSB       --VAAGGAEGGA-AAEEKTEFDVVLTDAGP---KKINTIKVIRQ-VTGLGLKEAKEAAEN
RL7_WOLSU       -----GAGVAAA-AVEEKTEFDVILLDGGE---KKINVIKVVRE-LTGLGLKEAKDAVEK
RL7_TREDE       --GGAAGGGAAE---EEKTEFTVTLKGLSDP-GKKIGVIKEVRNVIPGLGLKEAKELVEG
RL7_LEIXX       -APAAGGAGAAAEDAEQKDSFDIVLESVDA--SKKIQVIKEVRAL-TSLGLGEAKALVDG
RL7_TROWT       -APVE----PAAEAAPEKTTFDVILEAAG---DKKIQVIKEVRTI-TGLGLGEAKALVDG
RL7_MYCGI       -GPAAG--GGAAEAAEEQSEFDVILEGAG---EKKIGVIKVVREIVSGLGLKEAKDLVDS
RL7_SYNWW       -APAAG---AVAEAVEEQYEFDVILTSSG---EKKINVIKVVREI-TGLGLKEAKTLVDE
RL7_STRT2       ---------GAADAGAAKDSFDVELTSAGDK---KVGVIKVVRE-ITGEGLKEAKAIVDG
RL7_LACDA       ---------AAGGAEEAKSSFDVELTSAGTE---KVKVIKIVKE-ATGASLLDAKKTVDG
RL7_LACSS       ---------AGADAAAEKDSFTVELSEIGQE---KVKVIKAVRE-ITGLGLKDAKGLVDN
RL7_OENOB       ---------AAGDDAAAKDSFDVELTEPGQA---KIGVIKAVRD-ATGLGLKESKDLVDG
RL7_ENTFA       ---------AAGGAAEEQTEFTVELTAAGDQ---KVKVIKAVRE-ATGLGLKEAKAVVDG
RL7_UREP2       ---------APVA-AEAPTEVTIKLVEAGTN---KVGVIKLIRE-ITGLGLMEAKTAAET
RL7_MYCGA       ---------AAPA-AAAPTEATVVLVSAGDK---KVEVIKLVRE-VTGLGLMDAKKAVDT
RL7_MYCGE       ---------AGAT-QEAASEVSVKVTGYADNA--KLAVLKLYRE-ITGVGLMEAKTAVEK
RL7_MYCPE       ---------APAGGAAAPSEVTVTLKDVGGN---KVAVIKVVRE-ITGLGLMEAKALVDN
RL7_ACHLI       ---------AAAAEVEEKTEFNVVLKSFGDK---KIEVIKVTRE-VTGLGLVEAKKLVET
RL7_MYCPU       ---------AAEVS-EEKTSFNVILKSDGGA---KIAVIKAIKE-ALGLSIMDAKKMVES
RL7_TREPR       -------GSNAVEAEQDRRDRKVFLTHSGS---NKIAVIRAVRD-VTKLGLKESKGLVDS
RL7_CHLAB       -----AAGAGAEAAPAESTEFAVTLEEVPAD--KKIGVLKVVRE-VTGLALKEAKEMTEG
RL7_PARUW       -----AAGAPA-AAVVESTDFQVTLTEAPAD--KKIGIIKVVRE-ITGLGLKEAKDLVEA
RL7_LIBAF       -----AAGESA-AAVAEKTEFEVFLEGFDAK--KKISVIKEVRA-ITELGLKEAKDFVES
RL7_LEPIN       -----AAPAGA-GAAEEASTFNVILKGFDSA--KKIEVIKLVRE-ITGLGLADAKGLVEA
RL7_TRIEI       AMPGAPGAAAA-EPEEEQTEFDAILTEFPSD--KKIAILKVVRS-ITGLGLKEAKELVES
RL7_SYNJA       AAAAAPAPAAAPEPVEEQTAFDVILEAVPAD--KKIAVLKVVRE-LTGLGLKDAKDLVEA
RL7_SYNPX       AAPGAAAGGGGGEVAEEKTEFDVILESFDAA--AKIKVLKAVRN-ATGLGLGDAKALVEA
