CLUSTAL format seed alignment for MF_00375

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GSA1_BACAN      ------------MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPIAMERGKGAY
GSA1_BACHK      ------------MVVEFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGAY
GSA1_BACCR      --------------MNFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGAY
GSA1_BACCZ      --------------MKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGAY
GSA1_BACC1      ------------MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGAY
GSA1_BACLD      --------------MQHTQSEKLHEEALQHIVGGVNSPSRSYKAVGGGSPVAMERGSGAY
GSAB_BACSU      ---------------MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAY
GSA1_GEOKA      --------------MQWTKSEQLYKEALQHIVGGVNSPSRSYKAVGGGAPVVMERAQGAY
GSA1_OCEIH      --------------MKFTNSEKLHQEALQHIVGGVNSPSRAYKAVGGGSPVYMERGQGAY
GSA2_LISMO      --------------MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGGIPVTMERASGAY
GSA2_LISMF      --------------MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGGIPVTMERASGAY
GSA2_LISIN      --------------MDHSMSKKLHDEALLHIVGGVNSPSRSNKGVGGGIPVTMERANGAY
GSA1_BACSK      --------------MNRKTSESLYQEAQHVIVGGVNSPSRAYKGVGGGTPVFMERGEGAY
GSA1_BACHD      --------------MNRSRSESLFQKAQSLIVGGVNSPSRSFKAVGGGAPVFMEKAKGAY
GSA2_STAAC      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAA3      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAAR      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAAB      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGRGAY
GSA2_STAAS      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAAW      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAAM      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAAN      --------------MNFSESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAES      --------------MKFTESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA2_STAEQ      --------------MKFTESERLQQLSNEYILGGVNSPSRSYKAVGGGAPVVMKEGHGAY
GSA1_STAS1      --------------MKFTESEKLQKLSDEYILGGVNSPSRSYKAVGGGAPVMMRSGKGAY
GSA_SYMTH       ------------MTARYERSAALYERAVARIVGGVNSPARSFKSVGGGAPVFMARGQGPY
GSA_ACAM1       ---------MLTDTLNTTKSEEIFAAAQKLMPGGVSSPVRAFKSVGG-QPIVFDRVKGAH
GSA_CYAP4       ---------MLTSTFNTTKSEEIFAAAQKLMPGGVNSPVRAFKSVGG-NPIVFDRVEGAY
GSA_NOSS1       ---------MVNTTIKTTKSQEIFAAAQNLMPGGVSSPVRAFKSVGG-QPIVFDHVKGAY
GSA_TRIV2       ---------MVNTTIKTTKSQEIFAAAQNLMPGGVSSPVRAFKSVGG-QPIVFDHVKGAY
GSA_NOSP7       ---------MVNTTIKTTKSQEVFAAAQNLMPGGVSSPVRAFKSVGG-QPIVFDRVKGAY
GSA_TRIEI       ---------MVVTTLNTTKSEEIFAAAQKLMPGGVSSPVRAFKSVGG-QPIVFDRVQGAY
GSA_SYNE7       --------MVTSSPFKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGG-QPIVFDRVKDAY
GSA_SYNP6       --------MVTSSPFKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGG-QPIVFDRVKDAY
GSA_SYNP2       ---------MVTTALNTTKSEEIFSAAQKLMPGGVSSPVRAFKSVGG-QPIVFDRVKGSR
GSA_RIPO1       --------MVSTSSFQTTKSEEIFAAAQKLMPGGVSSPVRAFKSVGG-QPIVFDRVKGAY
GSA_MICAN       --------MVSTSSYQTTKSKEIFTAAQKLMPGGVSSPVRAFKSVGG-QPIVFESVKGAY
GSA_GLOC7       --------MVSTSSFKTTKSEEIFTAAQKLMPGGVSSPVRAFKSVGG-QPIVFDHVEGAY
GSA_SYNY3       --------MVNATPFITTKSEEIFAAAQHLMPGGVSSPVRAFKSVGG-QPIVFDRVEGAQ
GSA_SYNJB       -----MTSTLHSTSFNTTRSKQVFARAQSLMPGGVSSPVRAFKSVGG-DPVVFDRVSGAY
GSA_SYNJA       -----MTSTLPTRSFNTSRSRQIFARAQQLMPGGVSSPVRAFKSVGG-DPVVFDRVAGAY
GSA_THEEB       ----MRELTLTTTVFQTTKSQEIFAAAQKLMPGGVSSPVRAFKSVGG-QPIVFDHVKGAH
GSA_PROMA       ----------MTNAFNTSNSQAVFHAAQELMPGGVSSPVRAFKSVNG-DPIVFDRVKGAY
GSA_PROM4       ----------MTNAFNTNLSQAVFNAAQDLMPGGVSSPVRAFKSVNG-DPIVFDRVKGPY
GSA_PROM1       --------------MNTKRSEEIFGAAKNLMPGGVSSPVRAFKSVEG-DPIVFDRVKGPY
GSA_PROMT       ----------MTDALNTKRSEEIFGAAKNLMPGGVSSPVRAFKSVEG-DPIVFDRVKGPY
GSA_PROM3       --------------MNTSRSQAIFSAAQRLMPGGVSSPVRAFRSVGG-QPIVFDRVKGAY
GSA_PROMM       --------------MNTTRSQAIFSAAQRLMPGGVSSPVRAFRSVGG-QPIVFDRVKGAY
GSA_SYNS9       --------------MNTSRSQAIFGAAQGLMPGGVSSPVRAFKSVGG-QPIVFDRVKGPY
GSA_SYNPX       --------------MNTSRSQAIFGAAQGLMPGGVSSPVRAFKSVGG-QPIVFDRVKGPY
GSA_SYNSC       --------------MNTSHSQAIFGAAQALMPGGVSSPVRAFKSVGG-QPIVFDRVKGPY
GSA_SYNPW       ---------MTAPTLNTTRSQELFSAAQALMPGGVSSPVRAFRSVGG-QPLVFDRVKGPY
GSA_PROMS       ----------MTDILNYTKSEEIFSAAQQLMPGGVSSPVRAFKSVGG-QPIVFDRVKGPF
GSA_PROM0       ----------MTDILNYTKSEEIFSAAQELMPGGVSSPVRAFKSVGG-QPIVFDRVKGPF
GSA_PROM2       ----------MTDILNYNKSEEIFSAAQQLMPGGVSSPVRAFKSVGG-QPIVFDRVKGPF
GSA_PROM9       ----------MTDILNCTKSEEIFSAAQELMPGGVSSPVRAFKSVGG-QPIVFDRVKGPF
GSA_PROMP       ----------MTDILKTTYSEEVFSSALELMPGGVSSPVRAFKSVGG-QPIVFDRVKGPY
GSA_GLOVI       ---------MVTSAFQTAQSHRLFAEAQQLMPGGVNSPVRAFKSVGS-EPVFIERAEGAY
GSA_CHLSY       ---------MSVVTERYSRSQADYAAAREVIPGGVNSPVRAFRGVGG-IPIFFERGQGAY
GSA_CHLAA       ---------MSVVTERYSRSQADYAAAREVIPGGVNSPVRAFRGVGG-IPIFFERGQGAY
GSA_CHLAD       ---------MTIATERYSRSQANFAAAQAVIPGGVNSPVRAFRGVGG-SPIFFERGQGAH
GSA_ROSCS       --------------MKTYRSESLFAEARSLFPGGVNSPVRAFRAVGG-APRFIARGEGAF
GSA_ROSS1       --------------MKTTRSESLFAEAQSLFPGGVNSPVRAFRAVGG-TPRFIARGEGAL
GSA_HERA2       --------------MINDASSAAFERAQALLPGGVNSPVRAFRGVGG-VPRFIDHGAGAY
GSA_FRACC       ----------MVVPSAAPASEELFRRAERVVPGGVNSPVRAFRAVGG-TPRFMVAGNGPY
GSA_FRASN       ----------MVVPSTAPASDDLFRRAQRVVPGGVNSPVRAFRAVGG-TPRFMTSGSGPR
GSA_THEFY       -------------MATHLKSHELFNRARSVIPGGVNSPVRAFKAVGG-TPPFMVSGKGPY
GSA_STRAW       -------MACVSYPYEAPVSQTLFERAAAVTPGGVNSPVRAFRAVGG-TPRFMVSGNGPY
GSA_STRCO       -------MSELAYPYEAPASQALFDRAAAVTPGGVNSPVRAFRAVGG-TPRFMVSGTGPY
GSA_STRGG       ----------MAYSYEAPVSQSLFDRASVVTPGGVNSPVRAFRAVGG-TPRFMVSGTGPY
GSA_MYCA1       --MGSSDQATAHARAQA-ASARLFDDACAVIPGGVNSPVRAFTAVGG-TPPFITAARGCR
GSA_MYCPA       --MGSSDQATAHARAQA-ASARLFDDACAVIPGGVNSPVRAFTAVGG-TPPFITAARGCR
GSA_MYCMM       --MGSTDQAVTSVRR----SAQLFTDACAVIPGGVNSPVRAFTAVGG-TPRFITEAHGCW
GSA_MYCUA       --MGSTDQAVTSVRR----SAQLFTDACAVIPGGVNSPVRAFTAVGG-TPRFITEAHGCW
GSA_MYCBO       --MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG-TPRFITEAHGCW
GSA_MYCTA       --MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG-TPRFITEAHGCW
GSA_MYCBT       --MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG-TPRFITEAHGCW
GSA_MYCBP       --MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG-TPRFITEAHGCW
GSA_MYCTU       --MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG-TPRFITEAHGCW
GSA_MYCLE       --MGSTDQATAPAGPAVSISAKLFEDACAVIPGGVNSPVRAFSAVGG-TPLFITEARGCW
GSA_MYCLB       --MGSTDQATAPAGPAVSISAKLFEDACAVIPGGVNSPVRAFSAVGG-TPLFITEARGCW
GSA_RHOOB       --MTVSSGDPDVHASR---SAQLFERADLVIPGGVNSPVRAFHSVGG-TPRFIREASGYT
GSA_RHOJR       --MTVSSGDPDVHASR---SAQLFERADLVIPGGVNSPVRAFHSVGG-TPRFIKEASGYT
GSA_NOCFA       --MSASPRATHASAAA---SARLFDRAAQVIPGGVNSPVRAFRSVGG-TPRFIASADGYT
GSA_ACIC1       ----------MTSPGTDAVSAACFERARARIPGGVNSPVRAFRAVGG-TPRFIQSGAGPY
GSA_CORGL       --MTHMTSS------NTARSAEWFEKAQKLTPGGVNSPVRAFGSVGG-QARFIEKAHGST
GSA_CORGB       --MTHMTSS------NTARSAEWFEKAQKLTPGGVNSPVRAFGSVGG-QARFIEKAHGST
GSA_COREF       --MVDMSASPSGTSANVSRSIEWFEKAKMFTPGGVNSPVRAFGSVGG-QARFIDRAHGST
GSA_CORDI       -----MTST--------QRSQELFARAQQFTPGGVNSPVRAFGSVGG-HARFIQSAKGSK
GSA_CORA7       --MWAMPNSSQLNQQNTSQSAEWFERATKVTPGGVNSPVRAFGSVGG-QARVIARGEGSR
GSA_CORJK       --MSVNADSQHSNNSSHQASEKAFDRARSLIPGGVNSPVRAFGSVGG-TPPFITSAQGST
GSA_CLAM3       ----------------MTHSQDLFDRARDVIPGGVNSPVRAFGSVGG-TPRMMVKAAGPY
GSA_CLAMS       ----------------MTHSQDLFDRARDVIPGGVNSPVRAFGSVGG-TPRMMVRAAGPY
GSA_LEIXX       ----------MAAAAIGEANLAQFGRAQRVIPGGVNSPVRAFRSVGG-TPRFMVFANGPY
GSA_KOCRD       ----------------MSVSQELFDRARRVMPGGVNSPVRAFNSVGG-TPPFIAAAKGPY
GSA_CUTAK       ----------------MTSNAELFSAAQAVIPGGVDSPVRAYGSVGG-VPRFIEKAQGPW
GSA_PROFF       ----------------MSVSDELFAEALKVMPGGVSSPVRAYRSVGG-TPRFVKRALGSH
GSA_TROW8       ----------------MRTNFEWFEEAKRFIPGGVNSPVRAYAAVGG-TPRFLAKAQGAY
GSA_TROWT       ----------------MRTNFEWFEEAKRFIPGGVNSPVRAYAAVGG-TPRFLAKAQGAY
GSA_ANAD2       --------------MKTELSQKLFEKANDLFPGGVNSPVRAFKGVGG-TPRFISRAKGSH
GSA_ANASK       --------------MKTELSQKLFEKANDLFPGGVNSPVRAFKGVGG-TPRFISRAKGSH
GSA_ANADE       --------------MKTELSQKLFEKANDLFPGGVNSPVRAFKGVGG-TPRFIARAKGSH
GSA_ANADF       --------------MKTELSEKLFAKAQTLFPGGVNSPVRAFRGVGG-TPRFIARGKGSH
GSA_MYXXD       --------------MNHAHSQALFARAQARIPGGVNSPVRAFRGVGG-DPVFFREGAGAW
GSA_CARHZ       ------------MPLKIDRSIEAFSEAKKVIPGGVNSPVRAFKSVGL-NPVFIERGEGSK
GSA_PELTS       ------------MYKGFDRSVSLYRQACKVIPGGVNSPVRAFKAVGL-NPVFVKKGEGAR
GSA_MOOTA       ----------MTDSEAWPRSAAAFAEAVKLMPGGVNSPVRAFKSVGL-TPPFIQRGEGAY
GSA_THERP       --------------MMMENSGSLWDAARQFFPGGVNSPVRAFRAVGE-EPVVAVRGEGAY
GSA_THET2       -----------MEGMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGG-TPPFLVRGEGAY
GSA_THET8       --------------MERPISEAYFQEAKRHIPGGVSSPVRAFKAVGG-TPPFLVRGEGAY
GSA_DEIRA       --------MTLSETHPTARSEALFVRARAVTPGGVNSPVRAFRSVGG-VPRFIASAQGAY
GSA_RHOBA       --MNSPANSSAARPAAGPKSVAAFQRASALMPGGVNSPARAFGAVGG-TPLFIERAEGPY
GSA_SORC5       --MTNATSAPPARADRAPASKALFDRAAAVLPGGVNSPVRAFRAVGG-DPLFIARAQGAR
GSA_CALBD       -----------MRLDKSK---EVFDNTKRYIPGGVNSPVRAFKNLSI-TPPVISKGKGCR
GSA_CALS8       -----------MRFDKSK---EIFDNTKRYIPGGVNSPVRAFKNLSI-TPPVISKGKGCR
GSA_CLOAB       --------------MTNK---EIFEESKEYMPGGVNSPVRAYMDLNI-DPPIIKSGKDSH
GSA_CLOTE       --------------MNNL---EIFKESEKYMPGGVNSPVRAFSNASI-NPPIIKKGLGSR
GSA_CLOBA       --------------MNNL---EIFEESKKYMPGGVNSPVRCFKEMGM-NPPVIKSGKGVI
GSA_CLOBB       --------------MNNL---EIFEESKKYMPGGVNSPVRCFKEMGM-NPPVIKSGKGVI
GSA_CLOB8       --------------MKNV---DIFKESEEYMPGGVNSPVRAFKGVNL-NPPIIKSGKGVI
GSA_CLOP1       -------------MDRNK---EIFEESKKYMPGGVNSPVRSFGSVGI-NPPVIKSGKGAM
GSA_CLOPS       -------------MDRNK---EIFEESKKYMPGGVNSPVRSFGSVGI-NPPVIKSGKGAM
GSA_CLOPE       -------------MDRNK---EIFEESKKYMPGGVNSPVRSFGSVGI-NPPVIKSGKGAM
GSA_CLOK5       --------------MRND---KIFEESKLYMPGGVNSPVRAFKDVPL-NPPVIKKGRGAY
GSA_AQUAE       --------------MKNE---KLYREALQVMPGGVNSPVRAFKAVGG-KPIFLVKGRGPR
GSA_HYDS0       --------------MTNK---EAFELAKKYMPGGVSSPVRAFKSVGA-EPIVVNRGFGAF
GSA_PERMH       --------------MKMERSLNLFEEAQRYLVGGVNSPVRAFKSVGM-EPLFIQKGKGSR
GSA_SULSY       --------------MNNQKSKELFQEAQKYLVGGVNSPVRAFKAVEA-DPIFIKKGKGCR
GSA_DESVH       ---------------MSQRSSELFERAQQLIPGGVNSPVRACLGVDS-EPLFIARAAGSR
GSA_DESVV       ---------------MSQRSSELFERAQQLIPGGVNSPVRACLGVDS-EPLFIARAAGSR
GSA_DESVM       ---------------MDHRSKELFERAQQLIPGGVNSPVRACLGVDS-DPLFVAHAKGSH
GSA_DESAG       ---------------ME-RSRNLFERAQKLIPGGVNSPVRACLSVDS-APVFVERGQGSK
GSA_LAWIP       --------------MQEESSKELYSKAVKLIPGGVNSPVRACRNVGC-EPVFIESAKGAY
GSA_SYNWW       --------------MRTERSIELFARAREYIPGGVNSPVRAFKAVGN-NPLFIKEGHGSK
GSA2_BACAN      -------------MRKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGM-NPLFMERGKGSK
GSA2_BACHK      -------------MRKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGM-NPLFMERGKGSK
GSA2_BACCZ      -------------MKKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGM-NPLFMERGKGSK
GSA2_BACCR      -------------MKKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGM-NPLFMERGKGSK
GSA2_BACC1      -------------MKKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGM-NPLFMERGKGSK
GSA2_BACLD      -------------MRSYEKSKAAFEEAQRVMPGGVNSPVRAFKSVNM-DPIFMERGKGSK
GSA_BACSU       -------------MRSYEKSKTAFKEAQKLMPGGVNSPVRAFKSVDM-DPIFMERGKGSK
GSA2_GEOKA      -------------MRSYERSKTAYEEAVKLMPGGVNSPVRAFKSVGM-TPIFMARGQGAK
GSA2_BACSK      -------------MGNWTKSIEAFKEAQPLMPGGVNSPVRAFKSVGM-NPVYMKEGKGAK
GSA2_BACHD      -------------MKTFEKSSAAFNRAKPLMPGGVNSPVRAFKSVNM-DPVFMERGKGAN
GSA1_STAAU      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAAC      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAA8      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAA3      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAAM      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAAN      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAAR      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAAS      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAAW      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAAB      --------------MRYTKSEEAMKVAETLMPGGVNSPVRAFKSVDT-PAIFMDHGKGSK
GSA1_STAES      --------------MSFEKSIKAMEQAEKLMPGGVNSPVRAFKSVDT-PAIFMDHGEGSK
GSA1_STAEQ      --------------MSFEKSIKAMEQAEKLMPGGVNSPVRAFKSVDT-PAIFMDHGEGSK
GSA2_STAS1      --------------MRYSNSEKAMAKAEELMPGGVNSPVRAFKSVDT-PAIFMDHGEGSR
GSA2_STAHJ      --------------MGYEKSIEAMKIAENLMPGGVNSPVRAFKSVDT-PAIFMDHAKGSR
GSA2_OCEIH      --------------MTLNQSIDAYKEAVDLMPGGVNSPVRAFKSVGM-NPIFMKEGKGSK
GSA1_LISMO      -------------MQNYSKSEKAFKEAKKVLPGGVNSPVRAFNSVDA-SPVFMDHGKGAY
GSA1_LISMF      -------------MQNYSKSEKAFKEAKKVLPGGVNSPVRAFNSVDA-SPVFMDHGKGAY
GSA1_LISIN      -------------MQNYIKSEKAFKEAKKVLPGGVNSPVRAFNSVDA-SPVFMDHGKGAY
GSA_NATTJ       --------------MRYANSQKYFKTACDLMPGGVNSPARAFSSVES-DPLFIKDGSGSK
GSA_THEYD       --------------MKTTKSKKLYKQALKLMPGGVNSPVRAFKAVGG-NPLFIAKAKGSK
GSA_DESPS       --------------MESLKSKKLFAEAKKVIPGGVNSPVRACLSVGC-DPLFIERAEGSY
GSA_SYNAS       --------------MTKSLSEQLFETAEGLLPGGVNSPVRAFRAVGG-VPRFIDRAEGSR
GSA_DESOH       --------------MNQTRSKALFKEAAVLIPGGVNSPVRAGKAVGT-TPLFIDRAQGAE
GSA_SYNFM       --------------MTRDRSNLLYEDAGRFIPGGVNSPVRSGRAVGT-NPIFIREAKGCY
GSA_GEODF       --------------MNFSRSADLFKQAQNSIPGGVNSPVRAFKSVGR-DPLFIKKASGCK
GSA_GEOUR       --------------MNYSRSELLFQEAQKAIPGGVNSPVRAFKSVGT-DPLFIEKASGSR
GSA_GEOBB       --------------MQNSRSTKLFQQALQSIPGGVNSPVRAFRSVGS-DPLFIKKAAGPR
GSA_PELPD       --------------MKQDRSSALFQQARQSIPGGVNSPVRAFKSVGS-DPLFIQSASGCT
GSA_GEOLS       --------------MTHTRSHTLFDQARRIIPGGVNSPVRAFKSVGA-DPLFIKRASGSK
GSA_GEOMG       --------------MNTSHSKELFAKAQEIIPGGVNSPVRAFKSVGA-EPVFIKKASGST
GSA_GEOSL       --------------MLTARSKDLFTQAQEFIPGGVNSPVRAFKSVGA-DPLFIKKAFGCT
GSA_PELCD       --------------MSYSRSHQFFERARKVIPGGVNSPVRAFKAVGR-QPLFIERAEGCT
GSA_ECOL6       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOL5       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO45       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOK1       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO27       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOUT       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO81       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO24       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO8A       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO55       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOLC       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOSE       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOHS       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOLU       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO57       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO5E       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SHISS       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECO7I       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECODH       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOLI       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ECOSM       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SHIB3       ------------MS----KSENLYSAARELLPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SHIBS       ------------MS----KSENLYSAARELLPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SHIDS       ------------MS----KSENLYSAARELIPSGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SHIFL       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SHIF8       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_ESCF3       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALDC       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALSV       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALA4       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALTI       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALG2       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALNS       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALEP       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALPB       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALCH       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALPC       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALPA       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALPK       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALHS       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALTY       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAY
GSA_SALAR       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIEKADGAW
GSA_CROS8       ------------MS----KSENLFAAARELIPGGVNSPVRAFTGVGG-TPLFIERADGAY
GSA_ENT38       ------------MS----KSENLYSAARELIPGGVNSPVRAFTGVGG-TPLFIERADGAF
GSA_KLEP3       ------------MS----KSENLYHAARELIPGGVNSPVRAFTGVGG-TPLFIERADGAY
GSA_KLEP7       ------------MS----KSENLYHAARELIPGGVNSPVRAFTGVGG-TPLFIERADGAY
GSA_YERPE       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERPP       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERPN       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERPG       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERPA       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERPS       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERPB       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERP3       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERPY       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFTGVGG-IPLFIERADGAY
GSA_YERE8       ------------MS----KSESLYAQAKQLIPGGVNSPVRAFTGVGG-VPLFIERADGAY
GSA_ERWT9       ------------MS----KSENLYAQAQQLIPGGVNSPVRAFNGVGG-VPLFIERANGAY
GSA_PECAS       ------------MN----KSESLYAAAQQLIPGGVNSPVRAFNGVGG-TPLFIERADGAY
GSA_PHOLL       ------------MS----QSDILYSQAKQLIPGGVNSPVRAFNGVGG-TPLFIKHADGAY
GSA_PROMH       ------------MS----KSETLYNLAQQVIPGGVNSPVRAFNGVGG-TPLFIERANGAY
GSA_SODGM       ------------MS----HSASLYAEAQQLIPGGVNSPVRAFNGVGG-TPLFIASADGAR
GSA_ACTPJ       ------------MS----KSEQLFEKAQKVIPGGVNSPVRAFKGVGG-TPVFIQKAEGAY
GSA_ACTP2       ------------MS----KSEQLFEKAQKVIPGGVNSPVRAFKGVGG-TPVFIQKAEGAY
GSA_ACTP7       ------------MS----KSEQLFEKAQKVIPGGVNSPVRAFKGVGG-TPVFIQKAEGAY
GSA_HAEPS       ------------MT----TSQSLFEKAQRVIPGGVNSPVRAFKGVGG-TPVFIDSAKGAY
GSA_ACTSZ       ------------MS----NSTALFQRARQVIPGGVNSPVRAFKGVGG-TPVFIQKAAGAY
GSA_HAES1       ------------MT----TSATLFSRAQQVIPGGVNSPVRAFKGVGG-TPVFIEKANGAY
GSA_HISS2       ------------MT----TSATLFYRAQQVIPGGVNSPVRAFKGVGG-TPVFIEKANGAY
GSA_PASMU       ------------MT----TSLSLFQRAQHRIPGGVNSPVRAFKGVGG-TPIFIEKAQGAY
GSA_MANSM       ------------MT----DSNTLFSRAQQVIPGGVNSPVRAFKGVGG-TPVFIQKAKGAY
GSA_AERHH       ------------MS----KSDQLFEQARQTIPGGVNSPVRAFNGVGG-TPRFIDHADGAY
GSA_AERS4       ------------MS----KSDQLFEQARQTIPGGVNSPVRAFNGVGG-TPRFIDHADGAY
GSA_SHEB8       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKANGAY
GSA_SHEB2       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKANGAY
GSA_SHEB5       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKANGAY
GSA_SHEB9       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKANGAY
GSA_SHEPC       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKANGAY
GSA_SHESW       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKANGAY
GSA_SHESM       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKADGAY
GSA_SHESR       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKADGAY
GSA_SHESA       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKADGAY
GSA_SHEON       ------------MT----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKADGAY
GSA_SHEHH       ------------MT----RSDELFEQAKKTIPGGVNSPVRAFSGVGG-SPRFIEKADGAY
GSA_SHEPA       ------------MT----RSDELFEQAKKTIPGGVNSPVRAFSGVGG-SPRFIEKADGAY
GSA_SHESH       ------------MT----RSDELFEQAKKTIPGGVNSPVRAFNGVGG-SPRFIEKADGAY
GSA_SHEWM       ------------MT----RSDELFEQAKKTIPGGVNSPVRAFNGVGG-SPRFIDKADGAY
GSA_SHEPW       ------------MT----RSDELFEQAKKTIPGGVNSPVRAFNGVGG-SPRFIEKADGAY
GSA_SHELP       ------------MT----RSETLFEQAKKTIPGGVNSPVRAFNGVGG-SPRFIEKADGAY
GSA_SHEAM       ------------MT----RSETLFEQAKKTIPGGVNSPVRAFNGVGG-TPRFIEKADGAY
GSA_SHEDO       ------------MN----RSEALFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKADGAY
GSA_SHEFN       ------------MT----RSEVLFEQAKKTIPGGVNSPVRAFNGVGG-SPLFIEKADGAY
GSA_ALIF1       ------------MT----KSAELFAKAQDKIPGGVNSPVRAFAGVGG-SPIFVERADGPL
GSA_ALIFM       ------------MT----KSAELFAKAQDKIPGGVNSPVRAFAGVGG-SPIFVERADGPL
GSA_ALISL       ------------MT----KSAELFAKAQEKIPGGVNSPVRAFAGVGG-SPIFIERADGPL
GSA_VIBCH       ------------MT----KSAELYQKAQTTIPGGVNSPVRAFNGVGG-SPIFIDRADGAL
GSA_VIBC3       ------------MT----KSAELYQKAQTTIPGGVNSPVRAFNGVGG-SPIFIDRADGAL
GSA_VIBCM       ------------MT----KSAELYQKAQTTIPGGVNSPVRAFNGVGG-SPIFIDRADGAL
GSA_VIBVU       ------------MT----KSAELYQKAQQTIPGGVNSPVRAFNGVGG-SPIFVERADGAF
GSA_VIBVY       ------------MT----KSAELYQKAQQTIPGGVNSPVRAFNGVGG-SPIFVERADGAF
GSA_VIBPA       ------------MT----KSSELYQKAQQTIPGGVNSPVRAFNGVGG-SPLFIERADGAL
GSA_VIBTL       ------------MT----KSAELYEKAQQTIPGGVNSPVRAFNGVGG-SPIFVERADGPL
GSA_PHOPR       ------------MS----KSADLFAKAQKIIPGGVNSPVRAFAGVGG-SPLFIERADGAY
GSA_COLP3       ------------MN----KSEQLFEQAQKIIPGGVNSPVRAFNGVGG-TPCFIKRAQGAY
GSA_PSEHT       ------------MT----ISQDLFARAQASIPGGVNSPVRAFNGVGG-TPLFITKAEGAF
GSA_IDILO       ------------MS----RSEELYTKAQISIPGGVNSPVRAFNGVGG-SPIFFESAEGAY
GSA_PSYIN       ------------MS----ISNQLFDRAQAIIPGGVNSPARAFNGVGG-DPLFIEKAQGAY
GSA_PSEA6       ------------MQ----KSEQLFARAQKHIPGGVNSPVRAFRAVGG-TPPFIEKADGPY
GSA_ACIF2       -----------MTQ----TSHALFHMAQQCIPGGVNSPVRAFRGVGG-DPIFIDHAEGPF
GSA_ACIF5       -----------MTQ----TSHALFHMAQQCIPGGVNSPVRAFRGVGG-DPIFIDHAEGPF
GSA_METCA       ------------ML----DSTTLFADACRFIPGGVNSPVRAFRGVGG-TPVFVDRAEGPY
GSA_PSEAE       ------------MS----RSETLFNNAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEA8       ------------MS----RSETLFNNAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEAB       ------------MS----RSETLFNNAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEA7       ------------MS----RSETLFSNAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEE4       ------------MS----RSEALFAQAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEPW       ------------MS----RSESLFAQAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEP1       ------------MS----RSEALFAQAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEPK       ------------MS----RSEALFAQAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEPG       ------------MS----RSEDLFAKAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEF5       ------------MS----RSETLFANAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEPF       ------------MS----RSETLFANAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAEGAY
