CLUSTAL format seed alignment for MF_00371

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS27_METAC        ----------------------MVDYTQRPKSRFLRVKCNDCENEQIIFGSASRKITCVV
RS27_METMA        ----------------------MVDYTQRPKSRFLRVKCNDCENEQIIFGSASRKITCVV
RS27_METBF        ----------------------MVDYIQRPKSRFLRVKCNDCENEQIIFGSASRKITCVV
RS27_METKA        -----------MDEKRFLKRFTESDLVPQPRSRFLRVECVDCGNEQIIFGNASTEVKCHI
RS27_METLZ        ---------------------MVKAS-RETRSKFLKVKCPDCENEQLVFEKATSVVECTV
RS27_METMJ        ---------------------MVRVN-RENRSTFLRVKCPDCENEQVVFERASTVVECTV
RS27_METPE        ---------------------MVRLY-RENRSKFYRVKCPDCENEQIIFEKASTVVDCVV
RS27_METB6        ---------------------MVREA-RANRSSFLKVKCPDCDNEQTVFSKASTTVKCVV
RS27_METHJ        ---------------------MVQLT-RENRSKFVKVKCPDCENEQTIFDRACTPVDCIV
RS27_ARCFU        -----------------------------MHSRFVKVKCPDCEHEQVIFDHPSTIVKCII
RS27_HALSA        -----------------------------MSGGFYNVECPDCENEQTVFGKASTEVACAV
RS27_HALS3        -----------------------------MSGGFYNVECPDCENEQTVFGKASTEVACAV
RS27_HALMA        -----------------------------MAGSFITVECPDCENEQSLFEKAASEVSCAV
RS27_HALLT        -----------------------------MAGSFHRVACGDCENEQVVFGKASSVVSCAV
RS27_NATPD        -----------------------------MAGDFIRVHCDDCENEQVLFGKAANTVNCAV
RS27_THEAC        -----------------MADVKFVKP-KNINGHFVKIKCRDCGNVQVVFARPSSTVTCNI
RS27_THEVO        -----------------MSEVKFVKP-KNVSGHFLKIKCKDCGNVQVVFARPSSVVTCNI
A5UMB1_METS3      ---------------------MVS----KGRGNFLKVKCLDCDNEQIIFDRAASDVKCII
B9AFB5_METSM      ---------------------MVS----KGRGNFLKVKCLDCDNEQIIFDRAASDVKCII
D2ZPA0_METSM      ---------------------MVS----KGRGNFLKVKCLDCDNEQIIFDRAASDVKCII
RS27_METTH        ---------------------MIGVIFYNTKGNFLRVKCLDCGNQQVVFDRAASYVQCII
A4G0L1_METM5      -----------------------MQLISKPKSRFLKVQCTDCNNEQVIFGCPSTEVKCAG
A6VHX4_METM7      -----------------------MQLISKPKSRFLKVQCTDCNNEQVIFGCPSTEVKCAG
A9A8V5_METM6      -----------------------MQLISKPKSRFLKVQCTDCNNEQVIFGCPSTEVKCAG
G0H468_METMI      -----------------------MQLISKPKSRFLKVQCTDCNNEQVIFGCPSTEVKCAA
Q6LWK1_METMP      -----------------------MQLISKPKSRFLKVQCTDCNNEQVIFGCPSTEVKCAA
A6UQZ1_METVS      -----------------------MQLISKPKSRFLKVQCTDCSNEQVIFGCPATEVKCTS
A6UUW3_META3      -----------------------MALIPKPRSRFLKVQCPDCSSTQTIFGCPATDVVCIT
RS27_METJA        ----------------------MMELIPQPRTKFLRVQCPECNNEQIVFGSPATVVKCLT
RS27_PYRAB        -------------------MALPRNVIPMPRSRFLRVKCIDCGNEQIVFSHPATRVRCNV
RS27_PYRHO        -------------------MSLPRNVIPMPRSRFLRVKCIDCGNEQIVFSHPATRVRCLV
RS27_THEGJ        -------------------MALPKNLIPMPRSRFLRVKCIDCGNEQIVFSHPATKVRCLV
RS27_THEON        -------------------MALPKNLIPMPRSRFLRVKCIDCGNEQIVFSNPATTVRCLV
RS27_THEKO        -------------------MALPKNLIPMPRSRFLRVKCIDCGNEQIVFSHPATPVRCLV
RS27_PYRFU        ---------------------MAKPIIPMPRSRFLRVKCIDCGNEQIVFSHPATKVRCLI
RS27_PYRAE        -----------------MPVRFSKVLIPQPKSKFIKTRCPDCGNEQITFSHAAMVVRCLV
RS27_PYRIL        -----------------MPVKFSKVLIPQPRSKFIKVRCPDCGNEQVVFSHAAMVVRCLV
RS27_PYRAR        -----------------MPVKFGKVLIPQPRSKFVKIRCPDCGNEQVTFSHAAMVVRCLV