RK12_PORPU      AAPSSA-PAASDV--EEKTEFDVVLEEVPAP--KKIAVLKVVRS-LTGLGLKEAKDLVES
RK12_CYAPA      MAPAAG-GGADAA--EEKSAFDLVLEEVPAD--KKIAVLKVVRS-LTNLGLKEAKDLVEA
RK12_PHATC      AAAPA---VVEEV--EEKTEFNLMLDEVPAD--KKIAVLKVVRS-LTGLGLKEAKELVES
RK12_GUITH      AATAGA-GSAEAV--EEKTEFDLILEDVPAD--KKIAVLKVVRG-LTGLGLKEAKDLVEA
RK12_GRATL      MPTAVDNSNKNEI--EEKTEFDIILEEVPAA--KKIAILKVVRS-ITGLGLKEAKALVES
RK12_CYACA      SNLTTTQQTPESA--EVKEKWDVILENVPAD--KKIAILKVVRS-ITGLGLKEAKEFVES
RK12_CYAM1      AAPAVQVETKK----EEKTEFALVLSQVPAD--KKINVLKVVRT-ITGLGLKEAKELVDS
RK12_CHLVU      APGGAGTAAAEI--VEEKTTFDVIIEDVASD--KRVPVLKVVRN-LTSLDLKEAKEAITS
RK12_PROWI      ILVEP-IKQEDI--IEEKTTFDVILEEVPSD--KRVPILKVIRA-LTSLDLKQAKESITD
RK12_TUPAK      APGQESAGQEVV---EEKTTFDVIVKDIASD--KRVSVLKVIRK-LTSLGLAEAKEFTVS
RK12_OLTVI      AVGDAGGAAEEV---AEKTTFDVVVEDIPSD--KRVAVLKVIRK-LTSLGLAEVKAFTNS
RK12_TETOB      AAMPAAGGADAAPKEEEKTLFDVVLEEIPAD--KKVGIYKVVRN-IANIAVNQVKEFTGT
RK12_NEPOL      AAAAPS---APVV--EEQTEFTVMINDVPSA--KRIAVIKVVRA-LTGLGLKEAKDMIES
RK12_EUGGR      PSILPSKADETVV--EEKTEFDVIIQEVPSA--KRINVIKTVRS-LTTLGLKEAKDLIES
RK12_CHAVU      TESTSH--NKEVEEIDEKTEFDIILEEVPSS--SRITVIKVIRS-ITNSGLKEAKEFIEA
RK12_EUGLO      VIESSK--EITENKVIEKLEFNIILESFISS--QRIKLIKTLRD-LISIGLKEAKDLIET
RK12_HELSJ      TKPEANIIEQKESAEIKKSNFELILQTVPTE--KRVAVLKAIRN-TTSLDLKGAKDSIAD
                                        :         ::   :  :       :   *     

RL7_RHIEC       APKA---VKEGVSKAEAADIKKKLEDAGAKADVK----
RL7_RICFE       APKP---MKSNVKKAEAEEIKGKLEAAGAKVELK----
RL7_SOLUE       APKP---IKEGVSKEEAATIAKKFTDAGATVEVK----
RL7_CHLTE       APKT---VKEAVSKDEAEKIAKELKDAGAEVELN----
RL7_PORGI       APST---VKEGVDKATAEALKKALEEAGAEVELK----
RL7_RUEST       G-GK---IKEGVDKAEAEDIKGKLEAAGAEVELA----
RL7_SALRD       APNP---VSEGVSREEADDLKAQIEDAGGEVELQ----
RL7_THET2       G-GP---VKEGVSKQEAEEIKKKLEAVGAVVELK----
RL7_DEIRA       G-GV---LKEGVAKDEAEKMKAQLEAAGARVELK----
RL7_FUSNN       G-GV---IKEAAPKDEANAIKEKLTAAGAEVEVK----
RL7_CHLAA       APKP---VREGVSKEEAEAAKAKLTEAGAVVEIK----