GSA_PSEMY       ------------MS----RSEILFANAQKHIPGGVNSPVRAFRSVGG-TPLFFKHAEGAY
GSA_PSE14       ------------MS----RSETLFANAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAAGAY
GSA_PSEU2       ------------MS----RSETLFANAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAAGAY
GSA_PSESM       ------------MS----RSETLFANAQKHIPGGVNSPVRAFKSVGG-TPLFFKHAAGAY
GSA_PSEU5       ------------MS----RSETLFASAQTHIPGGVNSPVRAFRSVGG-TPLFLKHAEGAY
GSA_ACIB5       ---------MSLSP----KQEQLFKQASKHIPGGVNSPVRAFNGVGG-TPVFIEKAKGAY
GSA_ACIB3       ---------MSLSP----KQEQLFKQASKHIPGGVNSPVRAFNGVGG-TPVFIEKAKGAY
GSA_ACIBT       ---------MSLSP----KQEQLFKQASKHIPGGVNSPVRAFNGVGG-TPVFIEKAKGAY
GSA_ACIBY       ---------MSLSP----KQEQLFKQASKHIPGGVNSPVRAFNGVGG-TPVFIEKAKGAY
GSA_ACIBC       ---------MSLSP----KQEQLFKQASKHIPGGVNSPVRAFNGVGG-TPVFIEKAKGAY
GSA_ACIBS       ---------MSLSP----KQEQLFKQASKHIPGGVNSPVRAFNGVGG-TPVFIEKAKGAY
GSA_ACIAD       ---------MSLSP----KQVQLFEQASKHIPGGVNSPVRAFNGVGG-TPVFIKKAQGAY
GSA_PSYA2       -----------MST----KNEQLFAQACKHIPGGVNSPVRAFAGVGG-TPIFMHRANGSK
GSA_PSYCK       -----------MST----KNEQLFAQARKHIPGGVNSPVRAFAGVGG-TPIFMHRANGSK
GSA_RUTMC       ------------MN----QSETLFAQAKTVIPGGVNSPVRAFNGVGG-SPIFFTRGEGAY
GSA_VESOH       ------------MN----QSEVLFAQARTVISGGVNSPVRAFNGVGG-NPIFFTRGKGAY
GSA_HAHCH       ------------MT----ISEELFSRAQQHIPGGVNSPVRAFRGVGG-APVFFSKGEGAY
GSA_MARHV       ------------MN----HSETLFEQAQKYIPGGVNSPVRAFRGVGG-TPVFFKHAEGAY
GSA_MARMS       ------------MS----RSEDLYARAQHRIPGGVNSPVRAFNGVGG-TPIFFQRGEGAY
GSA_HYDCU       ------------MS----NSHTLFEAAQAHIPGGVNSPVRAFKGVGG-DPVFFESAKGAY
GSA_ALKEH       ------------MQ----RSHELFERARQHIVGGVNSPVRAFTGVGG-EPPFIARAEGPY
GSA_HALHL       ------------MQ----RTHQLFQQARELIPGGVNSPVRAFKGVGG-EPIFFERGEGPY
GSA_STRMK       ----------MNHD----QSHALFSRAQQLLPGGVNSPVRAFKSVGG-EPFFVERADGAY
GSA_STRM5       ----------MNHD----QSHALFSRAQQLLPGGVNSPVRAFKSVGG-EPFFVERADGAY
GSA_XANCH       ----------MNHS----RSHALFAQAQTLLPGGVNSPVRAFKSVGG-EPFFVARADGPY
GSA_XANC5       ----------MNHS----RSHALFAQAQTLLPGGVNSPVRAFKSVGG-EPFFVARADGPY
GSA_XANAC       ----------MNHS----RSHALFAQAQTLLPGGVNSPVRAFKSVGG-EPFFVARADGPY
GSA_XANOR       ----------MNHS----RSHALFAQAQTVLPGGVNSPVRAFKSVGG-EPFFVARADGSY
GSA_XANOM       ----------MNHS----RSHALFAQAQTVLPGGVNSPVRAFKSVGG-EPFFVARADGSY
GSA_XANCP       ----------MNHS----RSHALFSQAQNLMPGGVNSPVRAFKSVGG-EPFFVARADGAY
GSA_XANC8       ----------MNHS----RSHALFSQAQNLMPGGVNSPVRAFKSVGG-EPFFVARADGAY
GSA_XANCB       ----------MNHS----RSHALFSQAQNLMPGGVNSPVRAFKSVGG-EPFFVARADGAY
GSA_XYLF2       ----------MNHS----RSHALFVQAQTRIPGGVNSPVRAFRSVGG-EPFFVARADGPY
GSA_XYLFT       ----------MNHS----RSHALFVQAQTRIPGGVNSPVRAFRSVGG-EPFFVARADGPY
GSA_XYLFM       ----------MNHS----RSHALFVQAQTRIPGGVNSPVRAFRSVGG-EPFFVARADGPY
GSA_XYLFA       ----------MNHS----RSHTLFVQAQTRIPGGVNSPVRAFRSVGG-EPFFVARADGPY
GSA_CHRSD       ------------MT----TSAQLFEQACRHIPGGVNSPVRAFKGMER-APVFVERAQGAY
GSA_NITOC       ----------MTQI----HSDNLFRRAQAHIPGGVNSPVRAFKGVGG-EPVFFVRGEGAY
GSA_THISH       ------------MT----RSHDLFKAAQRHIPGGVNSPVRAFKGVGG-DPVFIQRAEGAY
GSA_ACISJ       ------------MTHNTDLNLPLFERAKALIPGGVNSPVRAFRAVGG-TPRFITRAQGAY
GSA_ACIET       ------------MTHNTDLNLPLFERAKALIPGGVNSPVRAFRAVGG-TPRFITRAQGAY
GSA_ACIAC       ------------MTPSTDLNLPLFERAKALIPGGVNSPVRAFRAVGG-TPRFVQRAQGAY
GSA_VEREI       ------------MTPNTDLNIPLFERAKALIPGGVNSPVRAFKAVGG-TPRFVKRARGAY
GSA_RHOFT       ------------MTLNTDNNQILFERAKRVIPGGVNSPVRAFKAVGG-TPRFVKRAQGAY
GSA_LEPCP       ------------MATPVSSNAELFERAQRSIPGGVNSPVRAFRAVGG-TPRFIARAQGAY
GSA_AZOSB       -----------MTS----RNEALFSRAQRSIPGGVNSPVRAFRSVGG-TPRFIERAEGAR
GSA_AROAE       -----------MTS----RNETLFQRAQKSIPGGVNSPVRAFRSVGG-TPRFISRAEGAR
GSA_BORBR       ------------MS----TNAELFDRACRSIPGGVNSPVRAFRSVGG-TPRFIQRAQGPY
GSA_BORPA       ------------MS----TNAELFDRACRSIPGGVNSPVRAFRSVGG-TPRFIQRAQGPY
GSA_BORPE       ------------MS----TNAELFDRACRSIPGGVNSPVRAFRSVGG-TPRFIQRAQGPY
GSA_BORPD       ------------MS----SNAQLFDRACRSIPGGVNSPVRAFRSVGG-TPRFIKRAQGPY
GSA_BORA1       ------------MS----RNAELFERASRSIPGGVNSPVRAFRSVGG-TPRFIKRALGPH
GSA_BURCM       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVSRAQGPY
GSA_BURA4       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVSRAQGPY
GSA_BURL3       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVARAQGPY
GSA_BURCA       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVARAQGPY
GSA_BURCH       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVARAQGPY
GSA_BURCC       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVARAQGPY
GSA_BURCJ       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVARAQGPY
GSA_BURVG       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVARAQGPY
GSA_BURM1       ------------MS----NNQILFERAQKTIPGGVNSPVRAFRSVGG-TPRFVARAQGPY
GSA_BURMA       ------------MS----NNQTLFERAQRTIPGGVNSPVRAFRSVGG-TPRFVARAQGAY
GSA_BURP1       ------------MS----NNQTLFERAQRTIPGGVNSPVRAFRSVGG-TPRFVARAQGAY
GSA_BURPS       ------------MS----NNQTLFERAQRTIPGGVNSPVRAFRSVGG-TPRFVARAQGAY
GSA_BURM9       ------------MS----NNQTLFERAQRTIPGGVNSPVRAFRSVGG-TPRFVARAQGAY
GSA_BURP0       ------------MS----NNQTLFERAQRIIPGGVNSPVRAFRSVGG-TPRFVARAQGAY
GSA_BURTA       ------------MS----NNQTLFERAQRTIPGGVNSPVRAFRSVGG-TPRFVARAQGAY
GSA_PARPJ       ------------MS----RNETLFERAQRTIPGGVNSPVRAFRSVGG-TPRFIERAQGPY
GSA_PARXL       ------------MS----KNETLFERAQRTIPGGVNSPVRAFRSVGG-TPRFIERAQGAY
GSA_PARP8       ------------MP----SNQELFERAQKTIPGGVNSPVRAFRSVGG-TPRFIERAQGAY
GSA_CUPTR       ------------MS----RNQQLFDRAQQTIPGGVNSPVRAFRSVGG-TPRFITRAEGPY
GSA_CUPNH       ------------MS----RNQQLFDRAQQTIPGGVNSPVRAFRSVGG-TPRFITRAEGAY
GSA_CUPPJ       ------------MS----RNQQLFDRAQQTIPGGVNSPVRAFRSVGG-TPRFITCAEGAY
GSA_CUPMC       ------------MS----RNQQLFDRAQQTIPGGVNSPVRAFRSVGG-TPRFITRAEGAY
GSA_RALPJ       ------------MSTPS-RSAALFERAQKTIPGGVNSPVRAFRSVGG-IPRFIAKAAGPY
GSA_RALSO       ------------MSSPS-RSVSLFERAQKTIPGGVNSPVRAFRSVGG-TPRFIAKAAGPY
GSA_HERAR       ------------MS--S-NNEILFARAQKSTPGGVNSPVRAFRSVGG-TPRFITRAEGPY
GSA_JANMA       ------------MS--S-KNDQLFARAQLSTPGGVNSPVRAFRSVGG-TPRFITKAEGPY
GSA_CHRVO       ------------MS----RNLELFERGKQVIPGGVNSPVRAFGQVGG-TPRFVARAEGAY
GSA_LARHH       ------------MD----RNQQLFERAKHVIPGGVNSPVRAFGSVGG-SPRFIKRAQGAY
GSA_NEIG1       ------------MN----RNEILFDRAKAIIPGGVNSPVRAFGSVGG-VPRFIKKAEGAY
GSA_NEIG2       ------------MN----RNEILFDRAKAIIPGGVNSPVRAFGSVGG-VPRFIKKAEGAY
GSA_NEIM0       ------------MN----RNEILFDRAKAIIPGGVNSPVRAFGSVGG-VPRFIKKAEGAY
GSA_NEIMF       ------------MN----RNEILFDRAKAIIPGGVNSPVRAFGSVGG-VPRFIKKAEGAY
GSA_NEIMA       ------------MN----RNEILFDRAKAVIPGGVNSPVRAFGSVGG-VPRFIKKAEGAY
GSA_NEIMB       ------------MN----RNEILFDRAKAIIPGGVNSPVRAFGSVGG-VPRFIKKAEGAY
GSA_NITEU       ------------MTI---TNQQLFERSRQYIPGGVNSPVRAFKSVGG-TPVFFQRGQGAY
GSA_NITEC       ------------MTI---TNQQLFERSRQYIPGGVNSPVRAFKSVGG-TPIFFQRGQGAC
GSA_NITMU       -------------MS---RNQQLFEQSQKFIPGGVNSPVRAFKSVGG-TPVFFRKGEGAY
GSA_DECAR       ------------MTS---RNQQLFERAQRHIPGGVNSPVRAFRSVGG-TPCFFQKGVGAK
GSA_METFK       ------------MS----RNQQLFEQSQTLIPGGVNSPVRAFGSVGG-TPVFFKRGLGAR
GSA_THIDA       ------------MS----RNEALFEASQKVIPGGVNSPVRAFRSVGG-TPVFFSRARGSR
GSA_SACD2       ------------MS-------QAFENAQQYIPGGVNSPVRAFKAVGG-EPVFIKRAKGAY
GSA_COXBU       --------MVD-------HSAALFNKAQNYMPGGVNSPVRAFGAVGG-VPRFIKKASGPY
GSA_COXBR       --------MVD-------HSAALFNKAQNYMPGGVNSPVRAFGAVGG-VPRFIKKASGPY
GSA_COXB2       --------MVD-------HSAALFNKAQNYMPGGVNSPVRAFGAVGG-VPRFIKKASGPY
GSA_COXB1       --------MVD-------HSAALFNKAQNYMPGGVNSPVRAFGAVGG-VPRFIKKASGPY
GSA_COXBN       --------MVD-------HSAALFNKAQNYMPGGVNSPVRAFGAVGG-VPRFIKKASGPY
GSA_FRATF       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRATO       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRATH       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRATM       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRATW       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRATT       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRAT1       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRATN       ------MENKS-------NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAY
GSA_FRAP2       ------MENKI-------NSQSLFQEALQYIPGGVNSPVRAFKSVGQEFPRFIKSAKGAY
GSA_LEGPC       ---------MS-------RSSDLFHKAQTIIPGGVNSPVRAFKGVGG-EPVFFKSGKGAY
GSA_LEGPH       ---------MS-------RSSDLFHKAQTIIPGGVNSPVRAFKGVGG-EPVFFKSGKGAY
GSA_LEGPL       ---------MS-------RSSDLFHKAQTIIPGGVNSPVRAFKGVGG-EPVFFKSGKGAY
GSA_LEGPA       ---------MS-------RSSDLFHKAQTIIPGGVNSPVRAFKGVGG-EPVFFKSGKGAY
GSA_CAMC1       -----------------MTNKEAFSEAKKYIPGGVNSPVRAFGSVGG-EPVMIDHARGAY
GSA_CAMC5       -----------------MTNKEAFSEAKKFIAGGVNSPVRAFGSVGG-EPIIIDHGKGAY
GSA_CAMFF       -----------------MTNKNAFLEAKTYIPGGVDSPVRAFGSVGS-DPVFIDHGNGEF
GSA_CAMHC       -----------------MSNHKEFSEALKVIPGGVDSPVRAFKNVGS-EPFMVQKGKGAY
GSA_CAMJE       -----------------MTNKKAFKETCKFIAGGVNSPVRAFANVQS-EPKFISHGKGAY
GSA_CAMJ8       -----------------MTNKKAFKEACKFIAGGVNSPVRAFANVQS-EPKFISHGKGAY
GSA_CAMJJ       -----------------MTNKKAFKEACKFIAGGVNSPVRAFANVQS-EPKFISHGKGAY
GSA_CAMJR       -----------------MTNKKAFKEACKFIAGGVNSPVRAFANVQS-EPKFISHGKGAY
GSA_CAMJD       -----------------MTNKKAFKEACKFIAGGVNSPVRAFANVQS-EPKFISHGKGAY
GSA_HELPH       --------------MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKG-TPPFILKGKGAY
GSA_HELP2       --------------MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKG-TPPFILKGKGAY
GSA_HELPG       --------------MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKG-TPPFILKGKGAY
GSA_HELPS       --------------MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKG-TPPFILKGKGAY
GSA_HELPJ       --------------MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKG-TPPFILKGKGAY
GSA_HELPY       --------------MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKG-TPPFILKGKGAY
GSA_HELAH       --------------MELLHSINDFNEAKQVIVGGVNSPVRAFKSVKG-TPPFILKGKGAY
GSA_HELHP       --------------MDILQSINDFNEAKQVIPGGVNSPVRAFGSVGG-TPRFIAKGKGAY
GSA_WOLSU       --------------MERINSINDFNEAKQVIPGGVNSPVRAFRAVGG-TPPFIKEAKGSY
GSA_SULDN       --------------MSIDNSLKAFKEAQNLIPGGVNSPVRAFKSVGG-TPLFIANGSGAY
GSA_SULNB       --------------MAYDKSIAAFEEAYKVIPGGVDSPVRAFSGVEG-TPPFIERGEGAY
GSA_STRSV       --------------MKREHSNQYFTEAQKLFPGGVNSPVRAFKAVGG-HPLFIEKASGAY
GSA_CHLP8       -------------MPVLTRSAELFEKAKKFIPGGVNSPVRAFKSVGG-TPIYMAKGQGAY
GSA_CHLTE       -------------MPVLTRSAELFEKAKKFIPGGVNSPVRAFKSVGG-TPIYMAKGQGAY
GSA_CHLL2       -------------MPQLTKSAELFELAKKFIPGGVNSPVRAFKSVGG-TPIYMAKGEGAY
GSA_CHLCH       -------------MPQITRSIELFEKAKKFIPGGVNSPVRAFKSVGG-TPIYMAKGSGAY
GSA_PELPB       -------------MPQLTKSAELFEKAKKFIPGGVNSPVRAFKSVGG-TPVYMAKGSGAY
GSA_CHLPD       -------------MLQHTKSAELFEKAKQFIPGGVNSPVRAFKSVGG-TPIYMAKGRGAY
GSA_CHLPB       -------------MPQLTRSAELFEKAKQFIPGGVNSPVRAFKSVGG-TPIFMAKGQGAY
GSA_PROA2       -------------MPQLTRSAELFEKAKQFIPGGVNSPVRAFKSVGG-TPIYMAKGQGAY
GSA_PELLD       -------------MPTHTRSAELFEKAKKFIPGGVNSPVRAFKSVGG-NPIFMAKGQGAY
GSA_CHLPM       -------------MPKLTRSAELFEKAKKFIPGGVNSPVRAFKSVGG-NPIFMAKGQGAY
GSA_CHLT3       -------------MLNLKTSAALFERAKKVIPGGVNSPVRAFNSVGG-TPVFVTKGEGAR
GSA_CYTH3       --------------MKNKTSAGLFSRAKEVIPGGVNSPVRAFRAVGG-NPLFIKRAHGAY
GSA_SALRD       -------MEVAPSDVDLRTSRRFYERAQHSIPGGVNSPARAFDSVGG-TPLFIERAEGAY
GSA_HUNT2       --------------MTLSKSKLLFERAKKVIPGGVNSPVRAFGAVGG-YPPFIKKAKGAR
GSA_FLAJ1       --------------MLYKRSSQLFAEAEKVIPGGVNSPVRAFKAVGG-TPIFVKSAKGAY
GSA_FLAPJ       --------------MLYKRSSQLFLEAEKVIPGGVNSPVRAFKSVGG-TPIFAKSAKGAY
GSA_GRAFK       --------------MIYKRSSQLFADAQKVIPGGVNSPVRAFKAVGG-EPIFIEKAEGAY
GSA_WIGBR       -------------MIKNSITNKLYVEAKKIIPGGVNSPARSFYFVKE-IPVIAKRSKGPY
GSA_CHLTR       -------------------MSHLFSKACQYFPGGVNSPVRACRAVNI-TPPIVARASKEV
GSA_CHLTA       -------------------MSHLFSKACQYFPGGVNSPVRACRAVNI-TPPIVARASKEV
GSA_CHLT2       -------------------MSHLFSKACQYFPGGVNSPVRACRAVNI-TPPIVARASKEV
GSA_CHLTB       -------------------MSHLFSKACQYFPGGVNSPVRACRAVNI-TPPIVARASKEV
GSA_CHLMU       -------------------MPHLFSKACQYFPGGVNSPVRACRSVDI-TPPVVTRASGDF
GSA_CHLFF       -------------MPVIDESTMTYAEACRYFPGGVNSPIRACLPVRI-VPPIVSSACRDI
GSA_CHLCV       -------------MPVIDETPMTYTEACRYFPGGVNSPIRACIPVGI-VPPIVSSASRDV
GSA_CHLAB       -------------MPIIEESTMTYAEACRYFPGGVNSPIRACIPVGI-LPPIVSSAHRDI
GSA_CHLPN       -----------MLNCSNQKHTVTFEEACQVFPGGVNSPVRACRSVGV-TPPIVSSAQGDI
GSA_PARUW       -------------MISRPISQQIYSNLNRVIPGGVNSPVRACANMGQ-IPMIIDHAYRDT
GSA_LEPIN       MNQNKPTSKLISDFWKGKTSEELFERAKKVSPGGVHSPVRSFRSVGG-TPVFFASAKGAT
GSA_LEPIC       MNQNKPTSKLISDFWKGKTSEELFERAKKVSPGGVHSPVRSFRSVGG-TPVFFASAKGAT
GSA_LEPBL       MSQR--SSELISDSWKGSSSEELFERAKIVSPGGVHSPVRSFRSVGG-TPVFFVSANGAT
GSA_LEPBP       -----------------MNSETLFQRSKQVVPGGVHSPVRSFSSVGG-TPIFFSEARGAY
GSA_BDEBA       --------------MHKVTSEELFQRALKVAPGGVHSPVRSFKGLDR-APVFFKKAEGAY
GSA_FUSNN       --------------MVFKNSIDLYKKAVELIPGGVNSPVRAFKSVNREAPIFIKKGQGAK
GSA_METI4       ---------MIKLEMDFVLSEKLWKEAQEIFPGGVNSPVRSFQSVGG-FPFYVSRAKGSK
GSA_AERPE       -------------MASGEKSRMLFERTKELFPGGVNSPVR--AAVK-PYPFYVKRGEGAY
GSA_HYPBU       --------------MPGEVSRSLYEKALTLFPGGVNSPVR--AAVK-PYPFYVERAEGPY
GSA_SULAC       ------------------MSEKYWNIASHYFAGGVNSPVR--AAVK-PYPFYVERAEGAY
GSA_SULTO       ------------------MSENLWKKALELFAGGVNSPVR--AAVK-PYPFYVEKSEGAF
GSA_SACS2       -----------------MNSEELWAQAKQLFAGGVNSPVR--AAVK-PFPFYVERGKGAY
GSA_PYRAE       ---------------------MLFERAKSVFPGGVNSPAR--ALKHLPSPLVAKAASGAY
GSA_PYRCJ       ------MPFDVQFLKVFDGVLMLFERAKAVFPGGVNSPAR--ALKHLPTPLVAKAASGPY
GSA_THEAC       -----------------MGSKDLFQRGSSLFPMGVNSPVR--YFKD--YPFYVDNASGSR
GSA_THEVO       -----------------MSSKELFELAAKLFPMGVNSPVR--YFKD--YPFYVKEGKGST
GSA_PICTO       -----------------MKGDDLFSEALKLFPSGVNSPVR--FYRP--VPVMFERGRGSR
GSA_ARCFU       --------------MKLDKSRKLYAEALNLMPGGVSSPVR--AFKP--HPFYTARGKGSK
GSA_METAR       --------------MKQDHSAQLYDEAKSLFPGGVSSPVR--AIKP--FPFFTKSASGSH
GSA_METAC       ----------MVSEVTLDKSRQMYEKAKTLIPGGVSSPVR--AIKP--YPFYTASADGSK
GSA_METMA       ----------MVSEITLEKSRQMYEKAKTLIPGGVSSPVR--AIKP--YPFYTASANGSK
GSA_METBF       ----------MTSEATLEKSRQMYEKAKTLIPGGVSSPVR--AIKP--YPFYTASANGSK
GSA_METJA       ------------MALKMDKSKELFEEAKKYLVGGVNSPVR--YFKP--YPFFVEKAKDCY
GSA_METMP       ----------MELNIKMDRSKELFEESKKYLVGGVNSPVR--LFKP--FPFFVKSAKDCF
GSA_METST       --------------MKLDKSKELFDEAVNYLPGGVNSPVR--AYKP--YPFFAKSAKGSK
GSA_METTH       -----------------MKSEELFRRASNVLPGGVSSPVR--RFDP--HPFFAAGGSGCL
GSA_METKA       ----------MGYEDEFPESLELFKRAERVMPGGVSSPVR--RFDP--YPFYVERAEGSR
GSA_HALMA       --------------MNHEQSRALYDRALSVLSGGVNSSV---RAT-RPYPFFVEKGDGGH
GSA_HALLT       --------------MNHERSRGLYDRALSVMPGGVNSSV---RAT-MPHPFFIERGDGGH
GSA_HALSA       --------------MNRETSRELYDRSLDVLVGGVNSTV---RAAPQPYPTFVQSGDGGH
GSA_HALS3       --------------MNRETSRELYDRSLDVLVGGVNSTV---RAAPQPYPTFVQSGDGGH
GSA_NATPD       --------------MNHEGSRSLYDRALSVLPGGVNSAV---RAAPQPYPVFADHGDGGH
                                                 ** *.           .          

GSA1_BACAN      FWDVDGNKYIDYLAAYGPIITGHAHPH-ITKAITTAAEN-GVLYGTPTALEVKFAKMLKE
GSA1_BACHK      FWDVDGNKYIDYLAAYGPIITGHAHPH-ITKAITTAAEN-GVLYGTPTALEVKFAKMLKE
GSA1_BACCR      FWDVDGNKYIDYLAAYGPIITGHAHPH-ITKAITTAAEN-GVLYGTPTALEVKFAKMLKE
GSA1_BACCZ      FWDVDGNKYIDYLAAYGPIITGHAHPH-ITKAITTAAEN-GVLYGTPTALEVKFAKMLKE
GSA1_BACC1      FWDVDGNKYIDYLAAYGPIITGHAHPH-ITKAITTAAEN-GVLYGTPTALEVKFAKMLKE
GSA1_BACLD      FWDVDGNKYIDYLAAYGPIITGHAHPH-ITKAIQTAAEN-GVLYGTPTKHEVTFAKMLKE
GSAB_BACSU      FWDVDGNKYIDYLAAYGPIITGHAHPH-ITEAIKKAAEN-GVLYGTPTKHEVTFAKMLKE
GSA1_GEOKA      FWDVDGNKYIDYLAAYGPIIAGHAHPH-IAEAIRRAAET-GVLYGTPTPHEITFAKMLKE
GSA1_OCEIH      FWDVDDNKYIDYLAAYGPIITGHAHPH-IAKAIAHAATT-GVLYGTPTCLENEFAQMLKE
GSA2_LISMO      FYDVDGNKYIDYLAAFGPIITGHAHPH-ITEAITKAAQN-GVLYGTPTKHEITFAKMLKE
GSA2_LISMF      FYDVDGNKYIDYLAAFGPIITGHAHPH-ITEAITKAAQN-GVLYGTPTKHEITFAKMLKE
GSA2_LISIN      FYDVDGNKYIDYLAAFGPIITGHAHPH-ITEAITKAAQN-GVLYGTPTKHEITFAKMLKE
GSA1_BACSK      FYDVDGNRYIDYLAAYGPIITGHAHPV-ITKAIQDQAAK-GVLFGTPTRLENEFAQELTN
GSA1_BACHD      FWDVDGNQYIDYLAAYGPIITGHAHPH-ITNAIQRAAEN-GVLYGTPTKLENQFASMLQQ
GSA2_STAAC      LYDVDGNKFIDYLQAYGPIITGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAA3      LYDVDGNKFIDYLQAYGPIITGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAAR      LYDVDGNKFIDYLQAYGPIITGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAAB      LYDVDGNKFIDYLQAYGPIITGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAAS      LYDVDGNKFIDYLQAYGPIITGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAAW      LYDVDGNKFIDYLQAYGPIITGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAAM      LYDVDGNKFIDYLQAYGPIIAGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAAN      LYDVDGNKFIDYLQAYGPIIAGHAHPH-ITKAIQEQAAK-GVLFGTPTELEIEFSKKLRD
GSA2_STAES      LYDVDGNKYIDYLQAYGPIITGHAHPH-ITEAIQDQAAK-GVLYGTPTELEINFSKKLRE
GSA2_STAEQ      LYDVDGNKYIDYLQAYGPIITGHAHPH-ITEAIQDQAAK-GVLYGTPTELEINFSKKLRE
GSA1_STAS1      LYDVDGNKYIDYLQAYGPIITGHAHPH-ITEAIQEQAAL-GILYGTPTELEIEFAKKLRD
GSA_SYMTH       LYDVDGNRYIDYIGAFGAGMFGHGHPE-LVAAVARAAEG-GTIYGTPNPWEVELAERIHQ
GSA_ACAM1       VWDVDGNQYIDYVGTWGPAICGHAHPE-VLTALKEALDK-GTSFGAPCLLENVLAEMVID
GSA_CYAP4       VWDVDGNQYIDYVGSWGPAICGHAHPE-VIKALHAALDK-GTSFGAPCLLENVLAEMVID
GSA_NOSS1       IWDVDGNQYIDYVGTWGPAICGHAHPD-VIGALHDALEK-GTSFGAPSFLENVLAEMVIA
GSA_TRIV2       IWDVDGNQYIDYVGTWGPAICGHAHPD-VIGALHEALEK-GTSFGAPSFLENVLAEMVIA
GSA_NOSP7       IWDVDGNQYIDYVGTWGPAICGHAHPE-VIAALHEALEK-GTSFGAPSTLENVLAEMVID
GSA_TRIEI       IWDVDGNQYIDYVGTWGPAICGHAHPE-VLNGLKEVLEK-GTSFGAPCALENTLAKMVID
GSA_SYNE7       AWDVDGNRYIDYVGTWGPAICGHAHPE-VIEALKVAMEK-GTSFGAPCALENVLAEMVID
GSA_SYNP6       AWDVDGNRYIDYVGTWGPAICGHAHPE-VIEALKVAMEK-GTSFGAPCALENVLAEMVID
GSA_SYNP2       VWDVDGNEYIDYVGTWGPAICGHANDE-VNAALRETLEK-GTSFGAPCLKENILAEMVIN
GSA_RIPO1       IWDVDGNQYIDYVGTWGPAICGHAHPD-VIAALHEALEK-GTSFGAPSVQENILAEMVIE
GSA_MICAN       IRDVDGNEYIDYVGTWGPAICGHAHPE-VIAALHDALDK-GTSFGAPCVQENILAEMVID
GSA_GLOC7       IWDVDNNQYIDYVGTWGPAICGHAHPD-VISALHKALDK-GTSFGAPCMQENILAEMVID
GSA_SYNY3       IWDVDGNQYIDYVGTWGPAICGHAHPD-VISALKQALDK-GTSFGAPCAQENVLAEMVID
GSA_SYNJB       AWDVDGNQYIDYIGSWGPAIVGHAHPE-VIEALRRALEK-GTSFGAPCVLENELAERVIE
GSA_SYNJA       AWDVDGNQYIDYIGSWGPAIVGHAHPE-VIEALRRALEK-GTSFGAPCVLENELAERVIE
GSA_THEEB       IWDVDGNQYIDYVGSWGPAIVGHAHPE-VIDALHAALEK-GTSFGAPCLLENILAEMVIA
GSA_PROMA       AWDLDGNRFIDYVGSWGPAICGHSHPE-VIASLQEALEK-GTSFGAPCELENKLAEMVIE
GSA_PROM4       AWDLDGNRFIDYVGSWGPAICGHSHPE-VIAALQEALEK-GTSFGAPCELENKLAGMVIE
GSA_PROM1       AWDVDGNRYIDYVGSWGPAICGHAHPE-VIAALQETLEK-GTSFGAPCVLENQLAEMVID
GSA_PROMT       AWDVDGNRYIDYVGSWGPAICGHAHPE-VIAALQETLEK-GTSFGAPCVLENQLAEMVID
GSA_PROM3       AWDVDGNRFIDYIGSWGPAICGHAHPE-VIAALQDALEK-GTSFGAPCELENQLAEMVID
GSA_PROMM       AWDVDGNRFIDYIGSWGPAICGHAHPE-VIVALQDALEK-GTSFGAPCELENQLAEMVID
GSA_SYNS9       AWDVDGNKYIDYIGSWGPAICGHAHPE-VISALQEAIEK-GTSFGAPCALENTLAEMVID
GSA_SYNPX       AWDVDGNKYIDYIGSWGPAICGHAHPE-VISALQEAIEK-GTSFGAPCALENTLAEMVID
GSA_SYNSC       AWDVDGNKYIDYIGSWGPAICGHAHPE-VIAALQEAIEK-GTSFGAPCALENTLAEMVID
GSA_SYNPW       AWDVDGNKYIDYIGSWGPAICGHAHPE-VISALQEAIEK-GTSFGAPCALENTLAEMVID
GSA_PROMS       AWDIDGNRYIDYIGSWGPAICGHAHPE-VTTALQEAIEK-GTSFGAPCVLENKLAEMVID
GSA_PROM0       AWDIDGNRYIDYIGSWGPAICGHAHPE-VITALHEAIEK-GTSFGAPCVLENKLAEMVID
GSA_PROM2       AWDIDGNRYIDYIGSWGPAICGHAHPE-VTTALQEAIEK-GTSFGAPCVLENKLAEMVID
GSA_PROM9       AWDIDGNRYIDYIGSWGPAICGHAHPE-VTTALQEAIEK-GTSFGAPCVLENKLAEMVID
GSA_PROMP       AWDIDGNRYIDYIGSWGPAICGHAHPE-VITALQEAIEK-GTSFGAPCVLENKLAEMVID
GSA_GLOVI       LWDVDGNRYIEYINTWGPSIVGHSHPE-VISALREALPK-GTSYGAPTRLENQMARTVID
GSA_CHLSY       VWDVDGNRYIDYVLSWGPLLLGHAHPA-VVEAITLQAQR-GTSFGAPTELETELARLVIE
GSA_CHLAA       VWDVDGNRYIDYVLSWGPLLLGHAHPA-VVEAITLQAQR-GTSFGAPTELETELARLVIE
GSA_CHLAD       IWDVDGNRYIDYVLSWGPLLLGHAHPA-VVNAIATQAQR-GTSFGAPTELETDLARLVLD
GSA_ROSCS       LVDVDGNRYIDYVLSWGPLILGHAHPN-VVAAIAEQAAH-GTSFGAPTELESELARLITQ
GSA_ROSS1       IFDVDGNRYIDYVLSWGPLIAGHTHPD-VVAAIAEQAAR-GTSFGAPTELESELARLIIQ
GSA_HERA2       LYDIDGNQYIDYVLSWGPLILGHAYPA-VVEAICAQAQR-GTSFGAPTELESELAELVIA
GSA_FRACC       LTDADGRTYIDLVCSWGPMILGHAHPA-VVEAVSRAVSV-GTSFGTPTPGEVELAELIVD
GSA_FRASN       LVDADGRTYVDLVCSWGPMILGHAHPD-VVQAITAAAAR-GTSFGTPTPGEVELAELIVE
GSA_THEFY       LTDADGNTYVDLICSWGPLILGHAHPA-VVEALAKAAAQ-GTSYGAPTEAEVELAEEIVS
GSA_STRAW       LTDADGRTYVDLVCSWGPMILGHSHPE-VIAAVQEAVAR-GTSFGTPGEGEVALAEEIVA
GSA_STRCO       LTDADGREYVDLVCSWGPMILGHAHPE-VIAAVQEAVAR-GTSFGTPAEGEVALAEAMVE
GSA_STRGG       LTDADGREYVDLVCSWGPMILGHSHPE-VIAAVQEAVSR-GTSFGTPGEGEVALAEEIVA
GSA_MYCA1       LTDADGNHYVDLVCSWGPMILGHAHPA-VVEAVAKAAAS-GLSFGAPTPAESELAAEMIA
GSA_MYCPA       LTDADGNHYVDLVCSWGPMILGHAHPA-VVEAVAKAAAS-GLSFGAPTPAESELAAEMIA
GSA_MYCMM       LTDADGNRYADLVCSWGPMILGHAHPA-VVEAVSRAATN-GLSFGAPTPTETELAAEMIG
GSA_MYCUA       LTDADGNRYADLVCSWGPMILGHAHPA-VVEAVSRAAAN-GLSFGAPTPTETELAAEMIG
GSA_MYCBO       LIDADGNRYVDLVCSWGPMILGHAHPA-VVEAVAKAAAR-GLSFGAPTPAETQLAGEIIG
GSA_MYCTA       LIDADGNRYVDLVCSWGPMILGHAHPA-VVEAVAKAAAR-GLSFGAPTPAETQLAGEIIG
GSA_MYCBT       LIDADGNRYVDLVCSWGPMILGHAHPA-VVEAVAKAAAR-GLSFGAPTPAETQLAGEIIG
GSA_MYCBP       LIDADGNRYVDLVCSWGPMILGHAHPA-VVEAVAKAAAR-GLSFGAPTPAETQLAGEIIG
GSA_MYCTU       LIDADGNRYVDLVCSWGPMILGHAHPA-VVEAVAKAAAR-GLSFGAPTPAETQLAGEIIG
GSA_MYCLE       LTDADGRRYVDLVCSWGPMILGHAHPA-VVDAVATVAAS-GLSFGAPTPAETQLAAEIIG
GSA_MYCLB       LTDADGRRYVDLVCSWGPMILGHAHPA-VVDAVATVAAS-GLSFGAPTPAETQLAAEIIG
GSA_RHOOB       LTDVDGNDYVDLICSWGPMILGHAHPA-VVEAVQTAATT-GLSFGAPTEGEIELAEEIVR
GSA_RHOJR       LTDVDGNDYVDLICSWGPMILGHAHPA-VVEAVQKAAAT-GLSFGAPTEGEIELAEEIVG
GSA_NOCFA       LTDADGNEYVDLVCSWGPMILGHAHPA-VVDAVRRAATG-GLSFGAPTEAEVELAEHIVA
GSA_ACIC1       LVDVDGNRYVDLVCSWGPLILGHAHPA-VVAAVKQAAER-GTSFGAPTEAEIEMAEEIAR
GSA_CORGL       LIDVDGNEYVDLVCSWGPMLMGHAHPA-VVEAVQKAVVD-GLSFGAPTIGEVELAQDIVK
GSA_CORGB       LIDVDGNEYVDLVCSWGPMLMGHAHPA-VVEAVQKAVVD-GLSFGAPTIGEVELAQDIVK
GSA_COREF       LIDVDGNEYVDLVCSWGPMLMGHAHPA-VLEAVQKTIVD-GLSFGAPTIGEVELAQDIIN
GSA_CORDI       LYDVDGNEYVDLVCSWGPMLLGNAHPE-IVEAVQKAATN-GLSFGAPTEAEVKIAEMIVD
GSA_CORA7       LWDIDGNEYVDLVSSYGPMIHGNAHPA-IVEAVQKAAAD-GLSFGAPTEGETLLAEHIVK
GSA_CORJK       LHDVDGNSYVDLFCSWGPMIHGHAHPQ-IVEAVREAAGH-GLSFGAPTTMEVDLVEEIDR
GSA_CLAM3       VTDADGVEYVDLVNSWGPAILGHARPE-VVQAVQDAAAL-GLGFGATTPAETELAELVTD
GSA_CLAMS       VTDADGVEYVDLVNSWGPAILGHARPE-VVKAVQDAAAL-GLGFGATTPAETELAELVTE
GSA_LEIXX       IVDAEGREYVDLVASWGPAILGHAHPA-VVSAVQEAAAR-GLSFGASTPAETELAEAVIA
GSA_KOCRD       LTDVDGREYVDLVCSWGPALIGHAHPV-VTEAVHEAVER-GLGFGATTRGETELAELVVD
GSA_CUTAK       IWDAEGTRYVDLVCTWGPALLGHARPE-VVSAVQVAASK-GLSFGAPTRTETELADAIIE
