CLUSTAL format seed alignment for MF_00373

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL28_LEUMM       MAK-DAITGARTRFGNQRSHALNS-------------SRRSWKPNLQKVTVKIN-GAAPK
RL28_OENOB       MAK-DAITGARTRFGNQRSHALNA-------------NRRSWKPNLQKVTVKIN-GDAAK
RL28_BACSU       MARKCVITGKKTTAGNNRSHAMNA-------------SKRTWGANLQKVRILVN-G-KPK
RL28_LISMO       MAKECVITGRKSRSGNKRSHAMNS-------------SKRTWKANLQKVRILVN-G-KPK
RL28_BACHD       MARKCYITGRQAKSGNKRSHAMNK-------------TKRRWGANVQKVRILVD-G-KPK
RL28_GEOSE       MAK-CFITGKKKSFGNTRSHAMNA-------------SRRDWKANLQKVRILVD-G-KPK
RL28_STAAM       MGKQCFVTGRKASTGNRRSHALNS-------------TKRRWNANLQKVRILVD-G-KPK
RL28_STRPN       MAKVCYFTGRKTVSGNNRSHAMNQ-------------TKRAVKPNLQKVTVLID-G-KPK
RL28_STRP1       MAKVCYFTGRKTVSGNNRSHAMNQ-------------TKRTVKPNLQKVTILVD-G-KPK
RL28_LACLA       MSKECYFTGRKTVSSNNRSHAMNQ-------------TKRVVKPNLQKVTILEN-G-ELK
RL28_AQUAE       MAD-SEICGKRPVVGRRVTLSGER-------------NRRIFKPNVHKMRVMLP-DGTVK
RL28_THEMA       MAKRCEVCGKAPRSGNTVSHSDKK-------------SGRWFRPNLQKVRVVLP-DGTIK
RL28_CLOAB       MSRKCDICGKGLVAGVQYSHSHRQ-------------SKRTWLPNIRKIKAVV--DGTPK
RL28_CLOPE       MARRCEICNKGVVAGVQYSHSHRQ-------------SKRTWAPNIKKVKAIV--KGTPK
RL28_SELRU       MASVCEICAKGELSGNNVSHSHLK-------------TRRTWKPNIQRVRAVV--EGEVK
RL28A_STRCO      MAANCDVCGKGPGFGNNISHSHRR-------------TSRRWNPNIQRVRTVV--SGTPK
RL28_TREPA       MARRCGLCGKGTISGCAVSKSMHH-------------CKRVWKPNLLAVRVVV--DGSAL
RL28_MYCGE       MAKKDQLTLRGPLYGNNRSHSKTI-------------TRRKWNVNLQSCKIKDT-NGKVT
RL28_MYCPN       MAKKDQLTLRGPLYGNNRSHSKTI-------------TRRKWNVNLQPCKVKTA-DGKTT
RL28_UREPA       MAKRDQLTGKGPLSGNTRSHAMNH-------------SKRRWNVNLQKATIKTE-NG-SQ
RL28_MYCPU       MSRRDDLTGKGPMFGNNRSHALNA-------------TRRRFNLNLQKVSV-VV-NGRKV
RL28_BRUME       MSRACELTGKSVQYGNNVSHANNR-------------TRRRFLPNLCNVTLISETLGQSY
RL28_RHILO       MSRTCELTAKAVQTGNNVSHANNK-------------TKRRFLPNLVNVTLISEALNQNV
RL28_RHIME       MSRSCELTGKGVQSGNNVSHANNK-------------TKRKFLPNLCNVTLISDALGQRF
RL28_CAUVC       MSRRCELTGIGPMVGHNVSHSNIK-------------TKRRFLPALSPATLQSESLGQSF
RL28_RICCN       MSRKCELTGVGVLYGNNVSHSQRK-------------TRRRFEPNLRSVKFTSDITAGEY
RL28_RICPR       MSRKCELTGVGVLYGNNVSHSQRK-------------TRRRFEPNLRSIKFRSDITDEVY
RL28_CAMJE       MARVCQITGKGPMVGNNVSHANNK-------------TKRRFLPNLRTVRVTLE-DGTTR
RL28_HELPY       MAKRCALTFKGPMIGNHVSHANNK-------------NKRRLLPNLRSIKIQLD-DGTTK
RL28_NOSS1       MSRRCDLTGKKANNAFAVSHSHRR-------------TKRLQQVNLQNKRVWWPSGNRWV
RL28_SYNY3       MARRCQLTGKKANNGFAVSHSHRR-------------TKKLQQANLQWKRVWWPEGNRFV
RK28_PORPU       MSKKCQLTGKVANNGYAVSHSHKR-------------TKKLQNVNLQYKKVWSTEQNKWI