RL7_DEHM1       APKA---VKENVSKEEADAAKKALEAAGATIEIK----
RL7_SYNAS       APKP---IKEAVSKDEAADIKKKIEEVGGTVEVK----
RL7_SYNFM       VPGV---VKEAIPKDEAEAIAKQLTEAGATVEIK----
RL7_PELPD       APGA---VKTGVSKQEAEDAQKQLVEAGAEVEVK----
RL7_PSELT       AGSPDAIVKSGIPKNEAEDIKKKLEEAGAEVTLK----
RL7_FERNB       AGAADAFIKQGVKKEEAEEIKKKITEVGGEVEIK----
RL7_AQUAE       APKP---IKEGVPKEEAEQIKKKLEEAGAEVELK----
RL7_CLOBH       A---PKTLKEAASKEDGEAIKAKLEEVGAKVELK----
RL7_ALKOO       A---PKTLKEGVSKEEAEQIKAKLEEAGAAVTVK----
RL7_PSYIN       C---PVAIKEGISKADAEALKAVLEEIGATVELK----
RL7_PHOPR       A---PASVKEGVDKAEAEALKAQLEEVGASVEIK----
RL7_CHRSD       V---PATLKEGMSKEDAEAAKTKLEEAGASVELK----
RL7_HALHL       C---PAPIKEGASKEEADDIKAKLEEAGASVELK----
RL7_PSEF5       A---PAMVLEAVAKEAADKAKAALEEAGAKVELK----
RL7_BUCAI       A---PTVLKENISKEDAESLKKTLEDVGAEIEIK----
RL7_BUCBP       A---PTIIKERITQDAAESLKKILNETGAEVEIK----
RL7_WIGBR       EL--PITLKTGLNKKDAESLKKEIETSGARIELK----
RL7_BLOFL       A---PVTLKESVSKDDADNLKKTLESVGASVEIK----
RL7_BAUCH       A---PITLKESISKDEAAALKKILEDAGASVEIK----
RL7_MANSM       A---PANLKEGVSKEEAESLKKELEAAGAEVEIK----
RL7_XYLFA       G----GILKEAVSKEEAEKVKKELEAAGATVEVK----
RL7_METCA       V---PSTVKEGISKAEADDIKKKLEEAGAAVDVK----
RL7_COXBU       V---PSVVKESVSKEEAEKIKKELEEAGAKVELE----
RL7_HAHCH       A---PSTVKEALSKDDAEKAKKELEEAGATVELK----
RL7_RUTMC       A---PVVIKEGASKVEAEDIQKQLEEAGASVELK----
RL7_BORAP       A---PKAIKEGLSKSDAEELKKKLEAVGAKVEVK----
RL7_ACISJ       A---PKNVKEGIAKADAEAAVKKLVEAGAKAELK----
RL7_METFK       A---PKAIKEGVSKADAEAAAKKLEEAGAKAEIK----
RL7_DECAR       A---PKAVKEGVSKADAEALKAQLEAAGAKVEVK----
RL7_NITSB       T---PTVIKEGVSKEEAEELKKQFEEAGAKVEIK----
RL7_WOLSU       T---PTTIKEGANKDDAAAMKAKLEEAGAKVEIK----
RL7_TREDE       A---PKVLKEDVSKEEAAKIKEAITAAGGEVEIA----
RL7_LEIXX       A---PSTVLEGANKEAADKAKTQLEGAGGTINLK----
RL7_TROWT       V---PSKVLEGANKDAADAAKAQLEAAGAQVSVK----
RL7_MYCGI       A---PKPLLEKVNKEAAEDAKAKLEAAGASVTVK----
RL7_SYNWW       C---PNPVKEKITKEEANEIKAKIEEAGGSVEVK----