GSA_PROFF       IVDVDDKRYVDLVCSWGPMIAGHAHPE-VVAAVLQAVAD-STSFGAPSEVELRLAQAVVA
GSA_TROW8       VTDIEGREYVDLVSSWGPLILGHAHPK-VIDAVINTAHR-GMSYGAPTTLEVELAELVCN
GSA_TROWT       VTDIEGREYVDLVSSWGPLILGHAHPK-VIDAVINTAHR-GMSYGAPTTLEVELAELVCN
GSA_ANAD2       IFDVDGNDYVDYVLSWGPMIVGHCHPE-VMREVQDAMKE-GSSFGAPSPREILLAELVRE
GSA_ANASK       IFDVDGNDYVDYVLSWGPMIVGHCHPE-VMREVQDAMKE-GSSFGAPSPREILLAELVRE
GSA_ANADE       IVDVDGNDYVDYVLSWGPMIVGHCHPE-VMRAVQDAMKE-GSSFGAPSPREILLAELVRE
GSA_ANADF       LFDVDGNDYVDYVLSWGPMIVGHAHPE-VMREVQDAMKE-GASFGAPSPREITLAELVRE
GSA_MYXXD       LTDVDGNRYVDLVGSWGPLILGHAYPP-ILDAIIDAARR-GSSYGAPHADEVEFAELICA
GSA_CARHZ       IYDIDGNCYIDYVGSWGPLILGHRHPK-VEEALANCLKK-GTSFGAPTLLETEMAEIIVN
GSA_PELTS       IYDFDDNEYIDYVCSWGPLILGHRHPR-VVGALERCLNEVGTSFGAPTELENILAEMIVE
GSA_MOOTA       LYDIDGHKYIDYVSSWGPLILGHRHPE-VVDALEKTLREMGTSFGAPTELENELAREITT
GSA_THERP       LIDADGRRFLDYICSWGALLAGHAHPH-VVDRLSEAIQR-GTSFGLLSPYEVELARAIVA
GSA_THET2       VWDADGNRYLDYVMSWGPLILGHAHPK-VLARVRETLER-GLTFGAPSPLEVALAKKVKR
GSA_THET8       VWDADGNRYLDYVMSWGPLILGHAHPK-VLARVRETLER-GLTFGAPSPLEVALAKKVKR
GSA_DEIRA       LTDADGARYLDYIGSWGPMILGHNHPA-VRDAVAQALAS-GTSFGAPNEREVELAELIVE
GSA_RHOBA       LYDIDGNRYIDYIGSWGPMILGHAHPE-VINAITQAAAK-GTSYGAPTEAESRLAEQIIE
GSA_SORC5       LFDADGAEYIDYVGSWGPAILGHAHPA-VIEAVREAALG-GLSFGAPTELEVRFAEKIRE
GSA_CALBD       IFDIDGNEYIDFVLSWGAMILGHCDPD-VVNRMKEVVED-QIAFGAPTEIEYKMAKLVCE
GSA_CALS8       IFDIDGNEYIDFVLSWGAMILGHCDPD-VVNSIKEVVED-QIAFGAPTEIEYKMAKLVCE
GSA_CLOAB       LFDEEGKEYIDFIEAWGPMILGHKNQK-VLNEVKEVLDE-GVGFGAPTSLELKLAKYICT
GSA_CLOTE       IVDEEGKEYIDFVASWGPMILGHNDPE-VVEAIQNTVED-AISFGAPTELELKLAKHMVE
GSA_CLOBA       IRDEDGKEYIDFVLAWGPLLLGHCDED-VVKAIKETSEN-ALAFGAPTKLELELSKFMCE
GSA_CLOBB       IKDEDGKEYIDFVLAWGPLLLGHCDED-VVKAIKETSEN-ALAFGAPTKLELELSKFMCE
GSA_CLOB8       IKDEEDNEYIDFVLAWGPLILGHCDDD-VVEAIKEVSSM-ALAFGAPTKLELDLAKFICT
GSA_CLOP1       IKDENGNEYIDFVLAWGPMILGHCDED-VVKAIKKTSEE-SIAFGASTKLELDLAKLLCE
GSA_CLOPS       IKDENGNEYIDFVLAWGPMILGHCDED-VVEAIKKTSEE-SIAFGASTKLELDLAKILCE
GSA_CLOPE       IKDENGNEYIDFVLAWGPMILGHCDED-VVEAIKKTSEE-SIAFGASTKLELDLAKLLCE
GSA_CLOK5       IYDEDGNEYIDFVCSWGPMILGHCDED-VVNAIKYTSEN-AISFGATTKIELELSKYICT
GSA_AQUAE       VWDAEGNEYIDFLASWGAIILGHAPKK-VVKAVQEEAEK-GLSFGLTNPHEVTLAKLVVE
GSA_HYDS0       VEDIEGKKYIDYMLSFGPLILGHRSEI-VVSKIMEALDK-GNSFGITNMYEIELSELIIK
GSA_PERMH       VWDVDGNEYIDYVLSWGPLILGHANDQ-IVNAIKQVANY-GTSFGAPTELEIEMAKAVVD
GSA_SULSY       IWDVDDNEYIDYVLSWGPLILGHAHDQ-VINAIKQISNY-GTSFGAPTELEVEMAKAVID
GSA_DESVH       LHTVDGETFIDFVESWGPMLLGHTHPE-VTAAVHAAVDR-GTSYGAPCEDEVVLAAKVVD
GSA_DESVV       LHTVDGETFIDFVESWGPMLLGHTHPE-VTAAVHAAVDR-GTSYGAPCEDEVVLAAKVVD
GSA_DESVM       LTTVDGTSFVDYVQSWGPMLLGHAHPV-VASAIHAAVDR-GTSYGAPCEDEVVLAEAVID
GSA_DESAG       LYSVDGREYIDFVESWGPLLLGHAHPA-VNKAIHEAVDK-GSSFGAPCEDEIRLAEAVVD
GSA_LAWIP       LTTVDGQELLDFVLSWGAIILGHTNST-VTNAIKKAASN-GTTFGAPCKAEVLLAKEIID
GSA_SYNWW       IYDVDGNEYIDYVCSWGPLILGHSHPQ-VVQAICEAAEK-GSSFGAPCEQEIELAQLICE
GSA2_BACAN      VYDIDGNEYIDYVLSWGPLIHGHANDR-VVEALKAVAER-GTSFGAPTEIENKLAKLVIE
GSA2_BACHK      VYDIDGNEYIDYVLSWGPLIHGHANDR-VVEALKAVAER-GTSFGAPTEIENKLAKLVIE
GSA2_BACCZ      VYDIDGNEYIDYVLSWGPLIHGHANDR-VVEALKAVAER-GTSFGAPTEIENKLAKLVIE
GSA2_BACCR      VYDIDGNEYIDYVLSWGPLIHGHANDR-VVEALKSVAER-GTSFGAPTEIENKLAKLVIE
GSA2_BACC1      VYDIDGNEYIDYVLSWGPLIHGHANNR-VVEALKAVAEK-GTSFGAPTEIENKLAKLVIE
GSA2_BACLD      IYDIDGNEYIDYVLSWGPLILGHSNEK-VVKEIQKAAEH-GTSFGAPTELETELAELVID
GSA_BACSU       IFDIDGNEYIDYVLSWGPLILGHTNDR-VVESLKKVAEY-GTSFGAPTEVENELAKLVID
GSA2_GEOKA      IYDIDGNEYIDYVLSWGPLILGHANPQ-VVEALKRVAEQ-GTSFGAPTLLENELAKLVIE
GSA2_BACSK      IKDIDGNEYIDYVLSWGPLILGHANDV-VVEELKKATEL-GTSFGAPHEYETRLAKLVIE
GSA2_BACHD      IYDIDGNEYIDYVLSWGPLILGHADDQ-VVEKLKETTEK-GTSFGAPSELETKLAELVIE
GSA1_STAAU      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAAC      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAA8      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAA3      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAAM      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAAN      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAAR      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAAS      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAAW      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAAB      IYDIDGNEYIDYVLSWGPLILGHRDPQ-VISHLHEAIDK-GTSFGASTLLENKLAQLVID
GSA1_STAES      IYDIDGNEYIDYVLSWGPLILGHKNQQ-VISKLHEAVDK-GTSFGASTLQENKLAELVID
GSA1_STAEQ      IYDIDGNEYIDYVLSWGPLILGHKNQQ-VISKLHEAVDK-GTSFGASTLQENKLAELVID
GSA2_STAS1      IYDIDGNEYIDYVLSWGPLILGHKNKQ-VIEKIHEAVDK-GTSFGASTLQENKLAELVIE
GSA2_STAHJ      IYDIDGNEYIDYVLSWGPLILGHKNEQ-VIKKLHEAVNR-GTSFGASTLEENKLAELVIE
GSA2_OCEIH      IVDIDNNEYIDYVLSWGPLILGHSDER-VVKKLQDITAK-GTSFGAPTLLENDLAKLVID
GSA1_LISMO      ITDVDGNEYIDYVLSWGPLILGHTDPA-VVNAITKAALK-GTSFGTPTEIETELAKLVIE
GSA1_LISMF      ITDVDGNEYIDYVLSWGPLILGHADPA-VVNAITKAALK-GTSFGTPTEIETELAKLVIE
GSA1_LISIN      ITDVDGNEYIDYVLSWGPLILGHADPS-VVNAITNSAMK-GTSFGTPTEIETELAKLVIE
GSA_NATTJ       VYDVDDNEYIDYVASYGPLILGHCHPQ-IRDALKEQIDY-GTGYGSPTELENEMAELVIE
GSA_THEYD       IYDVDGNEYIDYVLSWGPLILGHAYPS-VVKALKKAIEK-GTSYGAPTELEIKLATLVKK
GSA_DESPS       IYDADGQKYLDFVNSWGPMIMGHAHPD-IIKAIQDAAVY-GTSYGAPTSSEVDLASMVVE
GSA_SYNAS       IYDIDGREYIDYVGSWGPMILGHSHPQ-VVEAIRKAVER-GTSYGAPTPGEIALARTIIE
GSA_DESOH       IVDADGNVYIDYIGSWGPMILGHRHSA-VMAAIETVLKR-GLSFGASTDLEARLARMVAD
GSA_SYNFM       LWDEDGNRYVDFVASWGPLIVGHAHPA-VVEAVRAAVEK-GTSYGIPTEIEVRMARKVVE
GSA_GEODF       IEDVDGNQFIDFVGSWGPMILGHCHPQ-VASAVKAAVDS-GCSFGAPTELEITLAEMVIN
GSA_GEOUR       IYDVDGNEFIDYVGSWGPMILGHCHPQ-VVAAVKSAVDN-GCSFGAPTELEITLAEMVIE
GSA_GEOBB       IYDEDGNAFIDYVGSWGPMILGHCHPQ-VVSAIKAAVDN-GASFGAPTELEITLAEMVID
GSA_PELPD       ITDVDGNTFIDYVGSWGPMIVGHCHPQ-VVEAVRQAAGS-GASFGAPTEREITLANMVID
GSA_GEOLS       IFDEDNNTYIDYVGSWGPMILGHCFPE-VVNAVKQCMEN-GSSFGAPTELEITLAQMVID
GSA_GEOMG       IIDADDNAYIDYVGSWGPMILGHCHPR-IVASVQRATEN-GSSFGAPTELEITLAEMVVA
GSA_GEOSL       ITDADNNSYIDYVGSWGPMILGHCHPQ-VVEAVKRAVES-GSSFGAPTELEITLARMVID
GSA_PELCD       LVDADGNRYIDYVGSWGPMIVGHSHPK-VVEAICDAAAR-GTSFGAPTALEIELAEQVCA
GSA_ECOL6       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOL5       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO45       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOK1       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO27       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOUT       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO81       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO24       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO8A       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO55       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOLC       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOSE       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOHS       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOLU       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO57       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO5E       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_SHISS       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECO7I       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECODH       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOLI       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ECOSM       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_SHIB3       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_SHIBS       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_SHIDS       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_SHIFL       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_SHIF8       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ESCF3       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_SALDC       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALSV       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALA4       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALTI       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALG2       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALNS       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALEP       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALPB       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALCH       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALPC       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALPA       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALPK       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALHS       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALTY       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTN
GSA_SALAR       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAELVTS
GSA_CROS8       LYDADGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAAER-GLSFGAPTEMEVKMAQLVTE
GSA_ENT38       LYDVDGKAYIDYVGSWGPMVLGHNHPT-IRNAVIEAAQR-GLSFGAPTEMEVKMAELVTE
GSA_KLEP3       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAASR-GLSFGAPTEMEVKMAELVTE
GSA_KLEP7       LYDVDGKAYIDYVGSWGPMVLGHNHPA-IRNAVIEAASR-GLSFGAPTEMEVKMAALVTE
GSA_YERPE       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERPP       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERPN       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERPG       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERPA       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERPS       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERPB       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERP3       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERPY       LFDVDGKAYIDYVGSWGPMILGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAQLVTD
GSA_YERE8       LFDVDGKAYIDYVGSWGPMVLGHNHPA-IRQAVIEAVER-GLSFGAPTEMEVKMAELVTN
GSA_ERWT9       LYDADGKAYIDYVGSWGPMVLGHNHPA-IRNAVIDAAER-GLSFGAPTEMEVKMAALVTE
GSA_PECAS       LYDVDEQAYIDYVGSWGPMVLGHNHPS-IRDAVIAAAER-GLSFGAPTEMEVQMARLVTS
GSA_PHOLL       LYDVDGKAYIDYVGSWGPMVLGHNHSA-IRNAVIKAAEQ-GLSFGAPTAAEVEMAQLVTE
GSA_PROMH       IYDADGRAYLDYVGSWGPMVLGHNHPA-IRHAVTDAVQK-GLSFGAPTAAEVEMANLVTE
GSA_SODGM       LTDADGNSYIDYVGSWGPMVLGHNHPA-IRQAVLDAVQR-GLSFGAPTEIEVKMARLLTE
GSA_ACTPJ       ITDSDGKKYIDYVGSWGPMVLGHNHPA-IIDAVLKAVPN-GLSFGAPTESEITLAELVTK
GSA_ACTP2       ITDSDGKKYIDYVGSWGPMVLGHNHPA-IIDAVLKAVPN-GLSFGAPTESEITLAELVTK
GSA_ACTP7       ITDSDGKKYIDYVGSWGPMVLGHNHPA-IIDAVLKAVPN-GLSFGAPTESEITLAELVTK
GSA_HAEPS       ITDSEGKRYIDYVGSWGPMVLGHNHPA-IIDAVLKAVPN-GLSFGAPTAIEIELAELVCK
GSA_ACTSZ       ITDTDGKQYIDYVGSWGPMVLGHNHPA-IIDAVLKAVPN-GLSFGAPTEGEITLAELVCR
GSA_HAES1       IFDTEGKQYIDYVGSWGPMILGHNHPS-ILSAVLKTAEN-GLSFGTPTPLEIELAELICQ
GSA_HISS2       IFDIEGKQYIDYVGSWGPMILGHNHPS-ILSAVLKIAEN-GLSFGTPTPLEIELAELICQ
GSA_PASMU       LYDTEGNQYIDYVGSWGPMILGHNHPT-ILDAVISTAQN-GLSFGAPTALEIELAELVCS
GSA_MANSM       IWDTDDKQYVDYVGSWGPMILGHNHPA-ILSAVIKTAEN-GLSFGAPTPIEIDLAELVCK
GSA_AERHH       LYDVDGQAYVDYIGSWGPMLLGHNHPA-IKAAVIKAVEK-GLSYGAPTEIEVLMAEKVRQ
GSA_AERS4       LYDVDGQAYVDYIGSWGPMLLGHNHPA-IKAAVIKAVEK-GLSYGAPTEIEVLMAEKVRQ
GSA_SHEB8       IYDADGKAYIDYVGSWGPMILGHNHPK-IRAAVLAAVEN-GLSFGAPTELEVQMAEKVIS
GSA_SHEB2       IYDADGKAYIDYVGSWGPMILGHNHPK-IRAAVLAAVEN-GLSFGAPTELEVQMAEKVIS
GSA_SHEB5       IYDADGKAYIDYVGSWGPMILGHNHPK-IRAAVLAAVEN-GLSFGAPTELEVQMAEKVIS
GSA_SHEB9       IYDADGKAYIDYVGSWGPMILGHNHPK-IRAAVLAAVEN-GLSFGAPTELEVQMAEKVIS
GSA_SHEPC       IYDADGKAYIDYVGSWGPMILGHNHPK-IRAAVLAAVEN-GLSFGAPTELEVQMAEKVIS
GSA_SHESW       IYDADGKAYIDYVGSWGPMILGHNHPK-IRAAVLAAVEN-GLSFGAPTELEVQMAEKVIS
GSA_SHESM       IYDADGKAYIDYVGSWGPMILGHNHPK-IREAVLAAVHN-GLSFGAPTELEVQMAEKVIA
GSA_SHESR       IYDADGKAYIDYVGSWGPMILGHNHPK-IREAVLAAVHN-GLSFGAPTELEVQMAEKVIA
GSA_SHESA       IYDADGKAYIDYVGSWGPMILGHNHPK-IREAVLAAVHN-GLSFGAPTELEVQMAEKVIA
GSA_SHEON       IYDADGKAYIDYVGSWGPMILGHNHPK-IREAVLAAVHN-GLSFGAPTELEVQMAEKVIA
GSA_SHEHH       IFDADGKKYIDYVGSWGPMILGHNHPK-IREAVLAAVEN-GLSFGAPTELEITMAEKVIE
GSA_SHEPA       IFDADGKKYIDYVGSWGPMILGHNHPK-IREAVLKAVEN-GLSFGAPTELEITMAEKVIE
GSA_SHESH       IYDADGKAYIDYVGSWGPMILGHNHPK-IREAVLAAVEN-GLSFGAPTELEVTMAEKVIE
GSA_SHEWM       IYDADGKAYIDYVGSWGPMILGHNHPK-IRQAVLEAVEN-GLSFGAPTELEVKMAEKVIE
GSA_SHEPW       IFDADGKKYIDYVGSWGPMILGHNHPK-IRAAVLEAVEN-GLSFGAPTELEVTMAEKVIE
GSA_SHELP       IYDADGKAYIDYVGSWGPMILGHNHPK-IRQAVLDAVEN-GLSFGAPTELEVRMAEKVIE
GSA_SHEAM       IYDADGKAYIDYVGSWGPMILGHNHPS-IREAVLKAVHN-GLSFGAPTELEVIMAEKVIE
GSA_SHEDO       IFDADGNKYIDYVGSWGPMILGHNHPK-IRQAVLDAVEN-GLSFGAPTELEVKMAEKVIA
GSA_SHEFN       IFDADGKKYIDYVGSWGPMILGHNHPK-IRQAVLDAVDN-GLSFGAPTELEVKMAEKVIS
GSA_ALIF1       IFDADGKAYIDYVGSWGPMILGHNHAA-IREAVISAAQR-GLSFGAPTETEITMAELVSE
GSA_ALIFM       IFDADGKAYIDYVGSWGPMILGHNHAA-IREAVISAAQR-GLSFGAPTETEITMAELVSE
GSA_ALISL       IFDADGKAYIDYVGSWGPMILGHNHAA-IREAVISAAQR-GLSFGAPTETEINMAELVSE
GSA_VIBCH       IFDADGKAYIDYVGSWGPMILGHNHAV-IREAVIQAAQR-GLSFGAPTEMEITMAELVSE
GSA_VIBC3       IFDADGKAYIDYVGSWGPMILGHNHAV-IREAVIQAAQR-GLSFGAPTEMEITMAELVSE
GSA_VIBCM       IFDADGKAYIDYVGSWGPMILGHNHAV-IREAVIQAAQR-GLSFGAPTEMEITMAELVSE
GSA_VIBVU       IFDADGKAYIDYVGSWGPMILGHNHAV-IREAVIEAAQR-GLSFGAPTEMEIKMAELVSE
GSA_VIBVY       IFDADGKAYIDYVGSWGPMILGHNHAV-IREAVIEAAQR-GLSFGAPTEMEIKMAELVSE
GSA_VIBPA       IFDADGRAYIDYVGSWGPMILGHNHAV-IREAVIDAAQR-GLSFGAPTEMEIAMAELVSE
GSA_VIBTL       IFDADGKAYIDYVGSWGPMILGHNHVV-IRDAVIAAAQR-GLSFGAPTETEIKMAELVSE
GSA_PHOPR       IFDADGKAYIDYVGSWGPMILGHNHVA-VRDAVIKAAQQ-GLSFGAPTEMEITMAELVSK
GSA_COLP3       IYDADDKAYIDYVGSWGPMILGHNHPA-ILEAVITTAKN-GLSFGAPTEIEITMAEKVRE
GSA_PSEHT       TFDADGNRYIDYVGSWGPMIMGHNHPA-IKQAVHDAVEN-GLSYGAPTEAEILMAEKVKE
GSA_IDILO       MIDADGKRYIDYVGSWGPMILGHNHPA-VLEATLQAAKR-GLSFGTPTEVEITMAETIRK
GSA_PSYIN       IYDVDKKSYIDYVGSWGPMILGHNHPE-IKAAVIAAVEN-GLSFGAPTEIEIIMAEKVKS
GSA_PSEA6       LYDADGKQYIDYVQSWGPMVLGHNNPI-IRQAVIDAAQN-GLSFGAPTEAEVTIADLVSE
GSA_ACIF2       FWDVEGKRYLDYVGSWGPMIHGHGHPE-VLAAVHAQVNK-GLGFGAPTAIEVEMAELVCA
GSA_ACIF5       FWDVEGKRYLDYVGSWGPMIHGHGHPE-VLAAVHAQVNK-GLGFGAPTAIEVEMAELVCA
GSA_METCA       VYGVDGKAYIDYVGSWGPMILGHAHPE-VLTAVHAAVDR-GLSYGAPTVAETAMAKTVCA
GSA_PSEAE       VLDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRRQLDH-GLSYGAPTALEVEMADLVCS
GSA_PSEA8       VLDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRRQLDH-GLSYGAPTALEVEMADLVCS
GSA_PSEAB       VLDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRRQLDH-GLSYGAPTALEVEMADLVCS
GSA_PSEA7       VLDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRRQLDH-GLSYGAPTALEVEMADLVCA
GSA_PSEE4       VIDEDDKRYVDYVGSWGPMILGHGHPE-VLDAVRNQLQH-GLSYGAPTAMETEMADLVCS
GSA_PSEPW       VVDEDDKRYVDYVGSWGPMILGHGHPQ-VLDAVRNQLQH-GLSYGAPTAMETEMADLVCS
GSA_PSEP1       VVDEDDKRYVDYVGSWGPMILGHGHPD-VLDSVRKQLEH-GLSYGAPTAMETEMADLVCS
GSA_PSEPK       VVDEDDKRYVDYVGSWGPMILGHGHPD-VLDSVRRQLEH-GLSYGAPTAMETEMADLVCS
GSA_PSEPG       VVDEDDKRYVDYVGSWGPMILGHGHPD-VLDSVRKQLEH-GLSYGAPTAMETDMADLVCS
GSA_PSEF5       VTDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRKQLEH-GLSYGAPTAMETEMADLVCS
GSA_PSEPF       VTDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRNQLQH-GLSYGAPTAMETEMADLVCS
GSA_PSEMY       VVDEDDKRYVDYVGSWGPMILGHSHPD-VLDSVRRQLQH-GLSYGAPTALETEMAELVCS
GSA_PSE14       VTDEDDKRYVDYVGSWGPMILGHSHPE-VLDAVRSQLEH-GLSYGAPTAMETEMADLVCA
GSA_PSEU2       VTDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRSQLEH-GLSYGAPTAMETEMADLVCE
GSA_PSESM       VTDEDDKRYVDYVGSWGPMILGHSHPD-VLDAVRNQLEH-GLSYGAPTAMETEMADLVCE
GSA_PSEU5       VIDEDDKRYVDYVGSWGPMILGHSHPQ-VLDAVRRQLEH-GLSYGAPTAMETEMAELVCR
GSA_ACIB5       LWDVDGKRYVDYVGSWGPMILGHAHPD-IIKAVQTAAED-GLSFGAPTVHETTLADIICE
GSA_ACIB3       LWDVDGKRYVDYVGSWGPMILGHAHPD-IIKAVQTAAED-GLSFGAPTVHETTLADIICE
GSA_ACIBT       LWDVDGKRYVDYVGSWGPMILGHAHPD-IIKAVQTAAED-GLSFGAPTVHETTLADIICE
GSA_ACIBY       LWDVDGKRYVDYVGSWGPMILGHAHPD-IIKAVQTAAED-GLSFGAPTVHETTLADIICE
GSA_ACIBC       LWDVDGKRYVDYVGSWGPMILGHAHPD-IIKAVQTAAED-GLSFGAPTVHETTLADIICE
GSA_ACIBS       LWDVDGKRYVDYVGSWGPMILGHAHPD-IIKAVQTAAED-GLSFGAPTVHETTLADIICE
GSA_ACIAD       LWDEDDKRYVDYVGSWGPMILGHAHPD-IIQAVQTAAVD-GLSFGAPTVHETTLADIICD
GSA_PSYA2       IYDTEDNAYIDYVGSWGPMILGHAHPK-VIDAVKKAADD-GLSFGTPTPFETTVADKICE
GSA_PSYCK       IYDTEDNAYIDYVGSWGPMILGHAHPK-VIDAVKKAADD-GLSFGTPTPFETTVADKICE
GSA_RUTMC       LFDEDDKKYIDYVASWGSMILGHTNQA-VIIAVKTTLEN-GLGFGAPTQIETKLAEKVCE
GSA_VESOH       LFDVDGNKYIDYVASWGPMILGHANQE-VINAIKTNLEN-GLSFGAPTHIETMLAEKVCE
GSA_HAHCH       LYDEDGKRYIDYVGSWGPMILGHAHPD-VRQALERQLAN-GLGFGAPTRIEIDMAEKVCE
GSA_MARHV       LYDEDDRRYIDFIGSWGPMILGHSDPR-IKAALHAQVDL-GVGYGAPTAIETEMAKKVCE
GSA_MARMS       VYDEDKKRYIDYVGSWGPMILGHSHPD-VLDAVRQQLDF-GLSFGAPTEVEITMAEKVCE
GSA_HYDCU       LTDADGKQYIDYVASWGPAILGHTHPD-VIKAVQTQAEK-GLSFGAPTEIETTMADMVCD
GSA_ALKEH       LYDEDGNRYVDYVCSWGPMVAGHAHPK-VVRAVQAAAAD-GLSFGAPTEVEIRMAEKLKA
GSA_HALHL       MWDVDGKRYVDYVCSWGPLVAGHADPE-IVRRVQETAAK-GLSFGTPVELEVEMARTLCQ
GSA_STRMK       LYDVDGNRYIDYVGSWGPMIVGHNHPA-VRQAVKKAIDN-GLSFGAPCAGEVTMAETITR
GSA_STRM5       LYDVDGNRYIDYVGSWGPMIVGHNHTA-VRQAVKKAIDN-GLSFGAPCAAEVTMAETITR
GSA_XANCH       LFDVDDNRYIDYVGSWGPMIAGHNHPA-VREAVEQSIRN-GLSFGAPCAAEVTMAQTIAR
GSA_XANC5       LFDVDDNRYIDYVGSWGPMIAGHNHPA-VREAVERAIGN-GLSFGAPCAAEVTMAQTITR
GSA_XANAC       LFDVDDNRYIDYVGSWGPMIAGHNHPA-VREAVEQSIRN-GLSFGAPCAAEVAMAQTITR
GSA_XANOR       LFDVDGNRYIDYVGSWGPMIAGHNHPA-VREAVERAIRD-GLSFGAPCAAEVTMAETITG
GSA_XANOM       LFDVDGNRYIDYVGSWGPMIAGHNHPA-VREAVERAIRD-GLSFGAPCAAEVTMAETITG
GSA_XANCP       LFDVDGNRYIDYVGSWGPMIAGHNHPA-VREAVERAIRD-GLSFGAPCEAEVTMAETITR
GSA_XANC8       LFDVDGNRYIDYVGSWGPMIAGHNHPA-VREAVERAIRD-GLSFGAPCEAEVTMAETITR
GSA_XANCB       LFDVDGNRYIDYVGSWGPMIAGHNHPA-VREAVERAIRD-GLSFGAPCEAEVTMAETITR
GSA_XYLF2       LFDVDGHRYIDYVGSWGPMIVGHNHPA-VREAVQVAISN-GLSYGAPCAAEVTMAETIAR
GSA_XYLFT       LFDVDGHRYIDYVGSWGPMIVGHNHPA-VREAVQVAISN-GLSYGAPCAAEVTMAETIAR
GSA_XYLFM       LFDVDGHRYIDYVGSWGPMIVGHNHPG-VREAVQVAISN-GLSYGAPCAAEVTMAETIAR
GSA_XYLFA       LFDVDGHRYIDYVGSWGPMIVGHNHPA-VREAVQVAISN-GLSYGAPCAAEVTMAETIAR
GSA_CHRSD       LYDVEGQRYIDYVGSWGPLITGHADPD-VLGAVRSRLDD-GLSFGTPTAIETRMAELICE
GSA_NITOC       LYDVDDNRYIDYVNSWGPLIVGHTHPE-VVAAVQEAAAQ-GLGFGAPTATEIEMAETLCR
GSA_THISH       MYDADGKRYIDYVGSWGPMIAGHAHPE-VVEAVREAARG-GLSFGAPTEIEIRMAERVCE
GSA_ACISJ       MWDANGQRFIDYIGSWGPMILGHGHPA-VLEAVQKAALE-GFSFGAPTEREVELAEEIIR
GSA_ACIET       MWDANGQRFIDYIGSWGPMILGHGHPA-VLEAVQKAALE-GFSFGAPTEREVELAEEIIR
GSA_ACIAC       FWDANGQRFIDYIGSWGPMILGHGHPA-VLEAVQKAALD-GFSFGAPTEREVELAEEILR
GSA_VEREI       FWDANDQRFIDYIGSWGPMILGHGHPA-VLEAVQQAALE-GLSFGAPTERELELAEAILR
GSA_RHOFT       FWDANNQRYTDFIGSWGPMILGHGHPA-VVEAVQAAVLE-GFSYGAPTEREVELAEEILR
GSA_LEPCP       MWDAEGKQYIDYIGSWGPMILGHGHPA-VLAAVQKAATE-GFSFGAPTEREVELAETILA
GSA_AZOSB       VWDADGKAYIDYVGSWGPAIAGHSHPA-IVEAVREAALR-GLSFGAPTESEVEMAELLCA
GSA_AROAE       VWDADGKAYVDYVGSWGPAIAGHAHPA-IVEAVREAALA-GLSFGAPSEAEVDIAELICE
GSA_BORBR       VWDAEGKQYIDYVGSWGPAILGHAHPE-VVRAVQEAAVH-GLSFGAPTEAEVELAEMLIA
GSA_BORPA       VWDAEGKQYIDYVGSWGPAILGHAHPE-VVRAVQEAAVH-GLSFGAPTEAEVELAEMLIA
GSA_BORPE       VWDAEGKQYIDYVGSWGPAILGHAHPE-VVRAVQEAAVH-GLSFGAPTEAEVELAEMLIA
GSA_BORPD       VWDEEDTRYIDYVGSWGPAILGHAHPD-VVQAVREAALD-GLSFGAPTRAEVELAEVLIE
GSA_BORA1       IWDADGKQYIDYLGSWGPAILGHAHPE-VVRAVQDAATG-GLSFGAPTEAEVELAELLIQ
GSA_BURCM       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLSAVQNVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURA4       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLSAVQKVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURL3       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLSAVQNVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURCA       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLSAVQNVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURCH       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLSAVQNVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURCC       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLSAVQNVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURCJ       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLSAVQNVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURVG       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLAAVQRVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURM1       FWDADGKQYIDYIGSWGPMIVGHVHPE-VLDAVQKVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURMA       FWDADGKRYIDYIGSWGPMIVGHVHPD-VLAAVQRVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURP1       FWDADGKRYIDYIGSWGPMIVGHVHPD-VLAAVQRVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURPS       FWDADGKRYIDYIGSWGPMIVGHVHPD-VLAAVQRVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURM9       FWDADGKRYIDYIGSWGPMIVGHVHPD-VLAAVQRVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURP0       FWDADGKRYIDYIGSWGPMIVGHVHPD-VLAAVQRVLAD-GFSFGAPTEAEIEIAEEICK
GSA_BURTA       FWDADGKRYIDYIGSWGPMIVGHVHPD-VLAAVQRVLAD-GFSFGAPTEAEIEIAEEICK
GSA_PARPJ       FWDADGQRYIDYIGSWGPMILGHVHPE-VLEAVQRVLGN-GFSFGAPTESEVEIAEEICK
GSA_PARXL       FWDADGQRYIDYIGSWGPMILGHVHPE-VLEAVQRVLGN-GFSFGAPTESEVEIAEEICK
GSA_PARP8       FWDAEGKRYIDYIGSWGPMIVGHVHPE-VLEAVQRVLSK-GFSFGAPTEAEIEIAEEICK
GSA_CUPTR       MWDADGQRYIDYIGSWGPMIVGHAHPE-VVRAVQETAAH-SFSFGAPTEAEITMAEEICK
GSA_CUPNH       MWDADGQRYIDYIGSWGPMIVGHAHPE-VVRAVQETAAH-SFSFGAPTEAEITMAEEICK
GSA_CUPPJ       MWDADGQRYIDYIGSWGPMIVGHAHPD-VVRAVQETAAH-SFSFGAPTEAEIDMAEEICK
GSA_CUPMC       MWDADGQRYIDYIGSWGPMIVGHAHPD-VVRAVQETATQ-SFSFGAPTEAEIDMAEEICK
GSA_RALPJ       LWDADGTRYIDYVGSWGPMIVGHAHPE-VVRAVQEVAAD-SFSFGAPTEAEVVMAEEICK
GSA_RALSO       LWDADGTRLIDYVGSWGPMIVGHAHPE-VVRAVQQVAAD-SFSFGAPTEAEVVMAETLCE
GSA_HERAR       FWDADDRRYIDYIGSWGPAIVGHAHPD-VVKAVQDAATR-GLSFGAPTEGEIRMAELICQ
GSA_JANMA       FWDADDRRYIDYIGSWGPAIVGHAHPD-VVKAVQDAATR-GLSFGAPTEAEIEMAELICR
GSA_CHRVO       FWDADGKQYLDYVGSWGPAIVGHAHPE-VVKAVQDAAVG-GLSFGAPTEGEVVIAEEICK
GSA_LARHH       MWDADDRRLIDYIGSWGPMILGHAHPA-VVEAVQQAAVH-GLSFGTPTEAEIGIAEEICK
GSA_NEIG1       VWDENGTRYTDYVGSWGPAIVGHAHPE-VVEAVREAALG-GLSFGAPTEGEIAIAEQIAE
GSA_NEIG2       VWDENGTRYTDYVGSWGPAIVGHAHPE-VVEAVREAALG-GLSFGAPTEGEIAIAEQIAE
GSA_NEIM0       VWDENGTRYTDYVGSWGPAIVGHAHPE-VVEAVREAALG-GLSFGAPTEGEIAIAEQIAK
GSA_NEIMF       VWDENGTRYTDYVGSWGPAIVGHAHPE-VIEAMREAALG-GLSFGAPTEGEIVIAEEIAK
GSA_NEIMA       VWDENGTRYTDYVGSWGPAIVGHAHPE-VIEAVREAALG-GLSFGAPTEGEIAIAEEIAK
GSA_NEIMB       VWDENGTRYTDYVGSWGPAIVGHAHPE-VVETVCEAALG-GLSFGAPTEGEIVIAEEIAK
GSA_NITEU       FWDVEGKSYIDYVGSWGPLILGHAHPD-VVRAVQIAAGH-GTSFGAPTAAELEIAELLCR
GSA_NITEC       FWDVEGKSYIDYVGSWGPLILGHAHPD-VVRAVQDAASR-GTSFGAPTAAELEIAELLCR
GSA_NITMU       AWDADDKSYIDYVGSWGPLILGHAHPE-VVDAVYAAAKN-GLTFGAPTEAELEIAELLCR
GSA_DECAR       VQDADGKWYTDYVGSWGPMILGHAHPD-VIAAVQAAVVD-GLSFGAPTEKEVDIADLLCE
GSA_METFK       LWDEDGKEYIDYVGSWGPMILGHAQPD-VIAAVQATAAN-SLSFGAPTALELEMAQLITQ
GSA_THIDA       VWDADGREYIDYVGSWGPAILGHAHPG-TVKAVQDAAAN-GLSFGAPSEAELTIATRITE
GSA_SACD2       LYDINDKRYVDYVLSWGPMILGHADDD-VLAAVTEKLQY-GLSFGAPTEIETELAKKICN
GSA_COXBU       LIDVDEKKYIDYVGSWGPMILGHAHPA-VIQAAQEAVQN-GLSFGAPCENEIKLAALIGE