RK28_CYAPA       MARQCELTGKKANNGYTVSHSHRR-------------TKCLQKANLQTKRIWSPTLKRWL
RK28_GALSU       MTRKCQLLFKTSNTANKVSHSNHK-------------SKRLQFVNLQKKKVWSSLKKKWI
RK28_CYAM1       MSRVCPLTLKKCNHAFRVTYSHKR-------------NHRRQFVNLQKKRIFI--NNEWV
RL28_THET8       MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVA--GQEI
RL28_DEIRA       MSRECYLTGKKNLVVNSVIRRGKARADGGVGRKTTGITKRVQRANLHKKAIREN--GQVK
RL28_CHLMU       MSKKCALTGRKPRRGYSYAIRGISKKKKGIGLKVTGRTKRRFLPNMMTKRLWSTEENRFL
RL28_CHLTR       MSKKCALTGRKPRRGYSYAIRGISKKKKGIGLKVTGRTKRRFFPNMMTKRLWSTEENRFL
RL28_CHLPN       MSRKCPLTGKRPRRGYSYTLRGIAKKKKGIGLKVTGKTKRRFFPNMLTKRLWSTEENRFL
RL28_BORBU       MARKCEITGKKTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVNLINKKFFIPNLGRSV
RL28_ECOLI       MSRVCQVTGKRPVTGNNRSHALNA-------------TKRRFLPNLHSHRFWVESEKRFV
RL28_SALTY       MSRVCQVTGKRPVTGNNRSHALNA-------------TKRRFLPNLHSHRFWVESEKRFV
RL28_YERPE       MSRVCQVTGKRPMSGNNRSHAMNA-------------TKRRFLPNLHSHRFWVEGEKRFV
RL28_HAEIN       MSRVCQVTGKRPAVGNNRSHAMNA-------------TRRRFLPNLHTHRFWVESENRFV
RL28_PASMU       MSRVCQVTGKRPAVGNNRSHAMNA-------------TKRRFLPNLHTHRFWVESEKRFV
RL28_VIBCH       MSRVCQVTGKRPAVGNNRSHAKNA-------------TKRRFLPNLQTHRFWVESEKRFV
RL28_PSEAE       MSRVCQVTGKGPVTGNNISHAHNK-------------TRRRFLPNLQHHRFWVESEKRFV
RL28_NEIMA       MARVCKVTGKRPMSGNNVSHANNK-------------TKRRFLPNLQSRRFWVESENRWV
RL28_RALSO       MARVCQVTGKAPMVGNNVSHANNK-------------TKRRFLPNLQNRRFWVESENRWV
RL28_XYLFA       MSRVCQVTGKRVQTGNNVSHANNK-------------TRRRFLPNLHKRRFWVASENRWV
RL28_BUCAI       MSRICQITGKKRMIGNNRSHALNA-------------TKRKFLINIQYHRFWIADEKRFI
RL28A_MYCTU      MSARCQITGRTVGFGKAVSHSHRR-------------TRRRWPPNIQLKAYYLPSEDRRI
RL28B_MYCTU      MSAHCQVTGRKPGFGNTVSHSHRR-------------SRRRWSPNIQQRTYYLPSEGRRI
RL28B_STRCO      MSAHCMLTGARPGFGNRISHSHRR-------------TSRRFDPNIQTKRYWLPSENRHV
                 *     .                                      :              

RL28_LEUMM       KVYLTARTLKAGLKNG----------------SIERV-----------------------
RL28_OENOB       TVYLTARTLRAGLKNG----------------SIERV-----------------------
RL28_BACSU       KVYVSARALK----SG----------------KVERV-----------------------
RL28_LISMO       KVWVSARALK----SG----------------KVERV-----------------------
RL28_BACHD       RVYVSARALK----SG----------------KVERV-----------------------
RL28_GEOSE       RVWVSARALK----SG----------------KVKRV-----------------------
RL28_STAAM       KVWVSARALK----SG----------------KVTRV-----------------------
RL28_STRPN       KVWASARALK----SG----------------KVERV-----------------------