RL7_STRT2       A---PSVIKEGVAAAEAEEIKAKLEEAGASVTLK----
RL7_LACDA       A---PVVLKEGLSEDEANELKAKLEEVGATVTLK----
RL7_LACSS       A---PSALKEDVSKDEAEEMKAKLEEVGAVVNLK----
RL7_OENOB       A---PSVIKKDLNESDANDLKSKLEAAGATVALK----
RL7_ENTFA       A---PAPVKEAVSKEEAEALKAALEEVGASVTVK----
RL7_UREP2       A---GSVIKEDVKTEEANEIKKKFDELGAKVQLV----
RL7_MYCGA       P---PATIKENMNIEEAKALKAKFEAVGAKVDLK----
RL7_MYCGE       L---PCVVKQDIKPEEAEELKKRFVEVGATVEVK----
RL7_MYCPE       A---PSKVKEGVKLADAENMKKQFAEAGATVEW-----
RL7_ACHLI       A---DAVIKENAKKDEAEALKAKFEAAGAVVEIV----
RL7_MYCPU       T---PVAIKENLKADEAEELRKSIAASGAEVVVE----
RL7_TREPR       A---PSLVAEGLSADEAEDIRAKVEAAGAKAEVR----
RL7_CHLAB       L---PKVVKEKTSKSDAEETVKKLQEAGAKASFKGL--
RL7_PARUW       A---PKELKPTAPKAEAEDIKKKIETAGGKVTLKGL--
RL7_LIBAF       A---PKSLKTGVSKDEAEELKKKLEAAGATIILR----
RL7_LEPIN       G---GKAVKEGVAKAEADDLKKKFEGAGAQIELKAS--
RL7_TRIEI       V---PKPLKEGIAKEAAEDIKKQLEEAGAKVEIK----
RL7_SYNJA       A---PKPVKEGIPKEEANEIKKKLEEAGATVKVK----
RL7_SYNPX       A---PKPIKEGISKDEAEALKKEIEEVGGKVTLK----
RK12_PORPU      A---PKTLKEGASKDDAEAMKKQLEDAGATVGVK----
RK12_CYAPA      T---PKVVKEGASKDELKQLKKNLKQLEQK--------
RK12_PHATC      A---PKQIQEGLGKDAAEEAKKQIEAAGGKASLT----
RK12_GUITH      A---PKPIKEGMSKADAEAGKKQLEEAGAKATLK----
RK12_GRATL      A---PKMIKDNTNKENSEEIKQQLEEAGAKVSIK----
RK12_CYACA      V---PKIIKQSISQADAEHIKQQIEDAGASVVLK----
RK12_CYAM1      V---PKTLKEGLSASEAEQLKTQLTEAGAQVELK----
RK12_CHLVU      L---PKVIQQGVSKDDAEASKKQLEDAGAKVKIS----
RK12_PROWI      L---PKTILQGVSKEESEAAKQQLEAVGGKIKVS----
RK12_TUPAK      L---PKALKEGISKEEAAEAKKDLELAGAVVDIV----
RK12_OLTVI      L---PGTLQEGISKEEAETAKTELEAAGAVVKIA----
RK12_TETOB      L---PKALKESVSKEEAEAAKQQLEDAGAKVKIV----
RK12_NEPOL      V---PKAIKEGIGKDEAQQIKQQLEEAGATVTVK----
RK12_EUGGR      V---PKVVCEAVSKEVAEETKKLLEEAGASIIIK----
RK12_CHAVU      L---PKTVKEGISKEEAESVKAQLEESGAKVTLR----
RK12_EUGLO      L---PKTIYEGVSKEFAEETKKTLEESGASVIITENII
RK12_HELSJ      L---PKKLLDNLSLEEAEKAKTLLEEAGATVILA----
                       :               .