GSA_COXBR       LIDVDEKKYIDYVGSWGPMILGHAHPA-VIQAAQEAVQN-GLSFGAPCENEIKLAALIGE
GSA_COXB2       LIDVDEKKYIDYVGSWGPMILGHAHPA-VIQAAQEAVQN-GLSFGAPCENEIKLAALIGE
GSA_COXB1       LIDVDEKKYIDYVGSWGPMILGHAHPA-VIQAAQEAVQN-GLSFGAPCENEIKLAALIGE
GSA_COXBN       LIDVDEKKYIDYVGSWGPMILGHAHPA-VIQAAQEAVQN-GLSFGAPCENEIKLAALIGE
GSA_FRATF       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEAIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRATO       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEAIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRATH       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEAIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRATM       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEVIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRATW       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEAIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRATT       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEAIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRAT1       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEAIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRATN       LYDVDWNKYIDYIGSWGPMILGHCDDD-VLEAIQCQVKN-GLSYGAPCKQEVDLAKKIIE
GSA_FRAP2       LYDVDWNKYIDYIGSWGPMILGHGDDD-VLEAIQCQLKN-GLSYGAPCKQEIELAKKIVE
GSA_LEGPC       LTDVDDKQYIDYVGSWGPLILGHCHPK-VIEAVDNVLHS-GMSFGAPTELEIQLAEKIAS
GSA_LEGPH       LTDVDDKQYIDYVGSWGPLILGHCHPK-VIEAVDNVLHR-GMSFGAPTELEIQLAEKIAS
GSA_LEGPL       LTDVDDKQYIDYVGSWGPLILGHCHPK-VIEAVDNVLHS-GMSFGAPTELEIQLAEKIAS
GSA_LEGPA       LTDVDDKQYIDYVGSWGPLILGHCHPK-VIEAVDNVLHS-GMSFGAPTELEIQLAEKIAS
GSA_CAMC1       LYDVEGKKYLDFIQSWGPLIFGHCDKD-IEEAIISAVKQ-GVSYGAPSPKETALAKLICD
GSA_CAMC5       IYDIEGKKYLDFIQSWGPLIFGHCDAD-IEKAVIEAVKK-GLSFGAPTLVETTLAKILCE
GSA_CAMFF       LYDIEGNEYIDYVLSWGPLIFGHCDSD-IEEAVIKTAKK-GLSFGAPCLLETALAKLVLS
GSA_CAMHC       IYDIEGNKYLDFVQSWGPLIFGHADKD-IQDAVIKTAKS-GLSFGASSPLETKLAKLILS
GSA_CAMJE       IFDIDGNSYIDYVQSWGPLLFGHCDKD-IQKACQKALHK-GSSFGAPTLLETELAKLVLS
GSA_CAMJ8       IFDIDGNSYIDYVQSWGPLLFGHCDKD-IQKACQKALHK-GSSFGAPTLLETELAKLVLS
GSA_CAMJJ       IFDIDGNSYIDYVQSWGPLLFGHCDKD-IQKACQKALHK-GSSFGAPTLLETELAKLVLS
GSA_CAMJR       IFDIDGNSYIDYVQSWGPLLFGHCDKD-IQKACQKALHK-GSSFGAPTLLETELAKLVLS
GSA_CAMJD       IFDIDGNSYIDYVQSWGPLLFGHCDKD-IQKACQKALHK-GSSFGAPTLLETELAKLVLS
GSA_HELPH       LYDVDNNHYIDFVQSWGPLIFGHADEE-IEENIINTLKK-GTSFGAPTELETTLAKEIIS
GSA_HELP2       LYDVDNNHYIDFVQSWGPLIFGHADEE-IEENIINTLKK-GTSFGAPTELETTLAKEIIS
GSA_HELPG       LYDVDNNHYIDFVQSWGPLIFGHADEE-IEKNIINTLKK-GTSFGAPTELETTLAKEIVS
GSA_HELPS       LYDVDNNHYIDFVQSWGPLIFGHADEE-IEENIINVLKK-GTSFGTPTELETTLAKEIIS
GSA_HELPJ       LYDVDNNHYIDFVQSWGPLIFGHADEE-IEENIINVLKK-GTSFGAPTELETTLAKEIIS
GSA_HELPY       LYDVDNNHYIDFVQSWGPLIFGHADEE-IEENIINALKK-GTSFGAPTELETTLAKEIIS
GSA_HELAH       LYDVDNNHYIDFVQSWGPLIFGHADEE-IEENIIKALKK-GTSFGAPTELETTLAKEIIS
GSA_HELHP       IYDEDDNEYIDFVQSWGPLIFGHANEV-IESALSLAIKD-GLSFGAPTEKETTLVKQIIA
GSA_WOLSU       LVDEDGNRYIDFVQSWGPLLFGHADLD-IQKAVEEAIKR-GLSFGAPTTSETLLAKEIIA
GSA_SULDN       LTDIDGNRYVDFVQSWGPLLFGHRDES-IESAVIEAVKH-GLSFGAPTQAESDLAALVIS
GSA_SULNB       LFDIDGNRYIDYVQSWGPLIFGHTDAD-IEASVIDSVKK-GLSFGAPTTVETELAEEIVL
GSA_STRSV       LHDVDGNRYIDYVLSWGPMILGHAPKD-VLPAVEEAIWE-GTSFGAPSPREIALGQLVQE
GSA_CHLP8       MTDVDGNTYLDYVGSWGPFILGSMHPR-LTAAIEYTLRNIGTSFGTPIEIEIEIAELLCQ
GSA_CHLTE       MTDVDGNTYLDYVGSWGPFILGSMHPR-VTAAIEYTLRNIGTSFGTPIELEIEIAELLCK
GSA_CHLL2       MTDVDGNTYLDYVGSWGPFILGSMQPR-VTAAIEYTLRNIGSSFGTPIEMEIEIAELLSR
GSA_CHLCH       MTDVDGNTYLDYVGSWGPFILGSMHPR-ITAALEYTLKNIGTSFGTPIEMEIEIAELLCQ
GSA_PELPB       MTDVDGNTYLDYVGSWGPFILGSMHPR-ITAALEYTLKNIGTSFGTPIEMEIEIAELLCK
GSA_CHLPD       LTDVDGNSYLDYVGSWGPFILGSMHPR-ITAALEYTLKNIGTSFGTPIEMEIEIAELLCK
GSA_CHLPB       MTDVDGNTYLDYVGSWGPFILGSMHPR-ITAAIENTLTKIGTSFGTPIEMEIEIAELLTQ
GSA_PROA2       MTDVDGNTYLDYVGSWGPFILGSMHPR-ITAALEHTLTKIGTSFGTPIEMEIEIAELLCQ
GSA_PELLD       MTDVDGNTYLDYVGSWGPFILGSMHPR-ITAALEHTLTKIGTSFGTPIEMEIEIAELLTK
GSA_CHLPM       MTDVDGNTYLDYVGSWGPFILGSMHPR-ITAALERTLTTIGTSFGTPIEMEIEIAELLVE
GSA_CHLT3       MIDVDGNSYIDYVGSWGPFILGHSHPR-VIEAIERTMKAHGTSFGAPTELEIELAELIIK
GSA_CYTH3       LVDEDDNQYIELINSWGPMILGHGNEL-IEKAVRDALSN-SLSFGAPSRKEVEMAELIVS
GSA_SALRD       LEDADANEYLDYVGSWGPMIFGHAHPD-VVEAVKDQAEA-STSFGAPTEIEIEVADLVCD
GSA_HUNT2       IYDADGNEYIDYVGSWGPMILGHSHPR-VLEAVSKTMVD-GLSFGAATELEVQMAELITE
GSA_FLAJ1       LYDEDGNKLIDYINSWGPMVLGHAYQP-VVDAVIEKAKL-GTSFGMPTELETEIAALAVS
GSA_FLAPJ       VYDEDGNRFVDYINSWGPMILGHAYEP-VVTAVIEKAKS-GTSFGMPTELETEIAKLAVS
GSA_GRAFK       IYDEDGNKLIDYINSWGPLILGHAHKP-VIDAVIEKAKK-GTSFGTPTEIETKIAELAVK
GSA_WIGBR       IFDVDNNKYIDYICSWGASILGHNNYY-ITSKIIEYSKK-GLNFGLLTEIEIKIARLISK
GSA_CHLTR       FVDSLDKTFIDFCGSWGSLIHGHSHPK-ICTAIRQGLER-GSSYGLTSEQEILFAEEIFS
GSA_CHLTA       FVDSLDKTFIDFCGSWGSLIHGHSHPK-ICAAIRQGLER-GSSYGLTSEQEILFAEEIFS
GSA_CHLT2       FIDSLDKTFIDFCGSWGSLIHGHSHPK-ICAAIRQGLER-GSSYGLTSEQEILFAEEIFS
GSA_CHLTB       FIDSLDKTFIDFCGSWGSLIHGHSHPK-ICAAIRQGLER-GSSYGLTSEQEILFAEEIFS
GSA_CHLMU       FTDSQGKTYIDFCGSWGSLIHGHSHPY-ICEAIQQGLQR-GCSYGLTSEQEISFAEEIFS
GSA_CHLFF       FIDSFGNNFIDFCGSWGSLIHGHSHPK-ILDAICNAASH-GTSYGLTSENEISLASTLFS
GSA_CHLCV       FIDSFGKNFIDFCGSWGSLIHGHSHPK-ILDALCSAASQ-GTSYGLTSENEISLATTLFS
GSA_CHLAB       FIDSFGKTFIDFCGSWGSLIHGHGHPK-ILDVICNSASQ-GTSYGLTSENEISLAATLFS
GSA_CHLPN       FLDTHGREFIDFCGGWGALIHGHSHPK-IVKAIQKTALK-GTSYGLTSEEEILFATMLLS
GSA_PARUW       LVDVDGKTYVDYCGSWGALIHGHAHPS-ILEAVQQRMKK-GTSFGITTSIEGELAQEVIK
GSA_LEPIN       LTDISGKEYIDYCLSFGPLILGHRDPE-VEEVVRETTEI-AWSFGAAEPYSLELAELISS
GSA_LEPIC       LTDISGKEYIDYCLSFGPLILGHRDPE-IEEVVRETTEI-AWSFGAAEPYSLELAELISS
GSA_LEPBL       LTDVSGKEYVDFCLSFGPLILGHRDPE-VEEVVRETAGL-AWSFGTAEPYSLELAEFITN
GSA_LEPBP       LKSVEGNDFIDYCLSFGPLLFGHRHPE-IQEVVEDTVNK-AWSFGACEPYSLELAEFITE
GSA_BDEBA       LTSVEDKKYIDFCQSFGPLILGHLDAE-VKEEVHRMVDT-AWTFGATEIYSLELAEWITS
GSA_FUSNN       IWDEDDNEYIDYICSWGPLILGHNHPK-VIEEVKKIIEN-GSSYGLPTKYEVDLAELIVD
GSA_METI4       ITDVDGNDYTDYVCSWGALIHGHAHPA-VVRAVGEALKD-GTSYGANSPLEIKLARLIQS
GSA_AERPE       LYTVDGARIVDLVLAYGPLILGHKHPR-VLEAVEEALAR-GWLYGAPGEAEVLLAEKILG
GSA_HYPBU       IYTVDGEKLIDYVLAYGPLILGHKHPR-VEEAVRRQLEK-GWLYGAPYELEIRLAEKILK
GSA_SULAC       LYTADNKQLIDYVLGYGPLILGHANQY-VTKKIIEQVNK-GWLYGTPSPIEIELARKISH
GSA_SULTO       LYTIDGQRLIDYVLGYGPLILGHAHPY-VKKKIIEQIEK-GWLYGTPSKKEIELAEKIRS
GSA_SACS2       IYTVDGKKFIDYVLGYGPLILGHSPES-VKRRIVEQLER-GWLFGTPSELEIELARKIRS
GSA_PYRAE       LYTDRG-KLVDYCMAFGAIILGHAHPR-VKKAVEEQLEK-GWIYALLTEQEVEFAERIRR
GSA_PYRCJ       LYTDRG-RLVDFCLAFGAIILGHAHPK-VRRAVEEQLAR-GWIYALLTEEEVLFAEKIRA
GSA_THEAC       IYDVDGNEYIDYCLAYGPSILGHADPD-VVRAVRDQAEK-GLIYGAPSEAEIRLGDIIRR
GSA_THEVO       ILDVDGNKYIDYCLGYGPLILGHSDPD-VTRAVIEQAEK-GLLFGEPSENEIKLAEMIKE
GSA_PICTO       IYDVNGKEYIDYSLGFGPMILGHADPD-VASAIKRQADN-GILFGSITENEVRLGNIIKN
GSA_ARCFU       IYDVDGNAYIDYCMAYGPLVLGHANEV-VKNALAEQLER-GWLYGTPIELEIEYAKLIQK
GSA_METAR       ITDVDGNEYIDCCLAYGPLILGHGHPA-VKEAITKQLEN-GCLYGTPSEIEVKYGKLIQK
GSA_METAC       IRDLDGNEYIDYCLAYGPAVLGHNHPV-IKAAIKEQLDK-GWLYGTPTELEVTLAEKVAG
GSA_METMA       IRDLDGNEYIDYCLAYGPAILGHNHPV-IKEAIRQQLDR-GWLYGTPTELEVTLAEKVAS
GSA_METBF       IKDLDGNEYIDYCLAYGPALLGHNHPV-IKEAIKAQLDK-GWLYGTPTELEVNLAEKIAG
GSA_METJA       LFDVDGNCYIDYCLAYGPMVLGHANDA-VIKAVKEQLEL-GSAYGCPTEKEIILAKEVVK
GSA_METMP       LYDEDGNEFIDYCLAYGPMVLGHANEN-ILNAVKSQMDL-GTAYGVPSEKEITLAKEVIN
GSA_METST       IYDVDGNEYIDYCLGYGPLLFGHANEH-IIEKSIEQLKL-GTDYGVPSEKEVQLAKEVIK
GSA_METTH       LESVDGESYIDYCLAYGPLILGHAHPR-VVEAVNEQIKR-GTTYGVPTEGEIELAEAIIE
GSA_METKA       LYTVDGHVLIDYCLAFGPLILGHAHPE-VVEAVVERVRE-GFHYGTPTLPELKLAEKVVE
GSA_HALMA       VIDADGNRYIDFVMGYGPLLLGHSLPEQVQSAIQQHAAE-GPMYGAPTEVEVELAEFVTR
GSA_HALLT       VIDADGNRYVDWVMGYGPLLYGHDLPDPVQAAIQSHVAA-GPMYGAPTEIEVEHAEFVAR
GSA_HALSA       VIDADGNRYIDWVMGLGPLLLGHDLPQPVTAAIQRRASD-GPLFGTPTEIEVEHAEFVAR
GSA_HALS3       VIDADGNRYIDWVMGLGPLLLGHDLPQPVTAAIQRRASD-GPLFGTPTEIEVEHAEFVAR
GSA_NATPD       VIDADGNRYIDWIQGLGPLLLGHDMPEQLQAAVQSRASE-GPMYGMPSEIEVEHAEFVCR
                          :     *. : *                     :.     .         

GSA1_BACAN      AMPAL-----------DKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVL
GSA1_BACHK      AMPAL-----------DKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVL
GSA1_BACCR      AMPAL-----------DKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVL
GSA1_BACCZ      AMPAL-----------DKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVL
GSA1_BACC1      AMPAL-----------DKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVL
GSA1_BACLD      AIPAL-----------DKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVL
GSAB_BACSU      AIPAM-----------DKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVL
GSA1_GEOKA      AIPSL-----------EKVRFVNSGTEAVMTTIRVARAYTGRSKIVKFEGCYHGHSDLVL
GSA1_OCEIH      AIPSL-----------EKVRFNNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHFDAVL
GSA2_LISMO      AIPSL-----------EKVRFTNSGTEAVMTTIRVARAYTGRDKIIKFAGCYHGHFDLVL
GSA2_LISMF      AIPSL-----------EKVRFTNSGTEAVMTTIRVARAYTGRDKIIKFAGCYHGHFDLVL
GSA2_LISIN      AIPSL-----------EKVRFTNSGTEAVMTTIRVARAYTGRDKIIKFAGCYHGHFDLVL
GSA1_BACSK      AIPSL-----------EKVRFVNSGTEAVMTTIRVARAYTGKEKIIKFAGCYHGHSDLVL
GSA1_BACHD      AIPSL-----------EKVRFVNSGTEAVMTTIRVARAYTGRDKIIKFAGCYHGHSDLVL
GSA2_STAAC      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAA3      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAAR      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAAB      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAAS      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAAW      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAAM      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAAN      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAES      AVPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA2_STAEQ      AVPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIIKFAGSYHGHSDLVL
GSA1_STAS1      AIPSL-----------EKIRFVNSGTEAVMTTIRVARAYTKRNKIVKFAGQYHGHSDLVL
GSA_SYMTH       ALPSM-----------ERIRFVTTGTEAVMSAVRVARAFTGRPKIIKMEGCYHGHSDFAL
GSA_ACAM1       AVPSV-----------EVVRFVNSGTEACMSVLRLMRAFTGREKVIKFEGCYHGHADMFL
GSA_CYAP4       GVPSI-----------EMVRFVNSGTEACMAILRLMRAYTGREKIIKFEGCYHGHADMFL
GSA_NOSS1       AVPSI-----------EMVRFVNSGTEACMAVLRLMRAFTNREKVIKFEGCYHGHADMFL
GSA_TRIV2       AVPSI-----------EMVRFVNSGTEACMAVLRLMRAFTNREKVIKFEGCYHGHADMFL
GSA_NOSP7       AVPSI-----------EMVRFVNSGTEACMGVLRLMRAFTNRDKIIKFEGCYHGHADTFL
GSA_TRIEI       AVPSI-----------EMIRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFL
GSA_SYNE7       AVPSI-----------EMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFL
GSA_SYNP6       AVPSI-----------EMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFL
GSA_SYNP2       AVPSI-----------EMVRFVNSGTEACMSVLRLMRAFTGREKIIKFEGCYHGHADMFL
GSA_RIPO1       AVPSI-----------EMVRFVNSGTEACMSVLRLMRAFTGREKIIKFEGCYHGHADMFL
GSA_MICAN       AVPSI-----------EMVRFVNSGTEACMSVLRLMRAFTGRDKIIKFEGCYHGHADMFL
GSA_GLOC7       AVPSI-----------EMVRFVNSGTEACMSVLRLMRAYTNREKIIKFEGCYHGHADMFL
GSA_SYNY3       AVPSI-----------EMVRFVNSGTEACMSVLRLMRAFTGREKIIKFEGCYHGHADMFL
GSA_SYNJB       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAYTGREKVIKFEGCYHGHADMFL
GSA_SYNJA       AVPSV-----------EMVRFVNSGTEACMAALRLMRAYTGREKVIKFEGCYHGHADMFL
GSA_THEEB       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHADMFL
GSA_PROMA       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKLIKFEGCYHGHADMFL
GSA_PROM4       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKLIKFEGCYHGHADMFL
GSA_PROM1       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFL
GSA_PROMT       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFL
GSA_PROM3       AVPSV-----------EMVRFVNSGTEACMSVLRLMRAFTGRDKLIKFEGCYHGHADMFL
GSA_PROMM       AVPSV-----------EMVRFVNSGTEACMSVLRLMRAFTGRDKLIKFEGCYHGHADMFL
GSA_SYNS9       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFL
GSA_SYNPX       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFL
GSA_SYNSC       AVPSV-----------EMVRFVNSGTEACMAVLRLIRAYTGRDKVIKFEGCYHGHADMFL
GSA_SYNPW       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGHADMFL
GSA_PROMS       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFL
GSA_PROM0       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFL
GSA_PROM2       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFL
GSA_PROM9       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFL
GSA_PROMP       AVPSV-----------EMVRFVNSGTEACMAVLRLMRAFTGRDKVIKFDGCYHGHADMFL
GSA_GLOVI       AIPAV-----------EMVRFVNSGTEATMSALRLARAFTGREKIIKFEGCYHGHADMLL
GSA_CHLSY       LVPSI-----------EQIRFVNSGTEATMSALRLARAATGRRLIVKFNGCYHGHADMLL
GSA_CHLAA       LVPSI-----------EQIRFVNSGTEATMSALRLARAATGRRLIVKFNGCYHGHADMLL
GSA_CHLAD       LVPSI-----------EQIRFVNSGTEATMSALRLARAATGRRLIVKFNGCYHGHADMLL
GSA_ROSCS       AMPSV-----------EMVRFVSSGTEAAMSALRLARAATRRDKVIKFAGCYHGHFDGFL
GSA_ROSS1       AMPAV-----------EMVRFVSSGTEAAMSALRLARAATRRDKVIKFAGCYHGHFDGFL
GSA_HERA2       AVPSV-----------EMVRFVSSGTEAAMSAIRLARAYTQREKIIKFEGCYHGHADPFL
GSA_FRACC       RVGPV-----------EKVRLVNSGTEATMSAVRLARGFTGRSTIIKFAGCYHGHVDALL
GSA_FRASN       RVAPV-----------EQVRLVNSGTEATMSAIRLARGFTGRPTIVKFAGCYHGHVDALL
GSA_THEFY       RT-PV-----------EKVRLVNSGTEATMSAIRLARGATGRAKVVKFAGNYHGHVDALL
GSA_STRAW       RVEPV-----------EQVRLVSSGTEATMSAIRLARGFTRRAKVIKFAGCYHGHVDSLL
GSA_STRCO       RVAPL-----------EEVRLVSSGTEATMSAIRLARGFTRRTKVIKFAGCYHGHVDSLL
GSA_STRGG       RIEPV-----------EQVRLVSSGTEATMSAIRLARGFTGRAKVVKFAGCYHGHVDALL
GSA_MYCA1       RVAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALL
GSA_MYCPA       RVAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALL
GSA_MYCMM       RVAPV-----------ERLRLVNSGTEATMSAVRLARGFTGRSKIIKFSGCYHGHVDALL
GSA_MYCUA       RVAPV-----------ERLRLVNSGTEATMSAVRLARGFTGRSKIIKFSGCYHGHVDALL
GSA_MYCBO       RVAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALL
GSA_MYCTA       RVAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALL
GSA_MYCBT       RVAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALL
GSA_MYCBP       RVAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALL
GSA_MYCTU       RVAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALL
GSA_MYCLE       RMAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRTKIIKFSGCYHGHVDALL
GSA_MYCLB       RMAPV-----------ERIRLVNSGTEATMSAVRLARGFTGRTKIIKFSGCYHGHVDALL
GSA_RHOOB       RVAPV-----------EKVRLVNSGTEATMSAVRLARGFTGRTKVLKFSGCYHGHVDALL
GSA_RHOJR       RVAPV-----------EKVRLVNSGTEATMSAVRLARGFTGRTKVLKFSGCYHGHVDALL
GSA_NOCFA       RVAPV-----------DRVRLVNSGTEATMSAVRLARGFTGRTKIIKFAGCYHGHVDALL
GSA_ACIC1       RVPAV-----------EMIRLVNSGTEATMSALRLARAYTNRPLVVKFAGCYHGHVDALL
GSA_CORGL       RT-SV-----------EEVRLVNSGTEATMSAVRLARGYTQRSKILKFEGCYHGHVDALL
GSA_CORGB       RT-SV-----------EEVRLVNSGTEATMSAVRLARGYTQRSKILKFEGCYHGHVDALL
GSA_COREF       RT-SV-----------EEVRLVNSGTEATMSAVRLARGYTQRPKILKFDGCYHGHVDSLL
GSA_CORDI       RT-SV-----------EEVRMVNSGTEATMSAVRLARGFTGRPKVIKFDGCYHGHVDALL
GSA_CORA7       RT-AV-----------EQVRLVNSGTEATMSAVRLARGFTGRAKVLKFEGCYHGHVDALL
GSA_CORJK       RT-SV-----------EKARLVNSGTEATMSAIRLARGYTGRDKILKFEGCYHGHVDSLL
GSA_CLAM3       RVRVAGVDGSPDRRPIEKLRLVSTGTEATMTAIRLARGFTGRDLLVKFAGHYHGHSDSLL
GSA_CLAMS       RVRVAGVDGSPDRRPVEKLRLVSTGTEATMTAIRLARGFTGRDLLVKFAGHYHGHSDSLL
GSA_LEIXX       RVPF-----------VEKLRLVSTGTEATMTAIRLARGFTGRPLLIKFAGHYHGHSDSLL
GSA_KOCRD       RVAP-----------LEEIRMVSTGTEATMTALRLARGYTGRDLVVKFAGCYHGHVDSLL
GSA_CUTAK       RMAP-----------VEKVRFVSTGTEATMTAVRLARGATGRDVIVKFAGNYHGHSDVLL
GSA_PROFF       RMGGA----------IDKVRFTCSGTEAVMTAARLARGITKRPLLVKFVGCYHGHSDSFL
GSA_TROW8       RICNA-----QGIKPVERLRLVSTGTESCMTAIRLARCFTGRDLIVKFSGHYHGHADPFL
GSA_TROWT       RICNA-----QGIKPVERLRLVSTGTESCMTAIRLARCFTGRDLIVKFSGHYHGHADPFL
GSA_ANAD2       RMPWV-----------EKMRFVSSGTEATTSAIRVARGFTGRDDIVKFDGCYHGAGDPLL
GSA_ANASK       RMPWV-----------EKMRFVSSGTEATTSAIRVARGFTGRDDIVKFDGCYHGAGDPLL
GSA_ANADE       RMPWV-----------EKMRFVSSGTEATTSAIRVARGFTGRDDIVKFDGCYHGAGDPLL
GSA_ANADF       RMPWI-----------EKMRFCSSGTEATTAAIRVARGFTSRDDILKFEGCYHGAGDPLL
GSA_MYXXD       TMPAV-----------EMVRLVSSGTEATVAAIRVARGFTGREHILKFEGCFHGAGDPFL
GSA_CARHZ       AFPA-----------MDMVRMVNSGTEATMSAIRLARGFTGRNKIVKFEGCYHGHADSLL
GSA_PELTS       AVPS-----------IEMVRLVNSGTEAAMSALRLARGYTGRNKIVKFEGCYHGHADFLL
GSA_MOOTA       AMPA-----------VEMVRLVNSGTEATMSALRLARGYTGREKVVKFAGCYHGHADYFL
GSA_THERP       SVPA-----------IELVRFVNSGTEATMSAIRLARAVTGRNLVVKFAGCYHGHVDGLL
GSA_THET2       AYPF-----------VDLVRFVNSGTEATMSALRLARGYTNRPYIVKFRGNYHGHADGLL
GSA_THET8       AYPF-----------VDLVRFVNSGTEATMSALRLARGYTGRPYIVKFRGNYHGHADGLL
GSA_DEIRA       LTG------------AERVRFVSSGTEATMSALRLARGYTGRKFIVKFRGNYHGHADGLL
GSA_RHOBA       AVPS-----------IEKVRLVNSGTEATMSALRVARGATGRKKVIKFAGNYHGHVDSLL
GSA_SORC5       LYPS-----------IDMLRCVSSGTEATMSAIRVARGFTRRDAIIKFEGCYHGHADHLL
GSA_CALBD       T-AQI-----------DMVRFVNSGTEATMTAVRLAKGYTGKKKIVKFAGCYHGHHDIFL
GSA_CALS8       T-AQV-----------DMVRFVNSGTEATMTAIRLAKGYTGKKKIVKFAGCYHGHHDIFL
GSA_CLOAB       TVDNV-----------EMIRMVNSGTEATMSAVKLARGYTKRDKIIKFAGCYHGHFDGFL
GSA_CLOTE       TLDNI-----------DMVRMVNSGTEATMSAIKLARGYTRRDRIIKFAGCYHGHFDGFL
GSA_CLOBA       NLDNV-----------EMIRMVNSGTEATMSAVKLARGYTGKSKIVKFAGCYHGHFDGFL
GSA_CLOBB       NLDNV-----------DMIRMVNSGTEATMSAVKLARGYTGKSKIVKFAGCYHGHFDGFL
GSA_CLOB8       NLDNV-----------EMIRMVNSGTEATMSAVKLARGYTKRKRIVKFAGCYHGHFDGFL
GSA_CLOP1       TLDNV-----------DMIRMVNSGTEATMSAVKLARGYTKKDKIIKFAGCYHGHFDGFL
GSA_CLOPS       TLDNV-----------DMIRMVNSGTEATMSAVKLARGYTKKDKIIKFAGCYHGHFDGFL
GSA_CLOPE       TLDNV-----------DMIRMVNSGTEATMSAVKLARGYTKKDKIIKFAGCYHGHFDGFL
GSA_CLOK5       TMDNI-----------EMIRMVNSGTEATMSAVKLARGYTRRNKIIKFSGCYHGHFDDFL
GSA_AQUAE       MVPSV-----------EKVRFVNSGTEATMSAVRLARGVTGRKYIVKFEGCYHGHYDSLL
GSA_HYDS0       ASKVI-----------DKVRFVSSGTEAVMSAIRLARGITNKPYIIKFDGCYHGFSDSVL
GSA_PERMH       AVPSI-----------EMVRFVNSGTEATMSAIRLARGYTGKKKIVKFEGCYHGHVDSLL
GSA_SULSY       AVKSV-----------EMVRFVNSGTEATMSAIRLARGYTKRKKIIKFDGCYHGHGDSLL
GSA_DESVH       ALPGV-----------DMVRMVNSGTEATMSALRLARGYTGRTKLVKFVGCYHGHADPFL
GSA_DESVV       ALPGV-----------DMVRMVNSGTEATMSALRLARGYTGRTKLVKFVGCYHGHADPFL
GSA_DESVM       ALPGV-----------EMVRMVNSGTEATMSALRLARGVTGRNKVVKFVGCYHGHADAFL
GSA_DESAG       AVPSI-----------EMVRMVSSGTEATMSALRLARGYTGRNKLIKFEGCYHGHGDAFL
GSA_LAWIP       AFPGM-----------DMIRMVSSGTEATMSALRLARGVTGRNKVLKFIGCYHGHADPFL
GSA_SYNWW       AIPSV-----------EKVRMVNSGTEATMSAVRLARAFTGRNHIVKFEGCYHGHADHFL
GSA2_BACAN      RVPSI-----------EIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLL
GSA2_BACHK      RVPSI-----------EIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLL
GSA2_BACCZ      RVPSI-----------EIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLL
GSA2_BACCR      RVPSI-----------EIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLL
GSA2_BACC1      RVPSI-----------EIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLL
GSA2_BACLD      RVPSI-----------EIVRMVSSGTEATMSALRLARGYTGRNKIVKFEGCYHGHGDSLL
GSA_BACSU       RVPSV-----------EIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLL
GSA2_GEOKA      RVPSV-----------EIVRMVNSGTEATMSALRLARGYTKRNKIMKFEGSYHGHGDSLL
GSA2_BACSK      RVPSI-----------DVVRMVNSGTEATMSALRLARGYTGRNKILKFVGCYHGHGDSLL
GSA2_BACHD      RVPSI-----------EVVRMVNSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLL
GSA1_STAAU      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAAC      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAA8      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAA3      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAAM      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAAN      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAAR      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAAS      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAAW      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAAB      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLL
GSA1_STAES      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIIKFEGCYHGHSDSLL
GSA1_STAEQ      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIIKFEGCYHGHSDSLL
GSA2_STAS1      RVPSI-----------EKVRMVSSGTEATLDTLRLARGYTGRNKIVKFVGCYHGHSDSLL
GSA2_STAHJ      RVPSI-----------EKVRMVSSGTEATLAALRLARGYTGRNKIIKFEGCYHGHSDSLL
GSA2_OCEIH      RVPSI-----------EMVRMVNSGTEATMSAIRLARGYTDRDLILKFEGSYHGHGDSLL
GSA1_LISMO      RVPSI-----------EIVRMVSSGTEATMSAIRLARGYTKREKILKFEGSYHGHGDSLL
GSA1_LISMF      RVPSI-----------EIVRMVSSGTEATMSAIRLARGYTKREKILKFEGSYHGHGDSLL
GSA1_LISIN      RVPSI-----------EIVRMVSSGTEATMSAIRLARGYTKREKILKFEGSYHGHGDSLL
GSA_NATTJ       AVPSI-----------EMVRMVNSGTEATMSALRLARGYTGKNKIVKLTGCYHGHSDSLL
GSA_THEYD       AFPSI-----------EKLRFVNSGTEATMSAIRVARGFTKRNKVIKFEGCYHGHVDGLL
GSA_DESPS       AVPSI-----------EKVRFVSSGTEATMSAVRLARGYTGKNVIVKFDGCYHGHADSFL
GSA_SYNAS       AFPSM-----------EMIRMVSSGTEAVMSAIRLARGFTGRDKILKFEGCYHGHGDSLL
GSA_DESOH       AVPSI-----------EMVRMVNSGTEATMSAIRLARGITGRDGLVKFDGCYHGHADMLL
GSA_SYNFM       MVPSI-----------EMVRMVNSGTEATMSAIRLARGYTGRPGIIKFNGCYHGHGDCLL
GSA_GEODF       AVPSI-----------EMVRMVSSGTEATMSAIRLARGYTGRDKILKFSGCYHGHSDSLL
GSA_GEOUR       AVPSI-----------EMVRMVSSGTEATMSAIRLARGYTGRDKILKFSGCYHGHSDSLL
GSA_GEOBB       AVPSI-----------EMVRMVSSGTEATMSAIRLARGYTGRDNILKFSGCYHGHSDSLL
GSA_PELPD       AVPSI-----------EMVRMVSSGTEATMSAIRLARGYTGRDNIIKFSGCYHGHADSLL
GSA_GEOLS       AMPSI-----------EMVRMVSSGTEATMSAIRLARGYTGRDKILKFSGCYHGHADALL
GSA_GEOMG       AVPSI-----------EMVRMVSSGTEATMSAIRLARGYTGRDKIIKFSGCYHGHADSLL
GSA_GEOSL       AVPSI-----------EMVRMVSSGTEATMSAIRLARGYTGRDKIIKFSGCYHGHADALL
GSA_PELCD       AFPNM-----------ESVRMVSSGTEATMSAIRLARGVTGRDKILKFEGCYHGHADSLL