RL28_STRP1       KVWASARALK----SG----------------KVERI-----------------------
RL28_LACLA       TVWASAKALKK--LPA----------------GVERV-----------------------
RL28_AQUAE       RMYVCTKCLK----AG----------------KVMKAPRIPKEG----------------
RL28_THEMA       RMRVCTSCLK----SG----------------KVKKYVGQVSEV----------------
RL28_CLOAB       TIHVCTRCLR----SG----------------KVQRAV----------------------
RL28_CLOPE       TVHVCTRCLR----SE----------------KFKELYKKSLAKMQFNNCIFILHKNKG-
RL28_SELRU       RVNVCTRCLR----SG----------------KVQRAL----------------------
RL28A_STRCO      RVNACTSCIK----AG----------------KVSR------------------------
RL28_TREPA       NMRICARCLR----SN----------------PLMKKAQPRANAPLRAAAPKL-------
RL28_MYCGE       RILVSTKTIR----TL----------------KKQNRF----------------------
RL28_MYCPN       RILVSTRTLR----TL----------------KKHNRLS---------------------
RL28_UREPA       RVLVSAKTLK----TL----------------KKHNLLA---------------------
RL28_MYCPU       NLKVSAKTAK----TL----------------RRKNLI----------------------
RL28_BRUME       RLRISANALRSVEHRG----------------GLDAFLVKSDDKELSQRARLLKRQIAKK
RL28_RHILO       RLRISANALRSVEHRG----------------GLDAFLAKADVKELSQRARLLKKQIAKK
RL28_RHIME       RLRVSAAALRSVEHRG----------------GLDAFLLKADENELSMRARLLRRQIVKK
RL28_CAUVC       KLRISNAALRTLDFKG----------------GLDTFLLGAKDEQLSPRALKIKAQVKAK
RL28_RICCN       RLSVNARCISSVEKAG----------------GFDAYILKADDNVLSSNARAIKKKIIQT
RL28_RICPR       RLSVNARCIRSVEKAG----------------GFDAYILKANDDILSSAARAIKQKIIHI
RL28_CAMJE       KMRIAASTLRTLKKQN----------------SK--------------------------
RL28_HELPY       RIKVAASTLRTMRKGA--------------------------------------------
RL28_NOSS1       KLKLSTKAIKTLEVK-----------------GLEAMAKEAGINLNHY------------
RL28_SYNY3       RLRLSTTAIKTLESK-----------------GINAMAKEAGINLNKF------------
RK28_PORPU       KMLISTKAIKTL-TK-----------------AL--------------------------
RK28_CYAPA       KLQVSTKVIKDLKRK-----------------SIDALLKI--------------------
RK28_GALSU       KLRISTKMIKILNKK-----------------NIDYFL----------------------
RK28_CYAM1       VLKISTKAIKTLKSK-----------------TLKSKTFSNARLLHL-------------
RL28_THET8       TFRVAASHIPKVYELVERA------------KGLKLEGLSPKEIKKELLKLL--------
RL28_DEIRA       TVWLSANALRTLSK--GPY------------KGIELI-----------------------
RL28_CHLMU       KLKISAAALRLVDKL-----------------GLDKVVARAKSK--GF------------
RL28_CHLTR       KLKISAAALRLVDKL-----------------GLDQVVARAKSK--GF------------
RL28_CHLPN       KLKISASALRHIDKL-----------------GLEKVLERAKSK--NF------------
RL28_BORBU       SIKVSANALRSISKI-----------------GLDAFLKKNCKKIENFL-----------