RS27_PYRCJ        -----------------MPQRFSRVLIPQPRSRFVRLRCPDCGNEQVTFSHAAMVVRCLV
RS27_PYRNV        -----------------MPARFGKTLIPQPRSRFIKVRCPDCGNEQVTFSHAAMVVRCLV
E1QPE4_VULDI      -----------------MPTNWRSVLVPRPRSRFLRVRCNNCGNEQVVFDRPAMVVRCLV
RS27_AERPE        -----------MAFAPPLPIRRRKVLIPRPRSRFLLVTCPKCGNRQVVFSHSTFRARCLN
RS27_HYPBU        ------------------MVSKFKILVPQPRSRFLLVRCPVCGNEQVIFSHATFPARCLV
RS27_SULAC        ------------------MKAKFKILIPEPKSKFIRVKCRQCNNEQVIFSNATFPVRCLS
RS27_SULTO        ------------------MKAKFKVLIPEPKSKFIRIKCPNCGNEQTVFSHATFPVRCLS
RS27_SACS2        ------------------MMRKLRVLIPEPKSRFLRVKCPNCGNEQTIFSHATFPVRCLS
D5U2T1_THEAM      -------------------MRKRKLLIPQPRSRFYKVICKTCGAENVVFSHASFPTRCKV
RS27_BOVIN        MPLA--KDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27_HUMAN        MPLA--KDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27_MOUSE        MPLA--KDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27_RAT          MPLA--KDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27_PONAB        MPLA--KDPLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27_XENLA        MPLA--KDLLHPTPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27L_HUMAN       MPLA--RDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27L_MOUSE       MPLA--RDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27L_RAT         MPLA--RDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27L_BOVIN       MPLA--RDLLHPSLDEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVG
RS27_HOMAM        MPLA--KDLLHPSPSEEKRKCKLKRLVQHPNSYFMDVKCPGCFKISTVFSHAQTVVACVG
RS27_CAEEL        MPLA--VDLLHPEPQREIRCHKLKRLVQHPNSYFMDVKCSGCFKISTVFSHATTVVVCVG
RS27_NEUCR        MVLA--VDLLNPSPASEARKHKLKTLVPAPRSFFMDVKCPGCFTITTVFSHAQTVVICQG
RS27_SCHPO        MVLA--VDLLNPSHESEMRKHKLKQLVQGPRSFFMDVKCPGCFNITTVFSHAQTVVICGS
RS271_ARATH       MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGN
RS272_ARATH       MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
RS273_ARATH       MVLQNDIDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN
RS27_HORVU        MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCPG
RS27_CHLRE        MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGS
RS27_DICDI        MAKER-GDLLFPSIESEKRKHKLKRLVQAPNSFFMDINCHGCRTITTVFSHAQNVVICSS
RS27A_YEAST       MVLV--QDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCES
RS27B_YEAST       MVLV--QDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCES
RS27_ENTHI        MPLIE-VDLLNPTAASEAKAHKMKRLVPTPNSYFLEIKCPKCGATTTTFSHAHRQILCQK
                                                   *    *  *      *  .     *  

RS27_METAC        CGRTLAEPTGGKSTITT---HILEVLE---
RS27_METMA        CGRTLAEPTGGKSTITT---HILEVLE---
RS27_METBF        CGRTLAEPTGGKSTITT---HILEVLE---
RS27_METKA        CGRTLAKPTGGKAKILT---KIKEVLE---
RS27_METLZ        CGRILAEPTGGKAALKA---DIVATFE---
RS27_METMJ        CGRILAEPHGGKADIKA---EIMAVLE---
RS27_METPE        CGHVLAEPRGGRAALKA---EILAELE---
RS27_METB6        CGRDLATPTGGKANLKA---EIISEFK---
RS27_METHJ        CGSNLATPTGGKAQIKA---EIITAFE---
RS27_ARCFU        CGRTVAEPTGGKGNIKA---EIIEYVDQIE
RS27_HALSA        CGTTLARPTGGEADLLG---EVIETVEAR-