GSA_ECOL6       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOL5       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO45       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOK1       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO27       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOUT       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO81       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO24       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO8A       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO55       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOLC       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOSE       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOHS       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOLU       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO57       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO5E       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SHISS       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECO7I       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECODH       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOLI       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ECOSM       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SHIB3       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SHIBS       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SHIDS       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SHIFL       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SHIF8       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ESCF3       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALDC       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALSV       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALA4       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALTI       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALG2       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALNS       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALEP       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALPB       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALCH       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALPC       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALPA       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALPK       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALHS       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALTY       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_SALAR       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_CROS8       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTRRDKIIKFEGCYHGHADHLL
GSA_ENT38       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_KLEP3       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_KLEP7       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_YERPE       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERPP       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERPN       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERPG       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERPA       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERPS       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERPB       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERP3       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERPY       LVPTM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_YERE8       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLL
GSA_ERWT9       LVPTM-----------DMVRMVNSGTEATMSAIRLARGFTHRDKIIKFEGCYHGHADCLL
GSA_PECAS       LVPSM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_PHOLL       LVPSM-----------DMVRMVNSGTEATMSAIRLARGYTHRDKIIKFEGCYHGHADCLL
GSA_PROMH       LVPSM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLL
GSA_SODGM       LVPSI-----------ESVRMVNSGTEATMSTIRLARGYTGRDRVIKFEGCYHGHADGLL
GSA_ACTPJ       LVPSI-----------ELVRMVSSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHSDSLL
GSA_ACTP2       LVPSI-----------ELVRMVSSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHSDSLL
GSA_ACTP7       LVPSI-----------ELVRMVSSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHSDSLL
GSA_HAEPS       LVPSI-----------EMVRMVSSGTEATMSAIRLARGYTKRDKIIKFEGCYHGHSDSLL
GSA_ACTSZ       LIPSI-----------ELVRMVSSGTEATMSAIRLARGYTKRDKIIKFEGCYHGHSDSLL
GSA_HAES1       LVPSI-----------EMVRMVNSGTEATMSAIRLARGYTKRDKILKFEGCYHGHSDSLL
GSA_HISS2       LVPSI-----------EMVRMVNSGTEATMSAIRLARGYTKRDKILKFEGCYHGHSDSLL
GSA_PASMU       LVPSI-----------DMVRMVSSGTEATMSAIRLARGYTKRDKIIKFEGCYHGHADSLL
GSA_MANSM       LIPSM-----------EMVRMVSSGTEATMSAIRLARGYTNRDKIIKFEGCYHGHADSLL
GSA_AERHH       IVPSM-----------EQVRMVNSGTEATMSAIRLARGYTGRDKIVKFEGCYHGHADSLL
GSA_AERS4       IVPSM-----------EQVRMVNSGTEATMSAIRLARGYTGRDKIVKFEGCYHGHADSLL
GSA_SHEB8       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEB2       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEB5       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEB9       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEPC       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHESW       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHESM       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHESR       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHESA       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEON       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEHH       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEPA       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHESH       MVPSM-----------EQVRMVSSGTEATMSAIRLARGFTSRDKILKFEGCYHGHADCLL
GSA_SHEWM       MVPSM-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEPW       MVPSM-----------EQVRMVSSGTEATMSAIRLARGFTSRDKILKFEGCYHGHADCLL
GSA_SHELP       MVPSM-----------EQVRMVSSGTEATMSAIRLARGFTNRDKILKFEGCYHGHADCLL
GSA_SHEAM       MVPSM-----------DQVRMVSSGTEATMSAIRLARGYTKRDKILKFEGCYHGHADCLL
GSA_SHEDO       MVPSI-----------EQVRMVSSGTEATMSAIRLARGYTNRDKILKFEGCYHGHADCLL
GSA_SHEFN       MVPSI-----------EQVRMVSSGTEATMSAIRLARGFTNRDNILKFEGCYHGHADCLL
GSA_ALIF1       LVPSM-----------EQVRMVSSGTEATMSAIRLARGYTGRDKIMKFEGCYHGHADSLL
GSA_ALIFM       LVPSM-----------EQVRMVSSGTEATMSAIRLARGYTGRDKIMKFEGCYHGHADSLL
GSA_ALISL       LVPSM-----------EQVRMVSSGTEATMSAIRLARGYTGRDKIMKFEGCYHGHADSLL
GSA_VIBCH       LVPSM-----------EQLRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADSLL
GSA_VIBC3       LVPSM-----------EQLRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADSLL
GSA_VIBCM       LVPSM-----------EQLRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADSLL
GSA_VIBVU       LVPSM-----------EQLRMVSSGTEATMSAIRLARGFTGRDKILKFEGCYHGHADSLL
GSA_VIBVY       LVPSM-----------EQLRMVSSGTEATMSAIRLARGFTGRDKILKFEGCYHGHADSLL
GSA_VIBPA       LVPSM-----------EQIRMVSSGTEATMSAIRLARGFTGRDKIMKFEGCYHGHADSLL
GSA_VIBTL       MVPSM-----------EQLRMVSSGTEATMSAIRLARGFTGRDKILKFEGCYHGHADSLL
GSA_PHOPR       LVPSM-----------EQIRMVSSGTEATMSAIRLARGFTNRDKIIKFEGCYHGHADCLL
GSA_COLP3       LVPSM-----------ESLRMVSSGTEATMSAIRLARGYTGRDKILKFEGCYHGHADALL
GSA_PSEHT       LVPSI-----------EKVRMVSSGTEATMSAIRLARGFTGRDKILKFEGCYHGHADSLL
GSA_IDILO       IVPSI-----------EKVRMVNSGTEATMTAIRLARGYTGRDKILKFEGNYHGHADSLL
GSA_PSYIN       LVPSM-----------EQVRMVSSGTEATMSAIRLARGYTGRDKILKFEGNYHGHSDSLL
GSA_PSEA6       LVPSM-----------EMLRMVNSGTEATMSAIRLARGYTKRDKILKFEGCYHGHADALL
GSA_ACIF2       LVPGI-----------ESVRMTSSGTEAVMTAIRLARGYTGRDRIIKFEGNYHGHSDSLL
GSA_ACIF5       LVPGI-----------ESVRMTSSGTEAVMTAIRLARGYTGRDRIIKFEGNYHGHSDSLL
GSA_METCA       LMPSL-----------DRVRMVSSGTEATMSAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_PSEAE       MVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLL
GSA_PSEA8       MVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLL
GSA_PSEAB       MVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLL
GSA_PSEA7       MVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLL
GSA_PSEE4       IVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDAIIKFEGCYHGHSDSLL
GSA_PSEPW       LVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDAIIKFEGCYHGHSDSLL
GSA_PSEP1       IVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDAIIKFEGCYHGHSDSLL
GSA_PSEPK       IVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDAIIKFEGCYHGHSDSLL
GSA_PSEPG       LVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDAIIKFEGCYHGHSDSLL
GSA_PSEF5       IVPSM-----------EMVRMVSSGTEATMSAIRLARGFTGRDSIIKFEGCYHGHSDSLL
GSA_PSEPF       LVPSL-----------EMVRMVSSGTEATMSAIRLARGFTGRDSIIKFEGCYHGHSDSLL
GSA_PSEMY       LVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLL
GSA_PSE14       LVPSM-----------EMVRMVSSGTEATMSAIRLARGFTGRDSIIKFEGCYHGHSDSLL
GSA_PSEU2       LVPSM-----------EMVRMVSSGTEATMSAIRLARGFTGRDSILKFEGCYHGHSDSLL
GSA_PSESM       LVPSM-----------EMVRMVSSGTEATMSAIRLARGFTGRDSIIKFEGCYHGHSDSLL
GSA_PSEU5       LVPSM-----------EMVRMVSSGTEATMSAIRLARGYTGRDAIIKFEGCYHGHSDSLL
GSA_ACIB5       IMPSI-----------ELVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_ACIB3       IMPSI-----------ELVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_ACIBT       IMPSI-----------ELVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_ACIBY       IMPSI-----------ELVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_ACIBC       IMPSI-----------ELVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_ACIBS       IMPSI-----------ELVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_ACIAD       IMPSI-----------EMVRMTNSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_PSYA2       IVPSV-----------EMIRMTSSGTEATMSAIRLARGYTQRDKIVKFEGCYHGHSDSLL
GSA_PSYCK       IVPSV-----------EMIRMTSSGTEATMSAIRLARGYTQRDKIVKFEGCYHGHSDSLL
GSA_RUTMC       LMPSI-----------ELVRMVSSGTEATMSAIRLARGHTGRDKIIKFEGCYHGHSDSLL
GSA_VESOH       LIPSI-----------ELVRMVSSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHSDALL
GSA_HAHCH       LVPSI-----------EMVRMVNSGTEATMSAIRLARGFTGRDKIVKFEGCYHGHADSLL
GSA_MARHV       LVPSI-----------ELVRMVNSGTEATMSAIRLARGYTGRDKIVKFEGCYHGHVDSLL
GSA_MARMS       LVPSM-----------DMVRMVNSGTEATMSAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_HYDCU       LIPSM-----------DMVRMVSSGTEATMTAIRLARGYTGRDKIVKFEGCYHGHSDSLL
GSA_ALKEH       MLPSL-----------ERVRMVNSGTEATMSALRLARGHTGREKIIKFRGCYHGHVDALL
GSA_HALHL       HVPSL-----------EMVRLVNSGTEATMSALRLARGFTGRDKIVKFQGNYHGHVDALL
GSA_STRMK       LVPSC-----------EMVRMVNSGTEATLSAIRLARGATGRNRIVKFEGCYHGHGDSFL
GSA_STRM5       LVPSC-----------EMVRMVNSGTEATLSAIRLARGATGRNRIVKFEGCYHGHGDSFL
GSA_XANCH       LVPSC-----------EMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFL
GSA_XANC5       LVPSC-----------EMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFL
GSA_XANAC       LVPSC-----------EMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFL
GSA_XANOR       LVPSC-----------EMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFL
GSA_XANOM       LVPSC-----------EMVRMVNSGTEATLSAVRLARGATGRNRIIKFEGCYHGHGDSFL
GSA_XANCP       LVPSC-----------EMVRMVNSGTEATLSAIRLARGATGRNRIVKFEGCYHGHGDSFL
GSA_XANC8       LVPSC-----------EMVRMVNSGTEATLSAIRLARGATGRNRIVKFEGCYHGHGDSFL
GSA_XANCB       LVPSC-----------EMVRMVNSGTEATLSAIRLARGATGRNRIVKFEGCYHGHGDSFL
GSA_XYLF2       LVPSC-----------EMVRMVNSGTEATLSAIRLARGATGRNYIVKFEGCYHGHGDSFL
GSA_XYLFT       LVPSC-----------EMVRMVNSGTEATLSAIRLARGATGRNYIVKFEGCYHGHGDSFL
GSA_XYLFM       LVPSC-----------QMVRMVNSGTEATLSAIRLARGATGRNYIVKFEGCYHGHGDSFL
GSA_XYLFA       LVPSC-----------DMVRMVNSGTEATLSAIRLARGATGRNHIVKFEGCYHGHGDSFL
GSA_CHRSD       IMPSI-----------DMVRMVNSGTEATMSAIRLARGHTGRDKIVKFEGNYHGHSDSLL
GSA_NITOC       LVPSM-----------DLVRMVSSGTEATMSAIRLARGFTGRDKILKFEGCYHGHADSLL
GSA_THISH       LVPSM-----------DMVRMVSSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHGDSLL
GSA_ACISJ       HVPSM-----------EMIRLVSSGTEAGMSAIRLARGATRRNKIIKFNGCYHGHADSLL
GSA_ACIET       HVPSM-----------EMIRLVSSGTEAGMSAIRLARGATRRNKIIKFNGCYHGHADSLL
GSA_ACIAC       HVPSM-----------EMIRLVSSGTEAGMSAIRLARGATGRSRIIKFNGCYHGHADALL
GSA_VEREI       LLPSM-----------QMIRLVSSGTEAGMSAIRLARGATGRSKLIKFEGCYHGHADALL
GSA_RHOFT       LVPSM-----------DMVRLVSSGTEAAMSTIRLARGATGRSKLIKFEGCYHGHADALL
GSA_LEPCP       LVPSC-----------EQIRLVSSGTEAAMSAIRLARGATGRSKLIKFEGCYHGHADALL
GSA_AZOSB       LLPSI-----------EMLRLVSSGTEATMSAIRLARGFTGRDDIIKFEGCYHGHADSLL
GSA_AROAE       LMPSI-----------EMVRLVSSGTEATMSAIRLARGFTGRDAIVKFEGCYHGHADSLL
GSA_BORBR       RLPSL-----------EQVRLVSSGTEATMTAIRLARGATGRHKIIKFEGCYHGHSDSLL
GSA_BORPA       RLPSL-----------EQVRLVSSGTEATMTAIRLARGATGRHKIIKFEGCYHGHSDSLL
GSA_BORPE       RLPSL-----------EQVRLVSSGTEATMTAIRLARGATGRHKIIKFEGCYHGHSDSLL
GSA_BORPD       RLPSL-----------EQVRLVSSGTEATMTAIRLARGATGRAKIIKFEGCYHGHSDSLL
GSA_BORA1       RLPSM-----------EQVRLVSSGTEATMTAIRLARGATGRNKIIKFEGCYHGHSDSLL
GSA_BURCM       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURA4       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURL3       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURCA       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURCH       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURCC       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURCJ       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURVG       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURM1       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURMA       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURP1       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURPS       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURM9       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURP0       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_BURTA       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTGRSRIVKFEGCYHGHADSLL
GSA_PARPJ       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTNRSRIVKFEGCYHGHADSLL
GSA_PARXL       LVPSI-----------EQVRMVSSGTEATMSALRLARGFTNRTRIVKFEGCYHGHADSLL
GSA_PARP8       LVPSM-----------EQVRMVSSGTEATMSALRLARGFTDRSRIVKFEGCYHGHADSLL
GSA_CUPTR       LVPSI-----------EQVRLVSSGTEATMSALRLARGFTGRDLIIKFEGCYHGHADSLL
GSA_CUPNH       LVPSI-----------EQVRLVSSGTEATMSALRLARGFTGRDLIIKFEGCYHGHADSLL
GSA_CUPPJ       LVPSI-----------EQVRLVSSGTEATMSALRLARGFTGRDLIIKFEGCYHGHADSLL
GSA_CUPMC       LVPSI-----------EQVRLVSSGTEATMSALRLARGFTGRDLIIKFEGCYHGHADSLL
GSA_RALPJ       LVPSI-----------EQVRLVSSGTEATMSALRLARGFTGRDLIVKFEGCYHGHADSLL
GSA_RALSO       LVPSI-----------EQVRLVSSGTEATMSALRLARGFTGRDLIVKFEGCYHGHADSLL
GSA_HERAR       LVPSI-----------EQVRLVSSGTEAAMSALRLARGATGRDTIIKFEGCYHGHADSLL
GSA_JANMA       LVPSI-----------EQVRLVSSGTEAAMSALRLARGATGRDKIIKFEGCYHGHADSLL
GSA_CHRVO       LLPSV-----------EQVRLVSSGTEATMTAIRLARGFTGRDLIVKFEGCYHGHSDSLL
GSA_LARHH       LMPSI-----------ERVRLVSSGTEATMSAIRLARGFTGRDAIIKFEGCYHGHSDSLL
GSA_NEIG1       IMPSV-----------ERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLL
GSA_NEIG2       IMPSV-----------ERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLL
GSA_NEIM0       IMPSV-----------ERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLL
GSA_NEIMF       IMPSV-----------ERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLL
GSA_NEIMA       IMPSV-----------ERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLL
GSA_NEIMB       IMPSV-----------ERLRLVSSGTEATMTAIRLARGFTGRDKIIKFEGCYHGHSDSLL
GSA_NITEU       LLPSL-----------EMVRLVSSGTEAGMSAIRLARGYTGRNRIIKFEGCYHGHDDALL
GSA_NITEC       LLPSL-----------ELVRLVSSGTEAGMSAIRLARGYTGRNRIIKFEGCYHGHDDALL
GSA_NITMU       LVPSI-----------EQVRLVSSGTEATMSAIRLARGYTARNRIIKFEGCYHGHDDALL
GSA_DECAR       LVPSM-----------DMVRLVSSGTEATMSAIRLARGHTGRDVLIKFEGCYHGHSDGLL
GSA_METFK       LVPSM-----------EQVRLVSSGTEATMSAIRLARGFTSRSKILKFEGCYHGHADSLL
GSA_THIDA       LLPSV-----------EKVRLVSSGTEATMSAIRLARGFTGRSKFIKFEGCYHGHADFLL
GSA_SACD2       IMPGM-----------DKVRFVSSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHSDSLL
GSA_COXBU       FMPSI-----------EKVRMVNSGTEATMSALRLARGVTGRSKIIKFEGCYHGHADCLL
GSA_COXBR       FMPSI-----------EKVRMVNSGTEATMSALRLARGVTGRSKIIKFEGCYHGHADCLL
GSA_COXB2       FMPSI-----------EKVRMVNSGTEATMSALRLARGVTGRSKIIKFEGCYHGHADCLL
GSA_COXB1       FMPSI-----------EKVRMVNSGTEATMSALRLARGVTGRSKIIKFEGCYHGHADCLL
GSA_COXBN       FMPSI-----------EKVRMVNSGTEATMSALRLARGVTGRSKIIKFEGCYHGHADCLL
GSA_FRATF       LMPNI-----------EQVRFVNSGTEATISAIRLARAYTCRNKIIKFEGCYHGHADEFL
GSA_FRATO       LMPNI-----------EQVRFVNSGTEATISAIRLARAYTCRNKIIKFEGCYHGHADEFL
GSA_FRATH       LMPNI-----------EQVRFVNSGTEATISAIRLARAYTCRNKIIKFEGCYHGHADEFL
GSA_FRATM       LMPNI-----------EQVRFVNSGTEATMSAIRLARAYTCRNKIIKFEGCYHGHADEFL
GSA_FRATW       LMPNI-----------EQVRFVNSGTEATMSAIRLARAYTCRNKIIKFEGCYHGHADEFL
GSA_FRATT       LMPNI-----------EQVRFVNSGTEATMSAIRLARAYTCRNKIIKFEGCYHGHADEFL
GSA_FRAT1       LMPNI-----------EQVRFVNSGTEATMSAIRLARAYTCRNKIIKFEGCYHGHADEFL
GSA_FRATN       LMPNI-----------EQVRFVNSGTEATMSAIRLARAYTGRNKIIKFEGCYHGHADEFL
GSA_FRAP2       LMPNI-----------EQVRFVNSGTEATMSAIRLARAYTGRNKIIKFEGCYHGHADEFL
GSA_LEGPC       LMPSI-----------EKIRMVNSGTEATMTAIRLARGFTNKNKFIKFNGCYHGHSDSLL
GSA_LEGPH       LMPSI-----------EKIRMVNSGTEATMTAIRLARGFTNKNKFIKFNGCYHGHSDSLL
GSA_LEGPL       LMPSI-----------EKIRMVNSGTEATMTAIRLARGFTNKNKFIKFNGCYHGHSDSLL
GSA_LEGPA       LMPSI-----------EKIRMVNSGTEATMTAIRLARGFTNKNKFIKFNGCYHGHSDSLL
GSA_CAMC1       EFKQI-----------DKIRFVSSGTEATMSAIRVARGYAKKDGLIKFEGCYHGHSDALL
GSA_CAMC5       KFENL-----------DKIRFVSSGTEATMSAIRVARGYSKKDGLIKFEGCYHGHSDALL
GSA_CAMFF       KFPWL-----------GKIRFVSSGTEATMSAIRLARGYSKKNGIIKFEGCYHGHSDSLL
GSA_CAMHC       KFDWL-----------DKIRFVSSGTEATMSAIRLARGFSGKDKIIKFEGCYHGHSDSLL
GSA_CAMJE       DFPHL-----------EKIRFVSSGTEATMSAIRLARGFTKKDKILKFEGCYHGHSDSLL
GSA_CAMJ8       DFPHL-----------EKIRFVSSGTEATMSAIRLARGFTKKDKILKFEGCYHGHSDSLL
GSA_CAMJJ       DFPHL-----------EKIRFVSSGTEATMSAIRLARGFTKKDKILKFEGCYHGHSDSLL
GSA_CAMJR       DFPHL-----------EKIRFVSSGTEATMSAIRLARGFTKKDKILKFEGCYHGHSDSLL
GSA_CAMJD       DFPHL-----------EKIRFVSSGTEATMSAIRLARGFTKKDKILKFEGCYHGHSDSLL
GSA_HELPH       CYEGL-----------DKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLL
GSA_HELP2       CYEGL-----------DKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLL
GSA_HELPG       CYEGL-----------DKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLL
GSA_HELPS       CYEGL-----------DKVRLVSSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLL
GSA_HELPJ       CYEGL-----------DKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLL
GSA_HELPY       CYEGL-----------DKVRLVSSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLL
GSA_HELAH       CYDGL-----------DKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLL
GSA_HELHP       LSGSA-----------EKMRLVNSGTEATMSALRLARAYSNKDDIIKFEGCYHGHSDSLL
GSA_WOLSU       LYEGI-----------EKIRFTSSGTEATMSAIRLARGYTGRDDIIKFEGCYHGHSDALL
GSA_SULDN       MFDSI-----------EKIRFVSSGTEAVMSAIRLARGYTNCDDIVKFTGCYHGHSDSLL
GSA_SULNB       MFESI-----------DKVRFVSSGTEAVMSAIRLARGATGRDNILKFTGCYHGHSDSLL
GSA_STRSV       RLPFM-----------ERMRMVNSGTEATMSAIRVARGVTKRSKIVKFIGCYHGHSDSFL
GSA_CHLP8       IVPSL-----------EMVRMVNSGTEATMSAVRLARGYTGKDKIIKFEGCYHGHGDSFL
GSA_CHLTE       IVPSL-----------EMVRMVNSGTEATMSAVRLARGYTGKDKIIKFEGCYHGHGDSFL
GSA_CHLL2       IVPSI-----------EMVRMVNSGTEATMSAVRLARGYTGRDKIIKFEGCYHGHGDSFL
GSA_CHLCH       IVPSL-----------EMVRMVNSGTEATMSAVRLARGYTGRDKIIKFEGCYHGHGDSFL
GSA_PELPB       IVPSL-----------EMVRMVNSGTEATMSAVRLARGYTGRDKIIKFEGCYHGHGDSFL
GSA_CHLPD       IVPSL-----------EMVRMVNSGTEATMSAVRLARGYTGRDKIIKFEGCYHGHGDSFL
GSA_CHLPB       IVPSI-----------EMVRMVNSGTEATMSAVRLARGYTGRDKIIKFEGCYHGHGDSFL
GSA_PROA2       IVPSI-----------EMVRMVNSGTEATMSAVRLARGYTSRDKIIKFEGCYHGHGDSFL
GSA_PELLD       IVPSI-----------EMVRMVNSGTEATMSAVRLARGCTGRDKIIKFEGCYHGHGDSFL
GSA_CHLPM       IVPSI-----------EMVRMVNSGTEATMSAVRLARGCTGRDKIIKFEGCYHGHGDSFL
GSA_CHLT3       VVPSV-----------EMVRMVNSGTEATMSAIRLARGYTKREKIIKFEGCYHGHGDSFL
GSA_CYTH3       MVPSV-----------EMVRMVNSGTEATMSAIRVARGYTGKEKIIKFEGCYHGHGDSFL
GSA_SALRD       LVPSV-----------EKVRMVNSGTEATMSAARLARGYTGRDKIIKFEGNYHGHGDFFL
GSA_HUNT2       LVPSV-----------EMVRMVNSGTEAVMSAIRVARGYTKREKIIKFAGCYHGHADSML
GSA_FLAJ1       MVPNI-----------DKIRFVNSGTEACMSAIRLARGFTKRDKIIKFAGCYHGHSDSFL
GSA_FLAPJ       MVSNI-----------DKIRFVNSGTEACMSAIRLARGFTKRDKIIKFAGCYHGHSDSFL
GSA_GRAFK       MVPNI-----------DKIRMVNSGTEACMSAVRLARGFTGKEKIIKFAGCYHGHSDSFL
GSA_WIGBR       YIPSI-----------EMIRMVNSGTEATMSAIRLARSYTKKNKIIKFDGCYHGHADFLL
GSA_CHLTR       YLGLET---------NYKIRFMSTGSEATMTAVRLARGITGRPIIIKFLGCYHGHADTFL
GSA_CHLTA       YLGLET---------NYKIRFMSTGSEATMTAVRLARGITGRPIIIKFLGCYHGHADTFL
GSA_CHLT2       YLGLET---------NYKIRFMSTGSEATMTAVRLARGITGRPIIIKFLGCYHGHADTFL
GSA_CHLTB       YLGLET---------NYKIRFMSTGSEATMTAVRLARGITGRPIIIKFLGCYHGHADTFL
GSA_CHLMU       YLEISN---------DHKIRFMSTGSEATMTAVRLARGVTERPIIIKFSGCYHGHSDVFL
GSA_CHLFF       CLDLE----------DYKLRFVSSGTEATMTAVRLACGVTKCSIIVKFLGCYHGHADVLL
GSA_CHLCV       CLGLQ----------DHKLRFVSSGTEAAMTSVRLACGVTQRSVMIKFLGCYHGHADVLL
GSA_CHLAB       CLEFE----------DHKVRFVSSGTEATMTAVRLACATTGRSIMIKFLGCYHGHADVLL
GSA_CHLPN       SLKLK----------EHKIRFVSSGTEATMTAVRLARGITNRSIIIKFIGGYHGHADTLL
GSA_PARUW       LIDSV-----------EKIRFVSSGTEATMSAVRLARGYTNKEFIVKFNGNYHGHADFFL
GSA_LEPIN       RVPWA-----------EKVRFVNSGTEAVMSALRVARAATGREKILKFDGCYHGHLDSLL
GSA_LEPIC       RVPWA-----------EKVRFVNSGTEAVMSALRVARAATGREKILKFDGCYHGHLDSLL
GSA_LEPBL       RIPWA-----------EKVRFVNSGTEAVMSALRVTRAATGREKIFKFDGCYHGHLDALL
GSA_LEPBP       RIPWV-----------EKIRFVNSGTEAVMSALRVARAATGRNKILKFDGCYHGHLDQLL
GSA_BDEBA       TLPFM-----------EKLRFVSSGTEAVMSALRVARAATGRTKILKFEGCYHGHVDNLL
GSA_FUSNN       IVPSI-----------EKVRLTTSGTEATMSAVRLARAYTQRNKILKFEGCYHGHSDALL
GSA_METI4       AMPSI-----------EKIRFVNSGTEACMTAIRIARGVSGREKIMKFEGCYHGHSDSLL
GSA_AERPE       YVKRG-----------GMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVL
GSA_HYPBU       YYHPG-----------GMVRFVNTGTEATMTAIRLARGVTGRKYIVKFNGCYHGAHDAVL
GSA_SULAC       HLPSA-----------QKIRFVNSGTEATMLALRLARAYTGREKIIKFHGNYHGAHDYLL
GSA_SULTO       HIPSA-----------EKIRFVNSGTEATMLAIRLARGYTKREKILKFDGNYHGAHDYAL
GSA_SACS2       HIPSA-----------QKIRFVNSGTEATMAAIRLARGYTKRSKILKFSGNYHGAHDYAL
GSA_PYRAE       HMPSV-----------EKMRIVNTGTEATMSAIRAARGYTKRDVIIKFEGNFHGSHDYVL
GSA_PYRCJ       HVPSV-----------EKMRFVNSGTEATMNAVRLARGFTGRDYIIKFDGNFHGSHDYVL
GSA_THEAC       SSKNI-----------EMMRFTNSGTEATMHAIRLARAYTGRSIIVKMEGGFHGAHDYSL
GSA_THEVO       TSKNI-----------EMMRFTNSGTEATMHAIRLARAITGRKLIVKMEGGFHGAHDYSL
GSA_PICTO       HVKSI-----------EKMRFTNSGTEATMHAIRLARGYTKRKYILKMEGGFHGAHDYAL
GSA_ARCFU       YFPSM-----------EMLRFVNTGSEATMAALRVARGFTGRDKIVKVEGSFHGAHDAVL
GSA_METAR       YYPGM-----------QKLRFVNTGTEATMGAIRAARGFTGRDKIVKIEGGFHGAHDAVL
GSA_METAC       YYPSI-----------DMLRFVSTGTEATMSALRLARGFTRKNKFIKIEGGFHGAHDAVL
GSA_METMA       YYPSI-----------DMLRFVSTGTEATMSALRLARGFTRRNKFIKIEGGFHGAHDAVL
GSA_METBF       YYPSI-----------DMLRFVSTGTESTMSALRLARGFTGRNKFIKIEGGFHGAHDAVL
GSA_METJA       RVPCA-----------EMVRFVNSGTEATMSAIRLARGVTGRKKIIKFDGAYHGAHDYVL
GSA_METMP       RIPCA-----------EMVRFVNSGTEATMGAIRLARGVTKRNKIIKFEGAFHGAHDYVL
GSA_METST       RVPCA-----------QMVRFTNSGTEATMSAIRLARGITKRDKIIKFEGAYHGAHDAVL
GSA_METTH       RVPCA-----------EMVRFTNSGTEATMAAVRLARAFTGRDRIVKFEGSYHGAHDYVL
GSA_METKA       LVPNV-----------EKVRLVNTGTEATMSAIRLARAYTGREKIVKFEGCYHGAHDAVL
GSA_HALMA       HVPSV-----------EMLRFVNSGTEATVSAVRLARGYTGRDKIVVMQSGYHGAQESTL
GSA_HALLT       HVPSV-----------ESIRFVNSGTEATVSAVRLARGHTGRDKIVVMQGGYHGAQESTL
GSA_HALSA       HVPSV-----------ELLRFVNSGTEATVSAVRLARGYTGRNKIVVMQGGYHGAQESTL
GSA_HALS3       HVPSV-----------ELLRFVNSGTEATVSAVRLARGYTGRNKIVVMQGGYHGAQESTL
GSA_NATPD       HVPSV-----------EMIRFVNSGTEATVSACRLARAATGRNKIVVMQGGYHGAQESTL
                                   *   :*:*:     :     :    .. . . :**  :  *