RL28_ECOLI       TLRVSAKGMRVIDKK----GID---------TVLAELRAR-GEKY---------------
RL28_SALTY       TLRVSAKGMRIIDKK----GIE---------TVLSELRAR-GEKY---------------
RL28_YERPE       TLRVSAKGMRVIDKK----GIE---------TVLAEIRAR-GEKY---------------
RL28_HAEIN       TLRLTAKGMRIIDKK----GID---------AVLAEIRAR-GEKI---------------
RL28_PASMU       TLRLTAKGMRIIDKK----GID---------AVLADIRAR-GEKI---------------
RL28_VIBCH       KLRLTAKGMRIIDKK----GID---------AVLVEIRAR-GENV---------------
RL28_PSEAE       RLRVSAKGMRIIDKR----GIE---------AVLADLRAR-GEKF---------------
RL28_NEIMA       RLRVSNAALRTIDKV----GID---------VVLADLRAR-GEA----------------
RL28_RALSO       SLRVSNAGLRLIDKK----GID---------EVLADLRAR-GEV----------------
RL28_XYLFA       KLRVSTCAVRTIDKN----GID---------AVLAELRAS-GEKV---------------
RL28_BUCAI       KLHVSTNGMRYIDKK----GIE---------TVIRKINMK-K------------------
RL28A_MYCTU      KVRVSAQGIKVIDRD----GHRGRRRAARAGSAPAHFARQAGSSLRTAAIL---------
RL28B_MYCTU      RLRVSTKGIKVIDRD----GIE---------AVVARLRRQ-GQRI---------------
RL28B_STRCO      RLRLSTKGIRTVDSI----GVE---------AAVARIRAR-GVRI---------------
                  .                                                          

RL28_LEUMM       --------
RL28_OENOB       --------
RL28_BACSU       --------
RL28_LISMO       --------
RL28_BACHD       --------
RL28_GEOSE       --------
RL28_STAAM       --------
RL28_STRPN       --------
RL28_STRP1       --------
RL28_LACLA       --------
RL28_AQUAE       --------
RL28_THEMA       --------
RL28_CLOAB       --------
RL28_CLOPE       --------
RL28_SELRU       --------
RL28A_STRCO      --------
RL28_TREPA       --------
RL28_MYCGE       --------
RL28_MYCPN       --------
RL28_UREPA       --------
RL28_MYCPU       --------
RL28_BRUME       QAEAAA--
RL28_RHILO       LAEQVAA-
RL28_RHIME       AAEAA---
RL28_CAUVC       AKAAAQAA
RL28_RICCN       KTAKSL--
RL28_RICPR       KAAKSL--
RL28_CAMJE       --------
RL28_HELPY       --------
RL28_NOSS1       --------
RL28_SYNY3       --------
RK28_PORPU       --------
RK28_CYAPA       --------
RK28_GALSU       --------
RK28_CYAM1       --------
RL28_THET8       --------
RL28_DEIRA       --------
RL28_CHLMU       --------
RL28_CHLTR       --------
RL28_CHLPN       --------
RL28_BORBU       --------
RL28_ECOLI       --------
RL28_SALTY       --------
RL28_YERPE       --------
RL28_HAEIN       --------
RL28_PASMU       --------
RL28_VIBCH       --------
RL28_PSEAE       --------
RL28_NEIMA       --------
RL28_RALSO       --------
RL28_XYLFA       --------
RL28_BUCAI       --------
RL28A_MYCTU      --------
RL28B_MYCTU      --------
RL28B_STRCO      --------