RS27_HALS3        CGTTLARPTGGEADLLG---EVIETVEAR-
RS27_HALMA        CGHTIARPTGGKADIEG---EVTAVVEAR-
RS27_HALLT        CGTTLATPTGGEAEFHG---EIVETVEAR-
RS27_NATPD        CGSTLATPTGGEADLHG---DVVDVVESR-
RS27_THEAC        CGATIAKPTGGILATSG---EVVEVL----
RS27_THEVO        CGATIAKPTGGVLETSG---EVIESL----
A5UMB1_METS3      CGKTLVKSRGAKAKIMA---HIDKVLN---
B9AFB5_METSM      CGKTLVKSRGAKAKIMA---HIDKVLN---
D2ZPA0_METSM      CGKTLVKSRGAKAKIMA---HIDKVLN---
RS27_METTH        CGKTLVEPTGGKSKIKA---QILEVLD---
A4G0L1_METM5      CGKIIAEPKASKGAIKA---KILEVLQ---
A6VHX4_METM7      CGKIIAEPKASKGAIKA---KILEVLQ---
A9A8V5_METM6      CGKIIAEPKASKGAIKA---KILEVLQ---
G0H468_METMI      CGKIIAEPKASKGAIKA---KILEVLQ---
Q6LWK1_METMP      CGKIIAEPKASKGAIKA---KILEVLQ---
A6UQZ1_METVS      CGKIIAEPKASKGAIKA---KILEVLQ---
A6UUW3_META3      CGKVLAKPRASKGLIKA---KILGVLE---
RS27_METJA        CGKVLVEPRGGKGKVKA---KILEILG---
RS27_PYRAB        CGATLVEPTGGKGIIRA---KILEVLE---
RS27_PYRHO        CGATLVEPTGGKGIVKA---KILEVLE---
RS27_THEGJ        CGATLVEPTGGKGVIKA---KILEVLE---
RS27_THEON        CGATLVEPTGGKGVIKA---KILEVLE---
RS27_THEKO        CGATLVEPTGGKGIIKA---KVLEVLE---
RS27_PYRFU        CGATLVEPTGGKGIVKA---KILEVLE---
RS27_PYRAE        CGRVLAIPTGGKAKLAG---HVVKVLE---
RS27_PYRIL        CGRVLAEPTGGKARLAG---HVVKILE---
RS27_PYRAR        CGRVLAQPTGGKAKFAG---HIVKILE---
RS27_PYRCJ        CGRVLAQPTGGKAIFAG---HVVKVLE---
RS27_PYRNV        CGRVLAQPTGGKARLAG---HVIKVLE---
E1QPE4_VULDI      CGNVLIEPTGSKGRIVGA--TVVAVYE---
RS27_AERPE        CGEVLVEPTGGKARIL---GKIERIYG---
RS27_HYPBU        CGAQLVEPTGGKAKIL---GQVVRVLG---
RS27_SULAC        CGAQIVIPKGGKAKIE---GDTVRILG---
RS27_SULTO        CGTQLVYPRGGKAKIV---GETVRILG---
RS27_SACS2        CGTELVYSMGGKAKIV---GEVVRIMG---
D5U2T1_THEAM      CGTQLVKPTGGRALVLKDKSEIVAELG---
RS27_BOVIN        CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27_HUMAN        CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27_MOUSE        CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27_RAT          CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27_PONAB        CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27_XENLA        CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27L_HUMAN       CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27L_MOUSE       CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27L_RAT         CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27L_BOVIN       CSTVLCQPTGGKARLTE--GCSFRRKQH--
RS27_HOMAM        CATVLCQPTGGKAKLTD--GCSFRKKQN--
RS27_CAEEL        CNTVLCQPTRGKAKLTE--GCSFRKKQ---
RS27_NEUCR        CTTVLCQPTGGKARLTE--GCSFRRK----
RS27_SCHPO        CASVLCQPTGGKARLME--GCSFRRKN---
RS271_ARATH       CQTLLCTPTGGKAKLTE--GCSFRKK----
RS272_ARATH       CQTILCQPTGGKAKLTE--GCSFRRKGD--
RS273_ARATH       CQTVLCQPTGGKARLQE--GCSFRKK----
RS27_HORVU        CQTVLCQPTGGKARLTE--GCSFRRKGD--
RS27_CHLRE        CSSVLCTPTGWPRRLTE--GCSFRRKSD--
RS27_DICDI        CSTVIAQPTGGRARITA--GCRLRQKSD--
RS27A_YEAST       CSTILCTPTGGKAKLSE--GTSFRRK----
RS27B_YEAST       CSTVLCTPTGGKAKLSE--GTSFRRK----
RS27_ENTHI        CGQPLGQPTGGKLKLTQ--QCKFRIKK---
                  *   :  .