GSA1_BACAN      VAAGSGPSTLGT------------------PDSAGVPQSIAQEVITVPFNNVETLKEALD
GSA1_BACHK      VAAGSGPSTLGT------------------PDSAGVPQSIAQEVITVPFNNVETLKEALD
GSA1_BACCR      VAAGSGPSTLGT------------------PDSAGVPQSIAQEVITVPFNNVETLKEALD
GSA1_BACCZ      VAAGSGPSTLGT------------------PDSAGVPQSIAQEVITVPFNNIETLKEALD
GSA1_BACC1      VAAGSGPSTLGT------------------PDSAGVPQSIAQEVITVPFNNVETLKEALD
GSA1_BACLD      VAAGSGPSTLGT------------------PDSAGVPKSIANEVITVPFNDIDSYKEALD
GSAB_BACSU      VAAGSGPSTLGT------------------PDSAGVPKSIANEVITVPFNDIDSYKAALE
GSA1_GEOKA      VAAGSGPSTLGT------------------PDSAGVPPSIAQEVITVPYNDVESFREAMN
GSA1_OCEIH      VEAGSGPSTLGT------------------PDSAGVPASTASDVITVPFNDIEAYKAALN
GSA2_LISMO      VEAGSGPSTLGI------------------PDSAGVTKSTAEEVITVPFNDLDSFKEALA
GSA2_LISMF      VEAGSGPSTLGI------------------PDSAGVTKSTAEEVITVPFNDFASFKEALA
GSA2_LISIN      VEAGSGPSTLGI------------------PDSAGVTRSTAEEVITVPFNDLTSFKEALA
GSA1_BACSK      VAAGSGPSTLGT------------------PDSAGVTAATASEVITVPFNDIEAFKEALA
GSA1_BACHD      VAAGSGPSTLGT------------------PDSAGVTKNIAEEVITVPFNQLDSLKEALD
GSA2_STAAC      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAA3      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAAR      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAAB      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAAS      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAAW      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAAM      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAAN      VAAGSGPSQLGS------------------PDSAGVPESVAREVITVPFNDINAYKEAIE
GSA2_STAES      VAAGSGPSQLGS------------------PDSAGVPQSVAQEVITVPFNDIESYREAID
GSA2_STAEQ      VAAGSGPSQLGS------------------PDSAGVPQSVAQEVITVPFNDIESYREAID
GSA1_STAS1      VAAGSGPSQLGS------------------PDSAGVPLSVAQEVITVPYNDIDAYKEAID
GSA_SYMTH       IAAGSGPSQLGT------------------PDSAGVTEGVAQDVITVPYNDLDSLGEALD
GSA_ACAM1       VKAGSGVATLGLP------------------DSPGVPKSVTGNTLTAPYNDLQSVQALFS
GSA_CYAP4       VKAGSGVATLGLP------------------DSPGVPKSVTANTLTAPFNDLEAVKALFA
GSA_NOSS1       VKAGSGVATLGLP------------------DSPGVPKSATSSTLTAPYNDLEAVKALFE
GSA_TRIV2       VKAGSGVATLGLP------------------DSPGVPKSATSSTLTAPYNDLEAVKALFA
GSA_NOSP7       VKAGSGVATLGLP------------------DSPGVPKAATSTTLTAPYNDLESVKALFE
GSA_TRIEI       VKAGSGVATLGLP------------------DSPGVPKHVTKNTLTAPYNDLETVKKLFE
GSA_SYNE7       VKAGSGVATLGLP------------------DSPGVPKSTTANTLTAPYNDLEAVKALFA
GSA_SYNP6       VKAGSGVATLGLP------------------DSPGVPKSTTANTLTAPYNDLEAVKALFA
GSA_SYNP2       VQAGSGVATLGLP------------------DSPGVPKTTTAATLTAPYNDLEAVKKLFA
GSA_RIPO1       VKAGSGVATLGLP------------------DSPGVPKATTSFTLTAPYNDLEAVKALFA
GSA_MICAN       VKAGSGVATLGLP------------------DSPGVPKTTTNNTLTAPYNDLEAVKALFV
GSA_GLOC7       VKAGSGVATLGLP------------------DSPGVPKTTTSNTLTAPYNDLEAVKALFE
GSA_SYNY3       VKAGSGVATLGLP------------------DSPGVPSNTTKATLTAPYNDLEAVKALFV
GSA_SYNJB       VKAGSGVATLGLP------------------DSPGVPKAATSATLTAPYNDLEAVKALFE
GSA_SYNJA       VKAGSGVATLGLP------------------DSPGVPKAATSATLTAPYNDLEAVKALFE
GSA_THEEB       VKAGSGVATLGLP------------------DSPGVPKATTAATLTAPYNDLEAVSRLFE
GSA_PROMA       VKAGSGVATLGLP------------------DSPGVPRSTTSNTLTAPYNDLEAVKNLFA
GSA_PROM4       VKAGSGVATLGLP------------------DSPGVPRSTTSNTLTAPYNDLEAVKALFA
GSA_PROM1       VKAGSGVATLGLP------------------DSPGVPRSTTANTLTAPYNDLEAVKELFA
GSA_PROMT       VKAGSGVATLGLP------------------DSPGVPRSTTANTLTAPYNDLEAVKELFA
GSA_PROM3       VKAGSGVATLGLP------------------DSPGVPRSTTSNTLTAPYNDLEAVKELFA
GSA_PROMM       VKAGSGVATLGLP------------------DSPGVPRSTTSNTLTAPYNDLEAVKELFA
GSA_SYNS9       VKAGSGVATLGLP------------------DSPGVPRSTTANTLTAPYNDLEAVKALFA
GSA_SYNPX       VKAGSGVATLGLP------------------DSPGVPRSTTANTLTAPYNDLEAVKALFA
GSA_SYNSC       VKAGSGVATLGLP------------------DSPGVPRSTTANTLTAPYNDLEAVKALFA
GSA_SYNPW       VKAGSGVATLGLP------------------DSPGVPRSTTANTLTAPYNDLEAVKQLFA
GSA_PROMS       VKAGSGVATLGLP------------------DSPGVPRTTTANTLTAPYNDLEAVKKLFS
GSA_PROM0       VKAGSGVATLGLP------------------DSPGVPRTTTANTLTAPYNDLEAVKKLFS
GSA_PROM2       VKAGSGVATLGLP------------------DSPGVPRTTTANTLTAPYNDLEAVKKLFS
GSA_PROM9       VKAGSGVATLGLP------------------DSPGVPRTTTANTLTAPYNDLEAVKKLFS
GSA_PROMP       VKAGSGVATLGLP------------------DSPGVPRTTTANTLTAPYNDLEAVKKLFS
GSA_GLOVI       VQAGSGVATLGLP------------------DSPGVPKSTTAATLTAPYNDLAAVEALFK
GSA_CHLSY       VQAGSGVATLGLP------------------DSPGVPPSVAAETITIEYNDLDAAAALFA
GSA_CHLAA       VQAGSGVATLGLP------------------DSPGVPPSVAAETITIEYNDLDAAAALFA
GSA_CHLAD       VQAGSGVATLGLP------------------DSPGVPPTVAADTITIEYNDLDAAADLFA
GSA_ROSCS       VQAGSGVATLGLP------------------DSPGVTAATAASTLTAPYNDLDAVESLLK
GSA_ROSS1       VQAGSGVATLGLP------------------DSPGVTAATAAGTLTAPYNDLDAVEALLK
GSA_HERA2       VQAGSGVATLGLP------------------DSPGVLKSATSNTLTAPFNDLEAVEALFK
GSA_FRACC       ASAGSGVATLGL------------------PDTPGVTGAATADTIVLPYNDLALVEAVFV
GSA_FRASN       ASAGSGVATLGL------------------PDTPGVTGAATADTIVLPYNDLALVEATFA
GSA_THEFY       AAAGSGVATFAL------------------PDSPGVTGASAADTIVLPYNDIAAVEAAFA
GSA_STRAW       AAAGSGLATFAL------------------PDTPGVTGAQAGDTIVLPYNDLDAVREAFR
GSA_STRCO       AAAGSGVATFAL------------------PDTPGVTGAQASDTIVLPYNDLDAVHAAFA
GSA_STRGG       AAAGSGVATFGL------------------PDTPGVTGATAGDTVVLPYNDLEAVRAAFA
GSA_MYCA1       ADAGSGVATLGL------------------PSSPGVTGATAADTIVLPYNDIDAVRQAFA
GSA_MYCPA       ADAGSGVATLGL------------------PSSPGVTGATAADTIVLPYNDIDAVRQAFT
GSA_MYCMM       ADAGSGVATLGL------------------PSSPGVTGAAAADTIVLPYNDLEAVRQTFA
GSA_MYCUA       ADAGSGVATLGL------------------PSSPGVTGAAAADTIVLPYNDLEAVRQTFA
GSA_MYCBO       ADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQTFA
GSA_MYCTA       ADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQTFA
GSA_MYCBT       ADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQTFA
GSA_MYCBP       ADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQTFA
GSA_MYCTU       ADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQTFA
GSA_MYCLE       ADAGSGVATLSL------------------PSSPGVTGAAAADTIVLPYNDIEAVRQTFA
GSA_MYCLB       ADAGSGVATLSL------------------PSSPGVTGAAAADTIVLPYNDIEAVRQTFA
GSA_RHOOB       ADAGSGLATFGL------------------PTSPGVTGAQAEDTIVVPYNDLDAVAAAFA
GSA_RHOJR       ADAGSGLATFGL------------------PTSPGVTGAQAEDTIVVPYNDLDAVAQAFA
GSA_NOCFA       ADAGSGVATLGL------------------PTSPGVTGAQAADTIVLPYNDLDAVAAAFE
GSA_ACIC1       SAAGSGVATLGL------------------PGTPGVTPGQAAETIVLPYNDIDAVRTAFE
GSA_CORGL       ASAGSGVATFAL------------------PDSPGITGAQTSDTIVVPYNDIEAVRNAFA
GSA_CORGB       ASAGSGVATFAL------------------PDSPGITGAQTSDTIVVPYNDIEAVRNAFA
GSA_COREF       ASAGSGVATFAL------------------PDSPGITGAQTRDTIVVPYNDIEAVRAAFA
GSA_CORDI       ASAGSGVATFAL------------------PDSPGVTGASAADTIVVPYNDSEAVRAAFE
GSA_CORA7       ASAGSGVATFAL------------------PDSPGVTGASAADTIVVPYNDLDAVREAFA
GSA_CORJK       VAAGSGVATFGL------------------PDSPGITKAAAGDTVVVPYRDVQAVEDAFA
GSA_CLAM3       AEAGSGVATLALP------------------GSAGIPEAIAAQTIVVPYNDLDAVRAVIA
GSA_CLAMS       AEAGSGVATLALP------------------GSAGIPEAIAAQTIVVPYNDLGAVRAVFA
GSA_LEIXX       AEAGSGLATLSLP------------------GSAGVTEATAAQTLVLPYNDLGAVRAVFE
GSA_KOCRD       SEAGSGLATLALP------------------GSAGVTEATAAQTLVLPYNDVAALEAAFA
GSA_CUTAK       AAAGSGVATAGLP------------------GSAGVPAASTADTIVVDYNDVAALDAVFS
GSA_PROFF       VSAGSGVASLGLP------------------DSPGVPKEVAGDTVALPYGRIDMVEELFA
GSA_TROW8       IDAGSGL--VGHP------------------SSGGVPESVAKNTLVVPYNDLAVLEYLFE
GSA_TROWT       IDAGSGL--VGHP------------------SSGGVPESVAKNTLVVPYNDLAVLEYLFE
GSA_ANAD2       VKAGSGVETLGLP------------------DSPGVPADVARHTLTAPYNDLPALEKVFE
GSA_ANASK       VKAGSGVETLGLP------------------DSPGVPADVARHTLTAPYNDLPALEQVFQ
GSA_ANADE       VKAGSGVETLGLP------------------DSPGVPADVARHTLTAPYNDLPALEKVFE
GSA_ANADF       VKAGSGVETLGLP------------------DSPGVPADLAKHTLTLPYNDLAAVERLFA
GSA_MYXXD       VKAGSGVETLGLP------------------DSPGVPSALAKLTLTAPFNDLAAVERIFA
GSA_CARHZ       IKAGSGALT------------------LGVPTSPGVPANIANNTITAQFNDLALLEEIFA
GSA_PELTS       IKAGSGALT------------------FGVPTSPGIPAAAAAGTIVARYNDLAGLEEIFK
GSA_MOOTA       IQAGSGALT------------------FGIPNSPGVPATVAANTIVAPYNDLAAVEDIFQ
GSA_THERP       VAAGSGVLT------------------FGLPGTPGVTEGTARDTLVLPYNDQEAVEDAFA
GSA_THET2       VEAGSGALT------------------LGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLR
GSA_THET8       VEAGSGALT------------------LGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLK
GSA_DEIRA       VEAGSGLLTNAEGDLG-----------AAAPSSAGVPEEYAGLTLVLDYNDPEALDALMA
GSA_RHOBA       VAAGSAAAT------------------LGAPDSPGVTPGAAEDTLVLSYNDVSGLQNAFA
GSA_SORC5       VKAGSGLAT------------------FGAPDSAGVPESIARTTLSLPYNDPAALEAAFA
GSA_CALBD       KEAGSAVAELRLK------------------R---IDEDIVQNTIVVEYNNLDSVEKAFK
GSA_CALS8       KEAGSAVAELRLK------------------G---IDEDIVQNTIVVEYNNLDSIEKAFK
GSA_CLOAB       VEAGSGVLTQNIP------------------GSPGVPKGSIENTLIAEYNNVESVEVLFN
GSA_CLOTE       VEAGSGVLTERIP------------------GSPGVPKGSIENTLIAEYNHIDTVEALFE
GSA_CLOBA       IEAGSGVLTEGIP------------------GSLGVPKESVENTLIGLYNDKVQIKELFK
GSA_CLOBB       IEAGSGVLTEGIP------------------GSLGVPKESVENTLIGLYNDKTQIKELFK
GSA_CLOB8       IEAGSGVMTGGIP------------------GSLGVPNESIENTLIGIYNDKEQITELFK
GSA_CLOP1       IEAGSGVLTEGIP------------------GCLGVPEESIKNTLIGIYNDEKQVEELFE
GSA_CLOPS       IEAGSGVLTEGIP------------------GCLGVPEESIKNTLIGIYNDEKQVEELFE
GSA_CLOPE       IEAGSGVLTEGIP------------------GCLGVPEESIKNTLIGIYNDEKQVEELFE
GSA_CLOK5       VEAGSGVMTEGIP------------------GSAGVPKDSIKNTIIAEYNNLEDVKNIFN
GSA_AQUAE       VSAGSGVATFGIP------------------GTPGIPEEIAKLTIVLPYNDVQALEEAFK
GSA_HYDS0       VGAGSGVATLGIP------------------GTPGIPKEFAALTIVLDYNDENALEEAFI
GSA_PERMH       VSAGSGVATLSIP------------------GTPGIPEEFANLTIVLPYNNIDAVEETFK
GSA_SULSY       VSAGSGVATLGIP------------------GTPGIPEELASLTIVLPYNNIEAVEEAFE
GSA_DESVH       ASAGSGVATLSIP------------------GTPGVPESTVRDTLLAPYNDLAAVKDLFA
GSA_DESVV       ASAGSGVATLSIP------------------GTPGVPESTVRDTLLAPYNDLAAVKDLFA
GSA_DESVM       ASAGSGVATLSIP------------------GTPGVPEATVRDTLLAPYNDLTAVAELFT
GSA_DESAG       ASAGSGVATLSIP------------------GTPGVPDTVVADTLLAPYNNLERVKALFE
GSA_LAWIP       ASAGSGVATLSIP------------------GTPGVPEVTVRDTLLAPYNDLSTVKDLFV
GSA_SYNWW       IQAGSGLLTAGVP------------------TSPGVPEAFARHTLVARYNDLDSVERLFA
GSA2_BACAN      IKAGSGVATLGLP------------------DSPGVPEGVAKNTITVAYNDLESVKYAFE
GSA2_BACHK      IKAGSGVATLGLP------------------DSPGVPEGVAKNTITVAYNDLESVKYAFE
GSA2_BACCZ      IKAGSGVATLGLP------------------DSPGVPEGVAKNTITVAYNDLESVKYAFE
GSA2_BACCR      IKAGSGVATLGLP------------------DSPGVPEGVAKNTITVAYNDLESVKYAFE
GSA2_BACC1      IKAGSGVATLGLP------------------DSPGVPEGVAKNTITVAYNDLESVKYAFE
GSA2_BACLD      IKAGSGVATLGLP------------------DSPGVPESIAKNTITVPYNDLESMKLVFQ
GSA_BACSU       IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLESVKLAFQ
GSA2_GEOKA      IKAGSGVATLGLP------------------DSPGVPESVAQHTITVPYNDLDSVRYAFE
GSA2_BACSK      IKAGSGVATLGLP------------------DSPGVPESVAQNTLTVHYNDVESVRYVFE
GSA2_BACHD      IKAGSGVATLGLP------------------DSPGVPETVAQNTLTVPYNDLESVRYAFE
GSA1_STAAU      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAAC      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAA8      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAA3      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAAM      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAAN      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAAR      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAAS      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAAW      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAAB      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDALKIAFE
GSA1_STAES      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDSLKLAFE
GSA1_STAEQ      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDSLKLAFE
GSA2_STAS1      IKAGSGVATLGLP------------------DSPGVPEGIAKNTITVPYNDLDAIKVAFE
GSA2_STAHJ      IKAGSGVATLGLP------------------DSPGVPEGTAKNTITVPYNDLEAIKIAFE
GSA2_OCEIH      IKAGSGVATLGLP------------------DSPGVPENIAKNTITVPYNDTDSLKLAFE
GSA1_LISMO      IKAGSGVATLGLP------------------DSPGVTKGLAADTITVPYNDIEGAKLAFE
GSA1_LISMF      IKAGSGVATLGLP------------------DSPGVTKGLAADTITVPYNDIEGAELAFQ
GSA1_LISIN      IKAGSGVATLGLP------------------DSPGVTKGLAADTITVPYNDVEGAKLAFE
GSA_NATTJ       IKAGSGVTTLGLP------------------DSPGVPASIAENTITVPYNNLEVMEQVFN
GSA_THEYD       VSAGSGGATFSIP------------------DSLGVPQSYTSETIVLPFNDINTFKNTLK
GSA_DESPS       VKAGSGVLTLGIP------------------GSPGVPEDIVKNTISIPYNSVEALETTLR
GSA_SYNAS       VKAGSGVATLGIP------------------GSPGVPACLAELTITVPFNSNEAFRKAVD
GSA_DESOH       VDAGSGVATQAIP------------------GSPGVPADVVRHTISLPYNNTAALKDCLD
GSA_SYNFM       VKAGSGLATFGIP------------------GSPGVPEEVVRHTIPLSYNDLDEVESVME
GSA_GEODF       VKAGSGAATFGVP------------------DSPGVPQDFARHTLTADYNSLESVRTLIA
GSA_GEOUR       VKAGSGAATFGVP------------------DSPGVPQDFAKHTLTATYNDLESVNKLVA
GSA_GEOBB       VKAGSGAATFGVP------------------DSPGVPADLAKHTLTATYNDLDSVRALVA
GSA_PELPD       VRAGSGAATFGIP------------------DSPGVPADFAKHTLTAEFNSLDSVRQLVA
GSA_GEOLS       VKAGSGAATFGVP------------------DSPGVPADFAKHTLTAEYNSLASVKTLIT
GSA_GEOMG       VKAGSGAATFGVP------------------DSPGVPRDFAQHTLTATFNDLESVEELIC
GSA_GEOSL       VKAGSGAATFGVP------------------DSPGVPVDVAKNTLTAQFNDLDSVSKLID
GSA_PELCD       VDAGSGVATFGIP------------------ASPGVPADFARHTLTAPYNDLGRVRALVE
GSA_ECOL6       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECOL5       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO45       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECOK1       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO27       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECOUT       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO81       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO24       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO8A       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO55       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECOLC       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECOSE       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECOHS       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECOLU       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO57       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO5E       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SHISS       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECO7I       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ECODH       VKAGSGALTLGQ------------------PNSPGVPADFAKYTLTCTYNDLASVRAAFE
GSA_ECOLI       VKAGSGALTLGQ------------------PNSPGVPADFAKYTLTCTYNDLASVRAAFE
GSA_ECOSM       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SHIB3       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SHIBS       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SHIDS       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SHIFL       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SHIF8       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_ESCF3       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SALDC       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SALSV       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SALA4       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNNLASVRAAFE
GSA_SALTI       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALG2       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVHAAFE
GSA_SALNS       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALEP       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALPB       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_SALCH       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALPC       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALPA       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALPK       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALHS       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALTY       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLTSVRAAFE
GSA_SALAR       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCVYNDLASVRAAFE
GSA_CROS8       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVREAFE
GSA_ENT38       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLDTVRAAFE
GSA_KLEP3       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_KLEP7       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_YERPE       VKAGSGALTLGQ------------------PNSPGVPTDFAKHTLTCTYNDLASVRQAFE
GSA_YERPP       VKAGSGALTLGQ------------------PNSPGVPTDFAKHTLTCTYNDLASVRQAFE
GSA_YERPN       VKAGSGALTLGQ------------------PNSPGVPTDFAKHTLTCTYNDLASVRQAFE
GSA_YERPG       VKAGSGALTLGQ------------------PNSPGVPTDFAKHTLTCTYNDLASVRQAFE
GSA_YERPA       VKAGSGALTLGQ------------------PNSPGVPTDFAKHTLTCTYNDLASVRQAFE
GSA_YERPS       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRQAFE
GSA_YERPB       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRQAFE
GSA_YERP3       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRQAFE
GSA_YERPY       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRQAFE
GSA_YERE8       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVREAFE
GSA_ERWT9       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLASVRAAFE
GSA_PECAS       VKAGSGALTLGQ------------------PNSPGVPADFARHTLTCVYNDLSSVRTTFE
GSA_PHOLL       VKAGSGALTIGQ------------------PNSPGVPVDFVKHTLTCTYNDLSSVREAFE
GSA_PROMH       VKAGSGALTMGQ------------------PNSPGVPADFVKHTLTCTYNDLNSVRQAFE
GSA_SODGM       VKAGSGALTLGQ------------------PSSPGVPADYAKYTLTCSYNDLQSVREAFT
GSA_ACTPJ       VKAGSGALTLGQ------------------PSGPGVPADFAKHTLTCTYNDLDSVKTAFE
GSA_ACTP2       VKAGSGALTLGQ------------------PSGPGVPADFAKHTLTCTYNDLDSVKTAFE
GSA_ACTP7       VKAGSGALTLGQ------------------PSGPGVPADFAKHTLTCTYNDLDSVKTAFE
GSA_HAEPS       VKAGSGALTLGQ------------------PSSPGVPEDFAKHTLTCEYNNLASVKQAFE
GSA_ACTSZ       VKAGSGALTLGQ------------------PSSPGVPEDFAKHTLTCTYNDLNSVKCAFE
GSA_HAES1       VKAGSGSLTLGQ------------------PSSPGVPEDFAKHTITCEYNNLQSVKNAFE
GSA_HISS2       VKAGSGSLTLGQ------------------PSSPGVPEDFAKHTITCEYNNLQSVKNAFE
GSA_PASMU       VKAGSGALTLGQ------------------PSSPGVPADFAKHTLTCTYNDLDSVKHAFE
GSA_MANSM       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLESVKQAFE
GSA_AERHH       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCVFNDLDSVCEAFT
GSA_AERS4       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCVFNDLDSVREAFT
GSA_SHEB8       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHEB2       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHEB5       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHEB9       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHEPC       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHESW       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHESM       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHESR       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRTLFE
GSA_SHESA       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRSLFE
GSA_SHEON       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLDSVRSLFE
GSA_SHEHH       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTATYNDLDSVKAIFE
GSA_SHEPA       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTATYNDLDSVKAIFE
GSA_SHESH       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTATYNDLESVKALFE
GSA_SHEWM       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTATYNELESVKTLFE
GSA_SHEPW       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTATYNDLDSVKALFE
GSA_SHELP       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNELESVKTLFE
GSA_SHEAM       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTAVYNDLESVQSFFD
GSA_SHEDO       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTATYNDLASVRSLFE
GSA_SHEFN       VKAGSGALTLGQ------------------PSSPGIPEDFAKHTLTATYNDLDSVRAIFE
GSA_ALIF1       VKAGSGALTLGQ------------------PSSPGVPADFAKYTLTATFNDLDSVRELFA
GSA_ALIFM       VKAGSGALTLGQ------------------PSSPGVPADFAKYTLTATFNDLDSVRELFT
GSA_ALISL       VKAGSGALTLGQ------------------PSSPGVPADFAKYTLTATFNNLDSVRELFA
GSA_VIBCH       VKAGSGALTLGQ------------------PSSPGVPADFAKHTLTARFNDLDSVRELFA
GSA_VIBC3       VKAGSGALTLGQ------------------PSSPGVPADFAKHTLTARFNDLDSVRELFA
GSA_VIBCM       VKAGSGALTLGQ------------------PSSPGVPADFAKHTLTARFNDLDSVRELFA
GSA_VIBVU       VKAGSGALTLGQ------------------PSSPGVPADFAKHTLTATFNDLDSVRELFA
GSA_VIBVY       VKAGSGALTLGQ------------------PSSPGVPADFAKHTLTATFNDLDSVRELFA
GSA_VIBPA       VKAGSGALTLGQ------------------PSSPGVPADFAKHTLTATFNDLDSVRELFA
GSA_VIBTL       VKAGSGALTLGQ------------------PSSPGVPADFAKLTLTATFNNLDSVREIFA
GSA_PHOPR       VKAGSGALTLGQ------------------PNSPGVPADFAKHTLTCTYNDLETVREAFA
GSA_COLP3       VKAGSGALTLGV------------------PNSPGIPEDFAKHTLTVSYNNIDEVKEIFA
GSA_PSEHT       VKAGSGALTMGV------------------PNSPGIPEDFAKHTLTVSFNNLDEVKAIFA
GSA_IDILO       VKAGSGALTLGV------------------PNSPGIPEDFAKHTLTATYNDIESVKQIFA
GSA_PSYIN       VKAGSGALTLGQ------------------PSSPGIPADFAKHTLTATYNDLASVQQLFT
GSA_PSEA6       VKAGSGALTFGV------------------PSSPGIPADFAKHTLTMEYNNIDSVVQAFE
GSA_ACIF2       VKAGSGALTLGQ------------------PSSAGVPREVSQNTLVLPYNDLPAVVEMMA
GSA_ACIF5       VKAGSGALTLGQ------------------PSSAGVPREVSQNTLVLPYNDLPAVVEMMA
GSA_METCA       VKAGSGALTLGA------------------PSSPGVPANLAEHTLVLPYNDAAAVRDVFA
GSA_PSEAE       VKAGSGALTFGV------------------PNSPGVPAAFAKHTLTLPFNDIEAVRKTLG
GSA_PSEA8       VKAGSGALTFGV------------------PNSPGVPAAFAKHTLTLPFNDIEAVRKTLG
GSA_PSEAB       VKAGSGALTFGV------------------PNSPGVPAAFAKHTLTLPFNDIEAVRKTLG
GSA_PSEA7       VKAGSGALTFGV------------------PNSPGVPAAFAKHTLTLPFNDIEAVRETLA
GSA_PSEE4       VKAGSGLLTQGV------------------PSSAGVPADFAKHTLTLPFNDIAAVEKTLA
GSA_PSEPW       VKAGSGLLTQGV------------------PSSAGVPADFAKHTLTLPFNDIAAVEKTLA
GSA_PSEP1       VKAGSGLLTQGV------------------PSSAGVPADFAKHTLTLPFNDIAAVEKTLA
GSA_PSEPK       VKAGSGLLTQGV------------------PSSAGVPADFAKHTLTLPFNDIAAVEKTLA
GSA_PSEPG       VKAGSGLLTQGV------------------PSSAGVPADFAKHTLTLPFNDIAAVEKTLA
GSA_PSEF5       VKAGSGALTQGV------------------PSSAGVPAAFAKHTLTLPFNDIAAVEKMLA
GSA_PSEPF       VKAGSGALTQGV------------------PSSAGVPAAFAKHTLTLPFNDIDAVEKMLA
GSA_PSEMY       VKAGSGALTQGV------------------PNSAGVPAAFAKHTLTLPFNDIDAVAECLA
GSA_PSE14       VKAGSGALTLGV------------------PSSPGVPAAFAKHTLTVPFNNLDAVRDLLA
GSA_PSEU2       VKAGSGALTLGV------------------PSSPGVPAAFAKHTLTVPFNNLDAVRDLLA
GSA_PSESM       VKAGSGALTLGV------------------PSSPGVPAAFAKHTLTVPFNDLNAVRDLLA
GSA_PSEU5       VKAGSGALTQGV------------------PSSAGVPADFAKHTLTLAYNDLDEVEATLK
GSA_ACIB5       VKAGSGLLTKGEGE----------------PTSKGVPADFAKHTLTLPYNDIAALKECFA
GSA_ACIB3       VKAGSGLLTKGEGE----------------PTSKGVPADFAKHTLTLPYNDIAALKECFA
GSA_ACIBT       VKAGSGLLTKGEGE----------------PTSKGVPADFAKHTLTLPYNDIAALKECFA
GSA_ACIBY       VKAGSGLLTKGEGE----------------PTSKGVPADFAKHTLTLPYNDIAALKECFA
GSA_ACIBC       VKAGSGLLTKGEGE----------------PTSKGVPADFAKHTLTLPYNDVAALKECFA
GSA_ACIBS       VKAGSGLLTKGEGE----------------PTSKGVPADFAKHTLTLPYNDIPALKECFA
GSA_ACIAD       VKAGSGLLTLGEGE----------------PTSKGVPVDFAKHTLTLPYNNIEALKECFA
GSA_PSYA2       VKAGSGMLDIGE------------------PTSKGVPADFAKHTITIPYNDSQAIKDCFE
GSA_PSYCK       VKAGSGMLDIGE------------------PTSKGVPADFAKHTITIPYNDPQAIKDCFE
GSA_RUTMC       IKAGSGALTLGV------------------PTSPGVPKDFAKHTLTLEYNNIDQVCEVLS
GSA_VESOH       VKAGSAALTLGV------------------PTSPGVPKDFAKHTLTLEYNNINQVYEILK
GSA_HAHCH       VKAGSGALTLGI------------------PDSPGVPASVAEHTLTLTYNDAIMVREVFA
GSA_MARHV       VKAGSGALTLGV------------------PNSPGIPASLAEHTLTLTYNDIDEVRETFR
GSA_MARMS       VKAGSGALTLGV------------------PNSPGVPADLAQHTITLQYNDIEEVKRCFS
GSA_HYDCU       VKAGSGALTLGV------------------PSSPGVPACLAQETLTLTHNDSEEVKKVFS
GSA_ALKEH       VQAGSGALTLGI------------------PGSPGVPAAVVEQTITLPYNDAEAVRECFQ
GSA_HALHL       AQAGSGALTLGV------------------PGCPGVPEAVVAETLTVPYNDIEAVEQCFN
GSA_STRMK       VKAGSGMLTLGV------------------PTSPGVPAGLSELTLTLPYNDFEAATALFE
GSA_STRM5       VKAGSGMLTLGV------------------PTSPGVPAGLSELTLTLPYNDFEAATALFE
GSA_XANCH       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XANC5       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XANAC       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XANOR       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XANOM       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XANCP       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XANC8       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XANCB       VKAGSGMLTLGV------------------PTSPGVPAGLSELTATLSFNDFEGATALFD
GSA_XYLF2       VKGGSGMLTLGI------------------PSSPGVPAELSKLTITLTYNDFDAATALFE
GSA_XYLFT       VKGGSGMLTLGI------------------PSSPGVPAELSKLTITLTYNDFDAATALFE
GSA_XYLFM       VKGGSGMLTLGL------------------PSSPGVPAELSKLTITLTYNDFDAATALFE
GSA_XYLFA       VKGGSGMLTLGM------------------PSSPGVPAELSKLTITLTYNDFDAATALFE
GSA_CHRSD       VKAGSGALTHGE------------------PSSPGVPASLAEHTVTLPYNDLDAVRACFA
GSA_NITOC       VKAGSGALTLGV------------------PTSPGIPLAVAEHTLTVSYNNLGEVQEIFN
GSA_THISH       VKAGSGALTLGV------------------PSSPGVPAALAEHTLTLTYNDLDEVRETLA
GSA_ACISJ       VKAGSGLATFGH------------------ATSAGVPQEVVQHTLVLEYNDVAQLEEAFT
GSA_ACIET       VKAGSGLATFGH------------------ATSAGVPQEVVQHTLVLEYNDVAQLEEAFT
GSA_ACIAC       VKAGSGLATFGH------------------ATSAGVPAEVVQHTLVLEYNDIAQLEEAFA
GSA_VEREI       VKAGSGLATFGN------------------ATSAGVPAEVVQHTLVLEYNSIEQLERAFA
GSA_RHOFT       VKAGSGLATFGN------------------PTSAGVPPEVVQHTVVLEYNNIEQLEEAFA
GSA_LEPCP       VKAGSGLATFGN------------------PTSAGVPPEVVQHTLVLTYNDIEQLEEAFK
GSA_AZOSB       VKAGSGLLTFGN------------------PSSGGVPADFAHHTVVLDYNDLDQVETVFK
GSA_AROAE       VKAGSGLLTFGN------------------PSSGGVPADFAKHTIVLDYNDLQQVEDAFR
GSA_BORBR       VKAGSGLLTFGN------------------PSSAGVPPEFVAHTLTLEFNNLAAVDAAFS
GSA_BORPA       VKAGSGLLTFGN------------------PSSAGVPPEFVAHTLPLEFNNLAAVDAAFS
GSA_BORPE       VKAGSGLLTFGN------------------PSSAGVPPEFVAHTLTLEFNNLAVVDAAFS
GSA_BORPD       VKAGSGLLTFGN------------------PSSAGVPPEFVSHTLTLEYNNLAAVQAAFA
GSA_BORA1       VKAGSGLLTLGN------------------PSSAGVPPEFVAHTITLDYNNLPAVQTAFA
GSA_BURCM       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURA4       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURL3       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURCA       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURCH       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURCC       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURCJ       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURVG       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURM1       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAALEEAFG
GSA_BURMA       VKAGSGLLTFGN------------------PTSAGVPADVAKHTTVLEYNNVAALEEAFA
GSA_BURP1       VKAGSGLLTFGN------------------PTSAGVPADVAKHTTVLEYNNVAALEEAFA
GSA_BURPS       VKAGSGLLTFGN------------------PTSAGVPADVAKHTTVLEYNNVAALEEAFA
GSA_BURM9       VKAGSGLLTFGN------------------PTSAGVPADVAKHTTVLEYNNVAALEEAFA
GSA_BURP0       VKAGSGLLTFGN------------------PTSAGVPADVAKHTTVLEYNNVAALEEAFA
GSA_BURTA       VKAGSGLLTFGN------------------PTSAGVPADVAKHTTVLEYNNVAALEEAFA
GSA_PARPJ       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAELEEAFK
GSA_PARXL       VKAGSGLLTFGN------------------PTSAGVPADIAKHTTVLEYNNVAELEEAFK
GSA_PARP8       VKAGSGLLTFGN------------------PTSAGVPVDIAKHTTVLEYNNVAALEEAFS
GSA_CUPTR       VKAGSGLLTFADTTRNA-------------PSSAGVPADVTRHTMVLEYNNVEQLEQAFA
GSA_CUPNH       VKAGSGLLTFADTTQNA-------------PSSAGVPADVTRHTMVLEYNNVEQLEQAFA
GSA_CUPPJ       VKAGSGLLTFADTTQNA-------------PSSAGVPADVTRHTMVLEYNNVAQLEEAFA
GSA_CUPMC       VKAGSGLLTFADTTQNA-------------PSSAGVPADVTRHTMVLEYNNVTQLEEAFA
GSA_RALPJ       VKAGSGLLTFADTTQNA-------------PSSTGVPEDVVKHTMVLPYNDVAALREAFA
GSA_RALSO       VKAGSGLLTFADTTQNA-------------PSSAGVPEDVVKHTMVLPYNDADALREAFA
GSA_HERAR       VKAGSGLLTFGN------------------PTSAGVPEDFAKHTLVLDYNNPQQLEDTFK
GSA_JANMA       VKAGSGLLTFGN------------------PTSAGVPEDFAKHTLVLDYNDPAQLENVFK
GSA_CHRVO       VKAGSGLLTFGN------------------PSSGGVPADFTKHTLVLQYNDVEQLSRTFA
GSA_LARHH       VKAGSGLLTFGN------------------PSSAGVPEDFTRHTLVLEYNNVEQLERTFA
GSA_NEIG1       VKAGSGLLTFGN------------------PSSAGVPADFTKHTLVLEYNNIAQLEEAFA
GSA_NEIG2       VKAGSGLLTFGN------------------PSSAGVPADFTKHTLVLEYNNIAQLEEAFA
GSA_NEIM0       VKAGSGLLTFGN------------------PSSAGVPADFTKHTLVLEYNNIAQLEEAFA
GSA_NEIMF       VKAGSGLLTFGN------------------PSSAGVPADFTKHTLVLEYNNIAQLEEAFA
GSA_NEIMA       VKAGSGLLTFGN------------------PSSAGVPADFTKHTLVLEYNNIAQLEEAFA
GSA_NEIMB       VKAGSGLLTFGN------------------PSSAGVPADFTKHTLVLEYNNIAQLEEAFA
GSA_NITEU       VKAGSGALTFGH------------------PSSAGVPAETAGHTLVLNYNDVAGVEETFS
GSA_NITEC       VKAGSGALTFGH------------------PSSAGVPAETAGNTLVLNYNDVAGVEATFS
GSA_NITMU       VKAGSGALTFGH------------------PSSAGVPVETASSTVVLDYNDLAGVEQAFN
GSA_DECAR       VKAGSGLLTFGN------------------PSSSGVPAGTAETTMVLTYNDPQELADAFA
GSA_METFK       VKAGSGALTFGQ------------------PSSAGVPPELAAHTLTLPYNDVQALEHLFE
GSA_THIDA       VKAGSGALTFGN------------------PTSAGVPPEVAAQTIVLDYNDVAGLERTFA
GSA_SACD2       IKAGSGALTFGV------------------PSSPGVPACLAEHTVTLTYNNIEQVKQAFA
GSA_COXBU       VNAGSGALTFGM------------------PSSPGVPLGTVQDTLTATFNDLDSVAALFE
GSA_COXBR       VNAGSGALTFGM------------------PSSPGVPLGTVQDTLTATFNDLDSVAALFE
GSA_COXB2       VNAGSGALTFGM------------------PSSPGVPLGTVQDTLTATFNDLDSVAALFE
GSA_COXB1       VNAGSGALTFGM------------------PSSPGVPLGTVQDTLTATFNDLDSVAALFE
GSA_COXBN       VNAGSGALTFGM------------------PSSPGVPLGTVQDTLTATFNDLDSVAALFE
GSA_FRATF       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDMESIQALFE
GSA_FRATO       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDMESIQALFE
GSA_FRATH       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDMESIQALFE
GSA_FRATM       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDMESIQALFE
GSA_FRATW       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDMESIQALFE
GSA_FRATT       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDMESIQALFE
GSA_FRAT1       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDMESIQALFE
GSA_FRATN       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDIESIQALFE
GSA_FRAP2       VAAGSGALSLGQ------------------PNSPGVPEDVVKDTLVASFNDIESIQALFE
GSA_LEGPC       VKAGSGLLTLGI------------------PSTPGIPQSITEHTLTADFNNLEQVAQLFE
GSA_LEGPH       VKAGSGLLTLGI------------------PSTPGIPQSITEHTLTADFNNLEQVAQLFE
GSA_LEGPL       VKAGSGLLTLGI------------------PSTPGIPQCITEHTLTADFNNLEQVAQLFE
GSA_LEGPA       VKAGSGLLTLGI------------------PSTPGIPKSITEHTLTADFNNLEQVAQLFE
GSA_CAMC1       IKAGSGATTYGN------------------ASSGGVPQDVVKNTFLAIYNDIESVKAIFE
GSA_CAMC5       IKAGSGATTYGN------------------ASSGGVPQDVVRNTYLAVYNDAASVEAIFE
GSA_CAMFF       VKAGSGATTFGY------------------SSSLGVPEDIVKNTHIAIYNDIQSVEQCFK
GSA_CAMHC       VKAGSGATTFGS------------------SSSAGVPEDTAKNTYLAIYNDIDSVKNIVE
GSA_CAMJE       VSAGSGAATFNS------------------PSSLGVLEDVAKHTLVAKYNDINSVKELFE
GSA_CAMJ8       VSAGSGAATFNS------------------PSSLGVLEDVAKHTLVAKYNDINSVKELFE
GSA_CAMJJ       VSAGSGAATFNS------------------PSSLGVLEDVAKHTLVAKYNDINSVKELFE
GSA_CAMJR       VSAGSGAATFNS------------------PSSLGVLEDVAKHTLVAKYNDINSVKELFE
GSA_CAMJD       VSAGSGAATFNS------------------PSSLGVLEDVAKHTLVAKYNDINSVKELFE
GSA_HELPH       VKAGSGCVTFGS------------------PSSLGVPNDFSKHTLVARYNDLNSTEECF-
GSA_HELP2       VKAGSGCATFGS------------------PSSLGVPNDFSKHTLVARYNDLNSTEECF-
GSA_HELPG       VKAGSGCATFGS------------------PSSLGVPNDFSKHTLVARYNDLNSTEECF-
GSA_HELPS       VKAGSGCATFGS------------------PSSLGVPNDFSKHTLVARYNDLNSTEECF-
GSA_HELPJ       VKAGSGCATFGS------------------PSSLGVPNDFSKHTLVARYNDLNSTEECF-
GSA_HELPY       VKAGSGCATFGS------------------PSSLGVPNDFSKHTLVARYNDLNSTEECF-
GSA_HELAH       VKAGSGCTTFGS------------------PSSLGVPSDFSKHTLVARYNDLNSVQECF-
GSA_HELHP       VSAGSGCATFGT------------------PSSPGVPNDITKHTLVARYNDIESVRACF-
GSA_WOLSU       VQAGSGLATFGN------------------PSSPGVPQSFTKHTLLARYNDLESVRECF-
GSA_SULDN       VQAGSGAATFGN------------------PSSPGVPADFTKHTLLAEYNNIESVKKCFS
GSA_SULNB       VQAGSGLATFGT------------------PSSPGVPADLTKHTLLGTYNDIESVEKCFA
GSA_STRSV       VQAGSGLASFGI------------------ADSAGVIAQVAGETLALPYNDTDALKTCFE
GSA_CHLP8       IKAGSGVLTLGD------------------PDSPGVTKGTANDTLNATYNDIESVKAIVN
GSA_CHLTE       IKAGSGVLTLGD------------------PDSPGVTKGTANDTLNATYNDIESVKAIVN
GSA_CHLL2       IKAGSGVLTLGS------------------PDSPGVTKGTAADTLNATYNDIESVRLLVN
GSA_CHLCH       IKAGSGALTLGA------------------PDSPGVTKGTAQDTLNATYNDIESVKLLVQ
GSA_PELPB       IKAGSGALTLGA------------------PDSPGVTKGTAMDTLNATYNDIDSVKLLVN
GSA_CHLPD       IKAGSGALTLGA------------------PDSPGVTKGTALDTLNATYNDIESVKLLVE
GSA_CHLPB       IKAGSGALTLGA------------------PDSPGVTKGTANDTLNAKYNDIESVRVLVK
GSA_PROA2       IKAGSGALTLGA------------------PDSPGVTKGTANDTLNAKYNDIESVRLLVN
GSA_PELLD       IKAGSGALTLGA------------------PDSPGVTKGTAEDTLNAKYNDIKSVELLVA
GSA_CHLPM       IKAGSGALTLGA------------------PDSPGVTKGTAEDTLNAKYNDIASVELLVA
GSA_CHLT3       IKAGSGALTLGA------------------PSSPGVTEGTAKDTLNATYNDIESVRALVD
GSA_CYTH3       IAAGSGAVTMGV------------------PDSPGVPQGVANDTLTAPYNDIEAVRILVE
GSA_SALRD       ISAGSGAMTLGK------------------PDSPGVTDGNAKDTLLAQYNDLSHVQRLVE
GSA_HUNT2       VKVGSGAMTNGI------------------PNSGGVTAGAAKDTLIARYNDIDSVKLLFE
GSA_FLAJ1       IQAGSGAVTFGS------------------PNSPGVTEGTAKDTLLAKYNDLENVKTLIE
GSA_FLAPJ       IQAGSGAITFGS------------------PNSPGVTSGTAKDTLLASYNDIQNVKNLFD
GSA_GRAFK       IQAGSGAVTFGT------------------PNSPGVTQGTAKNTLLADYNDLDNVRKVIE
GSA_WIGBR       ANSNLDPYDLFSSN----------------PISSGIPKNILKDTLICPYNDYESIEKIFD
GSA_CHLTR       QEKPFSHTSLETL------------------------DLAHPLTLSLPFNDFPLFQTVMN
GSA_CHLTA       QEKPFSHTSLETL------------------------DLAHPLTLSLPFNDFPLFQTVMN
GSA_CHLT2       QEKPFSHTSLDTL------------------------DLAHPLTLSLPFNDFPLFQTVMN
GSA_CHLTB       QEKPFSHTSLDTL------------------------DLAHPLTLSLPFNDFPLFQTVMN
GSA_CHLMU       QEIHFQQTILDTV------------------------DLTQPLTLSLPFNNLSLFLDVMN
GSA_CHLFF       KGISVDENNLQNVAHIVD--------------TYFAGQPCLPLTLILPYNDVMIFEEVMH
GSA_CHLCV       KGMTIDENNLMEVPHLVD--------------RYFSSDPCLPLTLILPYNDLKTFEEVME
GSA_CHLAB       KGISIDESNIHQVPHIVD--------------TYFSGNPYLPLNLILPYNDIQIFKEVML
GSA_CHLPN       GGISTTEETIDNLTSLIH--------------T----PSPHSLLISLPYNNSQILHHVME
GSA_PARUW       VQAGSGVLEVSPSASSAG--------------I---PADIVKQTLCLPYNDIEACRQIFH
GSA_LEPIN       VKAGSGLAGESSSDSAG------------------ISATSIANTLVLPLDDEASVERVFE
GSA_LEPIC       VKAGSGLAGESSSDSAG------------------ISATSIANTLVLPLDDEASVERVFE
GSA_LEPBL       VKAGSGLAGESSSDSAG------------------ISSTAIANTLVLPLDDEMAVQKLFE
GSA_LEPBP       VKSGSGLAGLSSSDSKG------------------IGPEIIQNTLVLPLDDESKLEELFQ
GSA_BDEBA       VKAGSGLAGTAASSSAG------------------IPAEVAAHTVVAPLDDEAKLAEVFA
GSA_FUSNN       VKSGSGLLTEGYQDSNG------------------ITDGVLKDTLTLPFGDIEKVKEILK
GSA_METI4       VKAGSGALTTAVPNSAG------------------IPPCLSSLTLVLPWNDRQTLLEAFK
GSA_AERPE       VAAGSAAAHYGVP------------------TSAGVPEAVARLTLVTPYNDVEALERVFA
GSA_HYPBU       VGAGSAAAEYGVP------------------TSKGIPEEVAKLTLVAKYNDIESVEKIMS
GSA_SULAC       LDAGSAFTEFNVN------------------VYNGIPKSIVNTIRICEYNDAECVEKLSK
GSA_SULTO       INAGSAVSEFNVI------------------ISSGIPTSIINTVIVCKYNDLDCVEKHLR
GSA_SACS2       VEAGSAATEYNVA------------------TSDGVPMEIMKTVEICEFNDLDCVDKKLR
GSA_PYRAE       VKAGSGAATWGIP------------------TSAGIPQEVARLTVVVPYNDIDAFIKAVR
GSA_PYRCJ       VKAGSGAATWGIP------------------TSAGIPSDVVKMTVVVPYNDVDAFVKAVR
GSA_THEAC       IRSGSGTLTFGSP------------------SSPGVPEEVARTVVVGRYNDEANIRNIFS
GSA_THEVO       IKSGSGTLTFGSP------------------SSPGIPDEVAQTVIVGKYNDENNIKEIFQ
GSA_PICTO       IKSGSGTMTFGVP------------------SSNGVPEEITKTVLVGKYNDENSIESLFN
GSA_ARCFU       VKAGSGATTHGIP------------------NSAGVPADFVKNTLQVPFNDIEALSEILE
GSA_METAR       VKAGSGATTIGVP------------------DSLGVPVDVVKNTLQVPYNDIHALEETLE
GSA_METAC       VKAGSGATTLGEP------------------DSLGIPADFTKYTLQAPYNDIETMTTLVE
GSA_METMA       VKAGSGATTLGEP------------------DSLGIPADFTKHTLQAPYNDIETMTSLVE
GSA_METBF       VKAGSGATTLGEP------------------DSLGIPADFTKYTLQAPYNDIEAMTGLVE
GSA_METJA       VKSGSGALTHGHP------------------NSPGIPEETTKNTILIPFNDEDAVKKAIN
GSA_METMP       VKTGSGALTHGAP------------------NSPGIPEDTTKNTLLIPFNDEEAVRKVIS
GSA_METST       VKSGSG--AAGLP------------------DSPGIPTDTTKNTMLVEFNDEEALKKLIN
GSA_METTH       VRPGSG--AATAP------------------DSPGIPVDTVRNTLTVPFNHEEAMAELIE
GSA_METKA       VRAGSGASELGAP------------------DSPGIPESVAENTLVCPFNDVEAFVETVE
GSA_HALMA       VE---GEGDHTAP------------------SSPGIPESFAEHTLTVPFNDEEAAHEVFE
GSA_HALLT       VE---GSPGDAHP------------------STKGIPESFAEHTLPIPFNDPQAAKKVFA
GSA_HALSA       VE---GDADHRGP------------------SSAGIPPAFAQHTIPVPFNDADAVTEVFE
GSA_HALS3       VE---GDADHRGP------------------SSAGIPPAFAQHTIPVPFNDADAVTEVFE
GSA_NATPD       VE---GDADDVAP------------------SSAGIPQSFAEHTIPVPFNDPEAASEVFR
                                                                            

GSA1_BACAN      KW--GHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFM-YGG
GSA1_BACHK      KW--GHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFM-YGG
GSA1_BACCR      KW--GHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFM-YGG
GSA1_BACCZ      KW--GHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFM-YGG
GSA1_BACC1      KW--GHEVAAILVEPIVGNFGIVEPKTGFLEKVNELVHEAGALVIYDEVITAFRFM-YGG
GSA1_BACLD      KW--GNDIAAVLVEPIVGNFGIVEPKSGFLEQVNELTHNAGALVIYDEVITAFRFM-YGG
GSAB_BACSU      KW--GSEIAAVLVEPIVGNFGIVEPKEGFLEQVNELTHNAGALVIYDEVITAFRFM-YGG
GSA1_GEOKA      VW--GEQVAAVLVEPIVGNFGIVLPKPGFLEAINEIAHKEGALVIYDEVITAFRFM-YGG
GSA1_OCEIH      KW--GDQVAAVLVEPIVGNFGIVEPFKGFLQEVNELTHRAGALVIYDEVITAFRFT-YGS
GSA2_LISMO      IW--GDQVAAVLVEPIVGNFGMVAPEDGFLEAVNELAHVNGSLVIYDEVITAFRFM-YGG
GSA2_LISMF      VW--GDQVAAVLVEPIVGNFGMVAPEDGFLEAVNELAHANGSLVIYDEVITAFRFM-YGG
GSA2_LISIN      VW--GDQVAAVLVEPIVGNFGMVAPAEGFLEAVNELAHENGSLVIYDEVITAFRFM-YGG
GSA1_BACSK      HW--GSETAAVLVEPIVGNFGIVEPEPGFLEAVNDLAHSAGALVIYDEVITAFRFM-YGG
GSA1_BACHD      HW--GEEVAAVLVEPIVGNFGIVEPHEGFLEGVNELAHNAGALVIYDEVITAFRFM-YEG
GSA2_STAAC      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHNNGTLVIYDEVITAFRFH-YGA
GSA2_STAA3      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHNNGTLVIYDEVITAFRFH-YGA
GSA2_STAAR      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHSNGTLVIYDEVITAFRFH-YGA
GSA2_STAAB      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHNNGTLVIYDEVITAFRFH-YGA
GSA2_STAAS      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHNNGTLVIYDEVITAFRFH-YGA
GSA2_STAAW      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHNNGTLVIYDEVITAFRFH-YGA
GSA2_STAAM      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHNNGTLVIYDEVITAFRFH-YGA
GSA2_STAAN      FW--GDEIAAVLVEPIVGNFGMVMPQPGFLEEVNEISHNNGTLVIYDEVITAFRFH-YGA
GSA2_STAES      YW--KDDIAAVLVEPIVGNFGMVMPQPGFLEEVNKISHDNGTLVIYDEVITAFRFH-YGA
GSA2_STAEQ      YW--KDDIAAVLVEPIVGNFGMVMPQPGFLEEVNKISHDNGTLVIYDEVITAFRFH-YGA
GSA1_STAS1      YW--GDEIAAVLVEPIVGNFGMVEPKQGFLEQVNEITHNNGSLVIYDEVITAFRFH-YGG
GSA_SYMTH       VW--GPQVAAVLVEPIVGNFGVAMPKPGYLEGVKRLAHAHGALLIFDEVITGFRVA-YGG
GSA_ACAM1       QH--PDQIAGVILEPVVGNAGFIPPDAGFLEGLREITKENGALLVFDEVMTGFRIS-YGG
GSA_CYAP4       DH--PDQIAGVILEPVVGNAGFIPPDGGFLAGLREITQEQGALLVFDEVMTGFRIA-YGG
GSA_NOSS1       EN--RDQIAGVILEPVVGNAGFITPDAGFLEGLRELTHEHGALLVFDEVMTGFRIA-YGG
GSA_TRIV2       EN--RDQIAGVILEPVVGNAGFITPDAGFLEGLRELTHEHGALLVFDEVMTGFRIA-YGG
GSA_NOSP7       EN--RDEIAGVILEPVVGNAGFIAPDAGFLEGLRELTHEYGALLVFDEVMTGFRIA-YGG
GSA_TRIEI       EN--PDQISGVILEPVVGNSGFIVPDAGFLEGLRMITKENGALLVFDEVMTGFRIA-YGG
GSA_SYNE7       EN--PGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGFRIA-YGG
GSA_SYNP6       EN--PGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGFRIA-YGG
GSA_SYNP2       EN--PGEIAGVILEPVVGNSGFVLPDAGFLEGLREITKEHDALLVFDEVMTGFRIS-YGG
GSA_RIPO1       EN--PDDIAGVILEPVVGNSGFVLPDAGFLEGLRELTKEYGALLMFDEVMTGFRLA-YGG
GSA_MICAN       EN--PDSIAGVILEPVVGNAGFIVPDAGFLEGLRELTKEYGALLMFDEVMTGFRIA-YGG
GSA_GLOC7       NN--KDEIAGLILEPVVGNAGFIPPDAGFLEGLRELTKEYGALLVFDEVMTGFRIA-YGG
GSA_SYNY3       EN--PDSIAGVILEPVVGNAGFILPDAGFLEGLRELTKEYGALLVFDEVMTGFRVS-YGG
GSA_SYNJB       QH--PDSIAGVILEPVVGNAGFIPPQPGFLEGLRDLTQKYGALLVFDEVMTGFRIS-YGG
GSA_SYNJA       QY--PDSIAGVILEPVVGNAGFIPPQPGFLEGLRELTQKYGALLVFDEVMTGFRIS-YGG
GSA_THEEB       QY--PNDIAGVILEPVVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIA-YGG
GSA_PROMA       EN--PDAIAGVILEPIVGNAGFIQPEPGFLEGLRELTKENGSLLVFDEVMTGFRIS-YGG
GSA_PROM4       EN--PDAISGVILEPIVGNAGFIPPEPGFLEGLRELTKENGSLLVFDEVMTGFRIS-YGG
GSA_PROM1       EN--PDAISGVILEPVVGNAGFITPEPGFLEGLREVTQENGALLVFDEVMTGFRIS-YGG
GSA_PROMT       EN--PDAISGVILEPVVGNAGFITPEPGFLEGLREVTQENGALLVFDEVMTGFRIS-YGG
GSA_PROM3       EN--PDAISGVILEPVVGNAGFITPEPGFLEGLRELTREHGALLVFDEVMSGFRIS-YGG
GSA_PROMM       EN--PDAISGVILEPVVGNAGFITPEPGFLEGLRELTREHGALLVFDEVMSGFRIS-YGG
GSA_SYNS9       EN--PDAISGVILEPIVGNAGFIQPEPGFLEGLRELTKENGALLVFDEVMTGFRIS-YGG
GSA_SYNPX       EN--PDAIAGVILEPIVGNAGFIQPEPGFLEGLRELTKEHGALLVFDEVMTGFRIS-YGG
GSA_SYNSC       EN--PEAIAGVILEPIVGNAGFIQPEPGFLEGLRELTKEHGALLVFDEVMTGFRIS-YGG
GSA_SYNPW       EN--PDAISGVILEPIVGNAGFIQPEPGFLEGLRELTKEHGALLVFDEVMTGFRIS-YGG
GSA_PROMS       EN--PDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGFRIS-YGG
GSA_PROM0       EN--PDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGFRIS-YGG
GSA_PROM2       EN--PDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGFRIS-YGG
GSA_PROM9       EN--PDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGFRIS-YGG
GSA_PROMP       EN--PDAISGVILEPIVGNAGFITPEPGFLEGLRELTTENGSLLVFDEVMTGFRIS-YGG
GSA_GLOVI       QY--PSDVAGLILEPVVGNAGCLVPEIGFLEGLRDLTHAHGTVLIFDEVMTGFRLS-YGG
GSA_CHLSY       NR--GAEIAAVIVEPIAANMGFVLPKPGFLSGLRELTQTHGAIFILDEVMTGFRVA-AGG
GSA_CHLAA       NR--GAEIAAVIVEPIAANMGFVLPKPGFLSGLRELTQTHGAIFILDEVMTGFRVA-AGG
GSA_CHLAD       RR--GSEIAAVIVEPIAANMGFVLPKPGFLSGLRELTQQHGAIFILDEVMTGFRVA-PGG
GSA_ROSCS       AN--PGEVAAIAVEPVAGNMGLVLPQPGFLEGLRRLADEHGALLIFDEVMTGFRVG-YGG
GSA_ROSS1       AN--PGEVAAIAVEPVAGNMGLVLPQPGFLAGLRRLADEHGALLIFDEVMTGFRVA-YGG
GSA_HERA2       AN--AGQVAALVIEPVAGNMGFVLPREGYLAGLRQLCDQYGALLIFDEVMTGFRVA-YGG
GSA_FRACC       ER--GETIAAVITEAAAANMGVVPPLPGFNAGLRRLCDIHGALLILDEVMTGFRIS-RAG
GSA_FRASN       ER--GDTIAAVITESVAANMGVVPPLPGFNAGLRRLCDAHGALLVFDEVMTGFRVS-RTG
GSA_THEFY       EA--GDEIACVIAEACPANMGVVPPRDGFNAKLREITARHGALLILDEVLTGFRVS-PSG
GSA_STRAW       AH--PGEIACVITEASPGNMGVVPPAPGFNQGLKDACAENGALYISDEVMTGFRTS-KAG
GSA_STRCO       AH--PGEIACVITEASPGNMGVVPPLPGFNQGLKDACAANGALFVSDEVMTGFRTS-LAG
GSA_STRGG       AH--PGEIACVITEASPGNMGVVPPADGFNAGLKELCAANGALYISDEVMTGFRTS-KAG
GSA_MYCA1       EF--GDQIAAVITEASPGNMGVVPPAPGFNAALRALTAEHGALLIVDEVMTGFRVS-RSG
GSA_MYCPA       EF--GDQIAAVITEASPGNMGVVPPAPGFNAALRALTADHGALLIVDEVMTGFRVS-RSG
GSA_MYCMM       QH--GEQIAAVITEASPGNMGVVPPGRGYNAALRAVTAEHGALLIVDEVMTGFRVS-RSG
GSA_MYCUA       QH--GEQIAAVITEASPGNMGVVPPGRGYNAALRAVTAEHGALLIVDEVMTGFRVS-RSG
GSA_MYCBO       RF--GEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVS-RSG
GSA_MYCTA       RF--GEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVS-RSG
GSA_MYCBT       RF--GEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVS-RSG
GSA_MYCBP       RF--GEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVS-RSG
GSA_MYCTU       RF--GEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVS-RSG
GSA_MYCLE       RL--GDQIAAVITEASPGNMGVVPPAPGYNAALRAITAEHGALLIIDEVMTGFRVS-RSG
GSA_MYCLB       RL--GDQIAAVITEASPGNMGVVPPAPGYNAALRAITAEHGALLIIDEVMTGFRVS-RSG
GSA_RHOOB       AN--EGQIACVITEAAAGNMGAVAPQPGFNEGLRTLTRDNGALLIMDEVMTGFRVS-SAG
GSA_RHOJR       AN--EGRIACVITEAAAGNMGAVAPQPGFNEGLRKLTSDNGALLIMDEVMTGFRVS-SAG
GSA_NOCFA       AN--PGEIACVITEAAAGNMGAVAPLPGFNAGLRELTENHGALLIMDEVMTGFRVS-RSG
GSA_ACIC1       RY--GGEIACVIVEAAAANMGVVPPEPGFNRALADIAHENGALLVLDEVLTGFRVS-SAG
GSA_CORGL       EY--PGEIACIIAEAAGGNMGTVAPKDNFNDKLLAIAHADGALLILDEVMTGFRTS-YRG
GSA_CORGB       EY--PGEIACIIAEAAGGNMGTVAPKDNFNDKLLAIAHADGALLILDEVMTGFRTS-YRG
GSA_COREF       EF--PGQIACIISEAAAGNMGTVAPQDHFNEHLLAIAHADGALLILDEVMTGFRTS-YRG
GSA_CORDI       AH--PDQIACVIAEAAAGNMGTVAPQDNFNAKLKEVAHEHGALLILDEVMTGFRTS-YNG
GSA_CORA7       AH--PGEIACIIAEAAAGNMGTVAPEEGFNAALKEIAHADGALLILDEVMTGFRTS-YKG
GSA_CORJK       SH--EGEIAAIIVEGAAGNMGTVNPR-GFNAELQRIAHENGALLIVDEVMTGFRVS-ESG
GSA_CLAM3       EH--GPRIAAVITEAAAANMGVVPPLPGFTAELARIAHDNGSLLISDEVLTGFRVH-PAG
GSA_CLAMS       EH--GPRIAAVITEAAAANMGVVPPLPGFTAELARIAHDNGSLLISDEVLTGFRVH-PAG
GSA_LEIXX       AN--GPDIAAVIAEAAAANMGVVPPDEGFNAALTDLAHEYGALLILDEVLTGFRVS-EAG
GSA_KOCRD       EH--PGRIAAVITEAAPCNMGVVTPQDGFNAAIRRITQADGALMILDEVLTGFRVH-EAG
GSA_CUTAK       ER--GDQIAAVIVESCPANMGVVPPEPGFNAAIRRLTTEHGALMITDEVLTGFRCS-PSG
GSA_PROFF       ER--GDQVAAIVTEGVPANMGVIVPPEGFNRRLHDIAHAHGALLIQDEVLTGFRLS-PTG
GSA_TROW8       AY--PNQIACIITEACPANMGVIPPDPGFNARVADLGHSHGALIIFDEVITGFRVG-SGG
GSA_TROWT       AY--PNQIACIITEACPANMGVIPPDPGFNARVADLGHSHGALIIFDEVITGFRVG-SGG
GSA_ANAD2       AK--GASIAAVILEPVVGNMGVLVPRPGFLQGVHDLCRKHGALYIVDEVMTGFRLS-SGG
GSA_ANASK       AK--GASIAAVILEPVVGNMGVLVPRPGFLQGVHDLCRKHGALFIVDEVMTGFRLS-SGG
GSA_ANADE       AK--GASIAAVILEPVVGNMGVLVPRPGFLQGVHDLCKKHGALFIVDEVMTGFRLS-SGG
GSA_ANADF       ER--GGSIACVIIEPVVGNMGVLVPKDGYLQGLLALCRKHGALFIVDEVMTGFRVS-SGG
GSA_MYXXD       EN--GQDIACAIIEPVVGNMGVLVPKPGYLEGLQALCQKHGVLLVLDEVMTGFRLS-RGG
GSA_CARHZ       QE--GNDIAAVILEPVAGNMGVVPPKPGFLEGVRELTRKYGALLIMDEVMTGFRVH-WGG
GSA_PELTS       LE--GEDIAAVIVEPVAGNMGVVPPAPGFLEGLRNLTARYGSLLIFDEVITGFRLA-YGG
GSA_MOOTA       KA--GEEIAAVIVEPVAGNMGCVPPLTGFLAGLRTITKEYGSLLIFDEVMTGFRVA-FGG
GSA_THERP       QH--GERIAAVIVEPVAGNMGVVPPAAGFLSRLRELTRQAGALLIFDEVITGFRLG-LGG
GSA_THET2       RR--GEEIAAIIFEPVVGNAGVLVPTEDFLKALHE-AREFGVLLIADEVMTGFRLA-FGG
GSA_THET8       RR--GEEIAAIIFEPVVGNAGVLVPTEDFLKALHE-AKAYGVLLIADEVMTGFRLA-FGG
GSA_DEIRA       QR--GDEIAAVIFEPVVGNAGVLIPTSDFLAALHR-VRDFGAVLIADEVMTGFRLS-LNG
GSA_RHOBA       QH--GDDIAALILEPVVGNMGCVLPTMEFLNAARDLTTKHGSILIFDEVMTGFRVA-YGG
GSA_SORC5       AR--GGDIAAVILEPVVGNMGCVPPEPGFLALVIDLCRKHGALSIFDEVMTGCRLA-RGG
GSA_CALBD       EN--KDEIAAVIIEPVAGNMGVVPAKKEFLQVLREICNLHGSLLIFDEVITGFRLS-LKG
GSA_CALS8       EN--KDEISAVIIEPVAGNMGVVPAKKEFLQALREICDLHGSLLIFDEVITGFRLS-LKG
GSA_CLOAB       KY--KDEIAAVIIEPVAGNMGVIPAKKEFLVKLRELCTENQSILIFDEVMSGFRVA-YKG
GSA_CLOTE       KY--PEEIAAIIIEPIAGNMGTIPAKTEFLQRLREICTKYGALLIFDEVMTGFRVA-YKG
GSA_CLOBA       KY--GNEIAAVIIEPVAGNMGVIKANEDFIKELRDLCDEYGALLIFDEVMTGFRVA-FKG
GSA_CLOBB       KQ--GNEIAAVIIEPVAGNMGVIKANEDFIKELRSLCDEYGALLIFDEVMTGFRVA-FKG
GSA_CLOB8       KY--GNEIAGVIIEPVAGNMGVIKSENDFMETLRDLCNQYGSLLIFDEVMSGFRVA-FKG
GSA_CLOP1       KY--GNDIAGIIIEPVAGNMGVVKCDPKFMRKLRELCDKYGALLIFDEVMCGFRVA-YKG
GSA_CLOPS       KY--GNDIAGIIIEPVAGNMGVVKCDPKFMRKLRELCDKYEALLIFDEVMCGFRVA-YKG
GSA_CLOPE       KY--GNDIAGIIIEPVAGNMGVVKCDPKFMRKLRELCDKYGALLIFDEVMCGFRVA-YKG
GSA_CLOK5       KY--GSDTAAIIVEPVAGNMGVIPGRIDFLKGLRKLCDEYGSLLIFDEVMSGFRVA-YKG
GSA_AQUAE       EY--GSEIAGVIVEPIAGNMGVVPPKKEFLIRLRELTKEYGSLLMFDEVITGFRLS-KGG
GSA_HYDS0       KY--KNQIAAVLVEPVAGNMGVVLPKESWLKKLRDITKENDALLIFDEVITGFRLA-LGG
GSA_PERMH       KH--GDDIACVIIEPVAGNMGVVAPSKEYHQRLREITKEYGALLIWDEVMTGFRLA-YGG
GSA_SULSY       KY--GDDIACVIIEPVAGNMGVVAPSKEYHQKLREITRKYGALLIFDEVMTGFRLS-YGG
GSA_DESVH       LH--GKDIAAIIVEAVAGNMGLVPPKAGFLEGLRELCDQHGALLIFDEVITGFRVS-FGG
GSA_DESVV       LH--GKDIAAIIVEAVAGNMGLVPPKAGFLEGLRELCDQHGALLIFDEVITGFRVS-FGG
GSA_DESVM       LH--GKDIAAIIVEPVAGNMGLVLPMNGFLQGLRDLCTEHGALLIFDEVITGFRVN-YGG
GSA_DESAG       NH--GADIAAVIVEPTAGNMGLVRPAAGFLQGLRELCDRYGALLIFDEVITGFRLS-YGG
GSA_LAWIP       MY--GKDLAAVFVEPIAANMGLIPPKEGFLKGLRALCDAHGTLLIMDEVITGFRVA-YGG
GSA_SYNWW       QA--PADIAAVIVEPVAGNMGLVLPEPGFLEGLRQITKRYGALLIFDEVISGFRFC-FGG
GSA2_BACAN      QF--GDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVA-YNC
GSA2_BACHK      QF--GDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVA-YNC
GSA2_BACCZ      QF--GDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVA-YNC
GSA2_BACCR      QF--GDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVA-YNC
GSA2_BACC1      QF--GDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVA-YNC
GSA2_BACLD      EF--GDDIAGVIVEPVAGNMGVVPPVKGFLEGLRELTETHGALLIFDEVMTGFRVD-YNC
GSA_BACSU       QF--GEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRVD-YNC
GSA2_GEOKA      RF--GEDIAAVIVEPVAGNMGVVPPVPGFLEGLREVTKQYGALLIFDEVMTGFRVD-YHC
GSA2_BACSK      TF--GDDLAAVIVEPVAGNMGVVPPEPGFLETLRTWTEENGTLLIFDEVMTGFRVG-YTC
GSA2_BACHD      QF--GDDLAGVIVEPVAGNMGVVPPEPGFLEELRRLTEENGTLLIFDEVMTGFRVG-YHC
GSA1_STAAU      KF--GNDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAAC      KF--GNDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAA8      KF--GNDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAA3      KF--GNDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAAM      KF--GDDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAAN      KF--GDDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAAR      KF--GDDIAGVIVEPVAGNMGVVPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAAS      KF--GDDIAGVIVEPVAGNMGVVPPIEGFLQGLRNITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAAW      KF--GDDIAGVIVEPVAGNMGVVPPIEGFLQGLRNITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAAB      KF--GDDIAGVIVEPVAGNMGVIPPIEGFLQGLRDITTEYGALLIFDEVMTGFRVG-YHC
GSA1_STAES      KY--GDDIAGVIVEPVAGNMGVVPPVNGFLQGLRDITNEYGALLIFDEVMTGFRVG-YNC
GSA1_STAEQ      KY--GDDIAGVIVEPVAGNMGVVPPVNGFLQGLRDITNEYGALLIFDEVMTGFRVG-YNC
GSA2_STAS1      EF--GDDIAGVIVEPVAGNMGVVPPVEGFLQGLRDITTAYGSLLIFDEVMTGFRVG-YNC
GSA2_STAHJ      NY--GDDIAGIIVEPVAGNMGVVPPKDGFLQGLREITNDYGALLIFDEVMTGFRVG-YNC
GSA2_OCEIH      NY--GDRIAAIIMEPVCGNMGVVPPKDGFLQYVRHITEENGSLLIFDEVMTGFRVG-YHC
GSA1_LISMO      KY--GEEIAAVIVEPVAGNMGVVPPIEGFLEGLRELTTKFGSLLIFDEVMTGFRVD-YYS
GSA1_LISMF      KY--GEEIAAVIVEPVAGNMGVVPPIDGFLEGLRELTTKFGSLLIFDEVMTGFRVD-YYS
GSA1_LISIN      KF--GEEIAAVIVEPVAGNMGVVPPIDGFLEGLRELTTEYGALLIFDEVMTGFRVD-YYS
GSA_NATTJ       KY--GDDIAGVILEPVAGNMGVVPPNEGYLEGLRELTSKYGSLLIFDEVMTGFRVS-YGG
GSA_THEYD       EH--WKDIACVIVEPVVGNMGCILPKDEFLKVLRNETQKYGIVLIFDEVMTGFRVS-FGG
GSA_DESPS       DA--DLNIACVIVEPVAGNMGCVPPAPGFLQKLREITAEEGIVLIFDEVITGFRLS-YGG
GSA_SYNAS       RH--GKELACVIVEPVAANMGVVNPRPGFLETLRELTRKAGIVLIFDEVITGFRLA-YGG
GSA_DESOH       RK--GEQIACVIVEPVAGNMGMVEPDPGFLSALRKETEKHGCLLIFDEVMSGFRVA-YGG
GSA_SYNFM       RD--GDRIAAIILEPVAANMGLVLPRPGFLEGLRKLCDKHGALLIFDEVITGFRLA-RGG
GSA_GEODF       EN--KGQVACIIVEPVAGNMGTVPPREGFLEGLRTLCTQEGIVLIFDEVMSGFRVA-YGG
GSA_GEOUR       EN--KNQISCIIVEPVAGNMGTVPPREGFLEGLRSLCTEEGIVLIFDEVMSGFRVA-YGG
GSA_GEOBB       AN--KGSIACIIVEPVAGNMGTVPPKEGFLEGLRSICSEEGIVLIFDEVMSGFRVA-YGG
GSA_PELPD       DN--PESIACIIVEPVAGNMGTVPPRDGFLEGLRQICSNEGIVLIFDEVMTGFRVA-YGG
GSA_GEOLS       EN--SGQIACIILEPVAGNMGTVPPRPGFLEGLRELCTNEGIILIFDEVMSGFRVA-YGG
GSA_GEOMG       AH--SREVACIIVEPIAGNMGTVPPRAGFLEGLREICTNEGIILIFDEVMTGFRVA-YGG
GSA_GEOSL       EN--KNEIACIIVEPIAGNMGTVPPGEGFLEGLRSICDSEGIVLIFDEVMTGFRVA-YGG
GSA_PELCD       EH--KADLAAIILEPIAGNMGCVPPQPGFLEGLRALCDQHEILLIIDEVMTGFRVS-YGG
GSA_ECOL6       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOL5       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO45       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOK1       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO27       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOUT       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO81       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO24       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO8A       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO55       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOLC       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOSE       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOHS       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOLU       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO57       QY--PQEIACIIVEPVAGNMNCVPPLPDFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO5E       QY--PQEIACIIVEPVAGNMNCVPPLPDFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SHISS       QY--PQEIACIIIEPVAGNMNCVPPLPDFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECO7I       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECODH       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOLI       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ECOSM       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SHIB3       QY--PQEIACIIVEPVAGNMNCVPPQPEFLPGLRALCDEFGTLLIIDEVMTGFRVA-LAG
GSA_SHIBS       QY--PQEIACIIVEPVAGNMNCVPPQPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SHIDS       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SHIFL       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SHIF8       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ESCF3       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALDC       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALSV       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALA4       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALTI       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALG2       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALNS       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALEP       QY--PQEIACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALPB       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALCH       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALPC       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALPA       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALPK       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALHS       QY--PQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALTY       QY--PQEIASIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_SALAR       QY--PQEIACIIVEPVAGNMNCVLPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_CROS8       LY--PQDIACIIVEPVAGNMNCIPPQPDFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_ENT38       QY--PQEVACIIVEPVAGNMNCIPPQPDFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_KLEP3       QY--PQDIACIIVEPVAGNMNCIPPQPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_KLEP7       QY--PQEIACIIVEPVAGNMNCIPPQPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPE       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPP       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPN       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPG       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPA       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPS       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPB       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERP3       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERPY       QY--PQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LAG
GSA_YERE8       QY--PRDIACIIVEPVAGNMNCVPPLPEFLPGLRALCDKFGALLIIDEVMTGFRVA-LAG
GSA_ERWT9       QY--PQEIACIIVEPVAGNMNCVPPLPDFLPGLRALCDEFDALLIIDEVMTGFRVA-LAG
GSA_PECAS       QY--PDEIAAIIVEPVAGNMNCVPPLPDFLPGLRALCDEFGALFIIDEVMTGFRVA-LAG
GSA_PHOLL       QY--PQEIACIIVEPVAGNMNCVPPQPEFLPGLRALCDEFGALLIIDEVMTGFRVA-LSG
GSA_PROMH       NY--PEEIACIIVEPVAGNMNCVPPKADFLPGLRALCDEFGALLIIDEVMTGFRVA-LGG
GSA_SODGM       LY--PREIACVIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVE-LGG
GSA_ACTPJ       QY--PNEIACLIVEPVAGNMNCIPPKNDFLKGLRALCDQYGAVFIIDEVMTGFRVA-LGG
GSA_ACTP2       QY--PNEIACLIVEPVAGNMNCIPPKNDFLKGLRALCDQYGAVFIIDEVMTGFRVA-LGG
GSA_ACTP7       QY--PNEIACLIVEPVAGNMNCIPPKNDFLKGLRALCDQYGAVFIIDEVMTGFRVA-LGG
GSA_HAEPS       QY--PNDIACLIIEPVAGNMNCIPPKEGFLQGLRELCTQYGAVFIIDEVMTGFRVA-LGG
GSA_ACTSZ       RY--PQDIACLIIEPVAGNMNCVPPKPGFLQGVRELCDQYGALLIIDEVMTGFRVA-LGG
GSA_HAES1       QY--PDQIACVIVEPVAGNMNCILPKQDFLQGLRQLCNEYGSLFIIDEVMTGFRVA-LGG
GSA_HISS2       QY--PDQIACVIVEPVAGNMNCILPKQDFLQGLRQLCNEYGSLFIIDEVMTGFRVA-LGG
GSA_PASMU       QY--PNEIACLIVEPVAGNMNCIPPQEGFLQGLRALCDQYGAVFIIDEVMTGFRVA-LGG
GSA_MANSM       QY--PQDIACIIVEPVAGNMNCVPPQNNFLQGLRELCNQYGAVFIIDEVMTGFRVA-LGG
GSA_AERHH       QY--GSEIACIIVEPVAGNMNCIPPVPGFLEGLRAICDEAGALLILDEVMTGFRVS-LRG
GSA_AERS4       QY--GCDIACIIVEPVAGNMNCIPPVPGFLEGLRTICDEFGALLILDEVMTGFRVS-LRG
GSA_SHEB8       QY--PTDISCIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGFRVS-QSG
GSA_SHEB2       QY--PTDISCIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGFRVS-QSG
GSA_SHEB5       QY--PTDISCIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGFRVS-QSG
GSA_SHEB9       QY--PTEISCIIIEPVAGNMNCIPPIPGFLQGLRDICDEFGALMIIDEVMTGFRVS-QSG
GSA_SHEPC       QY--PTEISCIIIEPVAGNMNCIPPVPGFLQGLRDMCDEFGALLIIDEVMTGFRVS-QSG
GSA_SHESW       QY--PTEISCIIIEPVAGNMNCIPPVPGFLQGLRDMCDEFGALLIIDEVMTGFRVS-QSG
GSA_SHESM       QY--PIEIACIIIEPVAGNMNCIPPIPGFLEGLRTMCDEFGALLIIDEVMTGFRVS-RSG
GSA_SHESR       QY--PTEIACIIIEPVAGNMNCIPPIPGFLKGLRTMCDEFGALLIIDEVMTGFRVS-RSG
GSA_SHESA       QY--PTEISCIIIEPVAGNMNCIPPIPGFLEGLRAMCDEFGALLIIDEVMTGFRVS-RSG
GSA_SHEON       QY--PTEISCIIIEPVAGNMNCIPPIPGFLEGLRSLCDEFGALLIIDEVMTGFRVS-KSG
GSA_SHEHH       QY--PEEISCIIIEPVAGNMNCIPPIDGFLQGLRAICDQYGALMIIDEVMTGFRVS-KSG
GSA_SHEPA       QY--PEEISCIIIEPVAGNMNCIPPIDGFLQGLRAICDQYGALMIIDEVMTGFRVS-KSG
GSA_SHESH       QY--PEEISCIILEPVAGNMNCIPPVEGFLQGLRAICDQYGALMIIDEVMTGFRVS-KSG
GSA_SHEWM       QY--PEEISCIILEPVAGNMNCIPPVEGFLEGLRAICDQYGALLIIDEVMTGFRVS-KSG
GSA_SHEPW       QY--PDAISCIILEPVAGNMNCIPPVEGFLEGLRAICDQYGALMIIDEVMTGFRVS-KSG
GSA_SHELP       QY--PEEIACIILEPVAGNMNCIPPIPGFLEGLRALCDQYGALLIIDEVMTGFRVS-KSG
GSA_SHEAM       QY--PEDIACIIIEPVAGNMNCIPPVPGFLEGLRALCDKYGALFIIDEVMTGFRVS-RSG
GSA_SHEDO       LH--PDAISCIILEPVAGNMNCIPPIPGFLQGLRGLCDEFGALLIIDEVMTGFRVA-MGG
GSA_SHEFN       QN--PESIACIILEPVAGNMNCIPPVEGFLQGLRTICDEFGALLIIDEVMTGFRVS-MSG
GSA_ALIF1       VN--KGEIACIIVEPVAGNMNCIPPVEGFHEGLRQICDEEGALLIFDEVMTGFRVA-ENC
GSA_ALIFM       AN--KGEIACIIVEPVAGNMNCIPPVEGFHEGLRQICDEEGALLIFDEVMTGFRVA-ENC
GSA_ALISL       AN--KGEISCIIVEPVAGNMNCIPPVEGFHEGLREICDAEGALLIFDEVMTGFRVA-ENC
GSA_VIBCH       AN--QGEIACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGFRVA-LGG
GSA_VIBC3       AN--QGEIACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGFRVA-LGG
GSA_VIBCM       AN--QGEIACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGFRVA-LGG
GSA_VIBVU       AN--KGEIACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGFRVA-LGG
GSA_VIBVY       AN--KGEIACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGFRVA-LGG
GSA_VIBPA       AN--KGEIACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGFRVA-LGG
GSA_VIBTL       AN--KGEIACIIVEPVAGNMNCIPPVEGFHEGLREICDQEGALLIFDEVMTGFRVA-EGC
GSA_PHOPR       AH--PEQIACIIVEPVAGNMNCIPPVPGFLEGLRTICDDFGALLILDEVMTGFRVS-EGG
GSA_COLP3       KY--ADEIACIIVEPVAGNMNCIPPVEGFLEGLRDVCDQYSSVLIFDEVMTGFRVA-LGG
GSA_PSEHT       KY--ADEIACIIVEPVAGNMNCIPPVPGFLEGLRDVCDEYKSVLIFDEVMTGFRVA-LGG
GSA_IDILO       EM--GDEIACIIVEPVAGNMNCIPPVDGFLEGLRSICDDHGSVLIFDEVMTGFRVA-PGG
GSA_PSYIN       EY--KDQIACIIVEPVAGNMNCILPQEGFLQGLREICDANDALLILDEVMTGFRVA-LGG
GSA_PSEA6       QY--PDDIACIIVEPVAGNMNCIPPVHGFLQGLRDVCDKYGAVLIFDEVMTGFRVA-LGG
GSA_ACIF2       QF--GFDVATIIVEPVAGNMGCVPPEPGFLEGLRAVCDQYGCVLIFDEVMTGFRVA-LGG
GSA_ACIF5       QF--GFDVATIIVEPVAGNMGCVPPEPGFLEGLRAVCDQYGCVLIFDEVMTGFRVA-LGG
GSA_METCA       RH--GAEIACIIVEPVAGNMNCVPPVPGFLETLRDVCDASGAVLIFDEVMTGFRVA-LGG
GSA_PSEAE       EV--GKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVA-LGG
GSA_PSEA8       EV--GKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVA-LGG
GSA_PSEAB       EV--GKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVA-LGG
GSA_PSEA7       EV--GTDVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVA-LGG
GSA_PSEE4       EV--GQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGFRVS-LGG
GSA_PSEPW       EV--GQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGFRVS-LGG
GSA_PSEP1       EV--GQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGFRVS-LGG
GSA_PSEPK       EV--GQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGFRVS-LGG
GSA_PSEPG       EV--SQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGFRVS-LGG
GSA_PSEF5       EV--GQEVACIIVEPVAGNMNCVPPAPGFLEGLRRLCDQHGVVLIFDEVMTGFRVA-LGG
GSA_PSEPF       EV--GQDVACIIVEPVAGNMNCVPPAPGFLEGLRSLCDKHGVVLIFDEVMTGFRVA-LGG
GSA_PSEMY       QV--GKEVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTGFRVA-LGG
GSA_PSE14       EV--GQEVACIIVEPVAGNMNCVPPAPGYLQGLRDLCDEHGVVLIFDEVMTGFRVA-LGG
GSA_PSEU2       EV--GQEVACIIVEPVAGNMNCVPPAPGYLQGLRELCDEHGVVLIFDEVMTGFRVA-LGG
GSA_PSESM       EV--GQEVACIIVEPVAGNMNCVPPAPGYLQGLRALCDEHGVVLIFDEVMTGFRVA-LGG
GSA_PSEU5       EK--GEQVACIIVEPVAGNMNCVPPAPGFLEGLRRLCDAHGVVLIFDEVMTGFRVA-LGG
GSA_ACIB5       KF--GHEIAGVIIEPVAGNMNMVKPIDGFLQAIRDVCDEYKSVFIIDEVMTGFRVA-LGG
GSA_ACIB3       KF--GHEIAGVIIEPVAGNMNMVKPIDGFLQAIRDVCDEYKSVFIIDEVMTGFRVA-LGG
GSA_ACIBT       KF--GHEIAGVIIEPVAGNMNMVKPIDGFLQAIRDVCDEYKSVFIIDEVMTGFRVA-LGG
GSA_ACIBY       KF--GHEIAGVIIEPVAGNMNMVKPIDGFLQAIRDVCDEYKSVFIIDEVMTGFRVA-LGG
GSA_ACIBC       KF--GHEIAGVIIEPVAGNMNMVKPIDGFLQAIRDVCDEYKSVFIIDEVMTGFRVA-LGG
GSA_ACIBS       KF--GHEIAGVIIEPVAGNMNMVKPIDGFLQAIRDVCDEYKSVFIIDEVMTGFRVA-LGG
GSA_ACIAD       KF--GHEIAGVIVEPVAGNMNLVTPIDGFLQAIRDVCDEYGSVFIIDEVMTGFRVA-LGG
GSA_PSYA2       KW--GEEIACVILEPIAGNMNMVIPSQEFHDTLREQCTANNSVLIFDEVMTGFRVG-LGG
GSA_PSYCK       KW--GEEIACVILEPIAGNMNMVIPSQEFHDTLRAECTANGAVLIFDEVMTGFRVG-LGG
GSA_RUTMC       EV--GAEVACIIVEPVAGNMNCIPPIDGFLQVLRELCDEYGVILVFDEVMTGFRVA-LGG
GSA_VESOH       EV--GTEVACIIVEPVAGNMNCILPIDGFLQGLRKLCDEYGIILIFDEVMTGFRVA-LGG
GSA_HAHCH       RH--GDEIAAIIVEPVAGNMNCIPPEPGFLETLRAVCDEHGSLLIFDEVMTGFRVA-LGG
GSA_MARHV       QM--GDQIAAIIVEPVAGNMNCIPPVPGFLEALREVCDEHGTVLIFDEVMTGFRVS-LGG
GSA_MARMS       EI--GDQIACIIVEPVAGNMNCILPVEGFLETLRKVCDESGAVLIFDEVMTGFRVA-LGG
GSA_HYDCU       EI--GDQIACIIVEPVAGNMNCIPPEDGFLETLREVCDESGAVLIFDEVMCGFRVG-LTG
GSA_ALKEH       RM--GDEIAAVIVEPVAGNMNCVPPVPGFLEALRECCDDHGSVLIFDEVMTGFRVG-VQC
GSA_HALHL       EH--GSEIAAVIVEPVAGNMNCVPPVPGFLEKLREVCDRTDALLIFDEVMTGFRVG-PQC
GSA_STRMK       QQ--GDDIAGLIIEPVVGNANCIPPREGYLQHLRALCTKHGALLIFDEVMTGFRVA-LGG
GSA_STRM5       QQ--GDDIAGLIIEPVVGNANCIPPRDGYLQHLRELCTKHGTLLIFDEVMTGFRVA-LGG
GSA_XANCH       EI--GAEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XANC5       EI--GAEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XANAC       EI--GAEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XANOR       EI--GPEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XANOM       EI--GPEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XANCP       EI--GAEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XANC8       EI--GAEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XANCB       EI--GAEVAAVIIEPVVGNANCIPPQAGYLQHLRTLCTRHGALLIFDEVMTGFRVA-LGG
GSA_XYLF2       EM--GHHIAAVIVEPVIGNANCIPPQPGYLQHLRTLCTQYAVLLIFDEVMTGFRVA-LGG
GSA_XYLFT       EM--GHHIAAVIVEPVIGNANCIPPQPGYLQHLRTLCTQYAVLLIFDEVMTGFRVA-LGG
GSA_XYLFM       EM--GHHIAAVIVEPVIGNANCIPPRPGYLQHLRTLCTQYGVLLIFDEVMTGFRVA-LGG
GSA_XYLFA       EM--GHHIAAVIVEPVIGNANCIPPRPGYLQHLRTLCTQYAVLLIFDEVMTGFRVA-LGG
GSA_CHRSD       EL--GDEIAGIIVEPVAGNMNCIPPQPDFLKGLREICDVHGSVLIFDEVMTGFRVA-LGG
GSA_NITOC       HF--GEQIAAIIVEPVAGNMNCVPPVPGFLEGLRTICDDYGSVLIFDEVMTGFRVA-LGG
GSA_THISH       HV--GGQVACIIVEPVAGNMNCIPPVPGFLEGLRELCDEYGALLIFDEVMTGFRVA-LGG
GSA_ACISJ       LH--GPDVACVIMEPIAGNMNFVRASVPFMRRARELCTQHGALLVIDEVMTGFRVA-LGG
GSA_ACIET       LH--GPDVACVIMEPIAGNMNFVRASVPFMRRARELCTQHGALLVIDEVMTGFRVA-LGG
GSA_ACIAC       LH--GSEIAGLMIEPIAGNMNFVRASVPFMRRCRELCTQHGALLVFDEVMTGFRVA-LGS
GSA_VEREI       LH--GKELACLIIEPIAGNMNLVRASVPFMRRCRELCSEYGALLVLDEVMTGFRVA-PGG
GSA_RHOFT       MQ--GSEIACLMMEPICGNMNFVRASVPFVKRCRELCTQYGALLVFDEVMTGFRVA-LGG
GSA_LEPCP       IH--GPELACVMIEPIAGNMNFVRATVPFMKRIRELCTQHGALLVFDEVMCGFRVA-LGS
GSA_AZOSB       AR--GDQIAAVIVEPVAGNMNLIKPRPGFLEGLRRLCTEYGAVLIFDEVMTGFRVG-PQG
GSA_AROAE       AR--GGEIAAVIVEAIAGNMNLVKPLPGFLEGLRRLCTEYGVVLIFDEVMTGFRVG-PQG
GSA_BORBR       QH--GAEIACVIVEPVAGNMNLIKPAEGFLAGLRELCTRHGAVLIFDEVMTGFRVG-PQG
GSA_BORPA       QH--GAEIACVIVEPVAGNMNLIKPAEGFLAGLRELCTRHGAVLIFDEVMTGFRVG-PQG
GSA_BORPE       QH--GAEIACVIVEPVAGNMNLIKPAEGFLAGLRELCTRHGAVLIFDEVMTGFRIG-PQG
GSA_BORPD       QH--GADIACVIVEPVAGNMNLIKPAAGFLQGLRDVCTQHGAVLIFDEVMTGFRVG-PQG
GSA_BORA1       EH--GRDIACVIVEPVAGNMNLIKPAAGFLEGLRELCTRHGSVLIFDEVMTGFRVG-PQG
GSA_BURCM       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURA4       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURL3       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURCA       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURCH       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURCC       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCMKHGAVLIFDEVMCGFRVA-LGG
GSA_BURCJ       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURVG       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURM1       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_BURMA       AF--GGEIAAVIVEPVAGNMNLVRGTPEFLNALRALTAKHGAVLIFDEVMCGFRVA-LGG
GSA_BURP1       AF--GGEIAAVIVEPVAGNMNLVRGTPEFLNALRALTAKHGAVLIFDEVMCGFRVA-LGG
GSA_BURPS       AF--GGEIAAVIVEPVAGNMNLVRGTPEFLNALRALTAKHGAVLIFDEVMCGFRVA-LGG
GSA_BURM9       AF--GGEIAAVIVEPVAGNMNLVRGTPEFLNALRALTAKHGAVLIFDEVMCGFRVA-LGG
GSA_BURP0       AF--GGEIAAVIVEPVAGNMNLVRGTPEFLNALRALTAKHGAVLIFDEVMCGFRVA-LGG
GSA_BURTA       AF--GDEIAAVIVEPVAGNMNLVRGTPEFLNALRALCTKHGAVLIFDEVMCGFRVA-LGG
GSA_PARPJ       AF--GNEIASVIVEPVAGNMNLVRATPEFLQALRRLCTEHGSVLIFDEVMCGFRVA-LGG
GSA_PARXL       AF--GNEIASVIVEPVAGNMNLVRATPEFLQALRRLCSEYGSVLIFDEVMCGFRVA-LGG
GSA_PARP8       AF--GNEIASVIVEPVAGNMNLVRATPEFLGALRRLCSEYGSVLIFDEVMCGFRVA-LGG
GSA_CUPTR       KH--AGEIAAVIVEPVAGNMNLVRASDAFLQAMRELCTRDGAVLIFDEVMTGFRVA-LGG
GSA_CUPNH       RH--AGEIAAVIVEPVAGNMNLVRASDAFLKAMRELCTRDGAVLILDEVMTGFRVA-LGG
GSA_CUPPJ       QH--RGEIAAVIVEVVAGNMNLVRASDAFLKAMRELCTRDGAVLIFDEVMTGFRVA-LGG
GSA_CUPMC       RH--KGEIAAVIVEPVAGNMNLVRASEAFLTAMRNLCSEHGSVLIFDEVMTGFRVA-LGG
GSA_RALPJ       RH--GKEIAAVIVEPVAGNMNLVRGSNEFHQAMRALCTEHGAVLIFDEVMTGFRVA-LGC
GSA_RALSO       RH--GKEIAAVIVEPVAGNMNLVRATAAFLQAMRALCTEHGAVLIFDEVMTGFRVA-LGC
GSA_HERAR       EI--GNQIACVIVEPVAGNMNLLPATPEFLQTMRRVCTQYGAVLIFDEVMSGFRVA-LGG
GSA_JANMA       EM--GDSIACVIVEPVAGNMNLLPATPEFLQTMRRVCTQYGAVMILDEVMSGFRVA-LGG
GSA_CHRVO       EI--GDKIACVILEPIAGNMNLIQPSREFVQALRQLTEKHGAVLIYDEVMTGFRVA-KGC
GSA_LARHH       EI--GERIACVILEPVAGNMNLIRPSAAFVQALRTLTQQHGSVLIYDEVMTGFRVA-LGG
GSA_NEIG1       QS--GDEIACVIVEPFVGNMNLVRPTEAFVKALRGLTEKHGAVLIYDEVMTGFRVA-LGG
GSA_NEIG2       QS--GDEIACVIVEPFVGNMNLVRPTEAFVKALRGLTEKHGAVLIYDEVMTGFRVA-LGG
GSA_NEIM0       QS--GNDIACVILEPFVGNMNLVRPTEAFVKALRELTEKHGAVLIYDEVMTGFRVA-LGG
GSA_NEIMF       QS--GNDIACVILEPFVGNMNLVRPSEAFVKALRELTEKHGAVLIYDEVMTGFRVA-LGG
GSA_NEIMA       QS--GNDIACVILEPFVGNMNLVRPSEAFVKALRELTEKHGAVLIYDEVMTGFRVA-LGG
GSA_NEIMB       QS--GNEIACVIVEPFVGNMNLVRPTEAFVKALRGLTEKYGAVLIYDEVMTGFRVA-LGG
GSA_NITEU       KM--GTEIAAVIVEPVAGNMNLIKATSQFLETLRTLCTKHGSLLILDEVMTGFRVG-LEC
GSA_NITEC       KL--GSEIAAVIVEPVAGNMNLIKATPQFLETLRTLCTKHSSLLILDEVMTGFRVG-LEC
GSA_NITMU       QF--GAEIAAVIVEPVAGNMNLIAPQPGFLAGLRELCTRHGSVLIFDEVMTGFRVG-LEC
GSA_DECAR       KH--GDKIAAVIVEPVVGNMNLIAPTQAFLNAMRDLCTKNGSVLIFDEVMTGFRVG-LKS
GSA_METFK       EL--GKEIACVILEPVAGNMNLVRPTPEFLGALRSLCTHSGTLLIFDEVMTGFRVA-LGG
GSA_THIDA       EI--GDEIACIIVEPFAGNMNLVKPSAEFMAAMRRLCDEHGALLIFDEVMTGFRVD-LGC
GSA_SACD2       EI--GDQIACVIVEPVAGNMNCIPPIAGFLETLREECTKAGSLLILDEVMTGFRLG-ITG
GSA_COXBU       KY--SKDIAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGFRVA-KGG
GSA_COXBR       KY--SKDIAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGFRVA-KGG
GSA_COXB2       KY--SKDIAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGFRVA-KGG
GSA_COXB1       KY--SKDIAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGFRVA-KGG
GSA_COXBN       KY--SKDIAAIIVEPIAGNMNLIPAAPDFLTGLRELCNQYGSLLIFDEVITGFRVA-KGG
GSA_FRATF       KY--KDEIACIIVEPIAGNMNMIFPQDGFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRATO       KY--KDEIACIIVEPIAGNMNMIFPQDGFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRATH       KY--KDEIACIIVEPIAGNMNMIFPQDGFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRATM       KY--KDEIACIIVEPIAGNMNMIFPQDDFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRATW       KY--KDEIACIIVEPIAGNMNMIFPQDDFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRATT       KY--KDEIACIIIEPIAGNMNMIFPQDDFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRAT1       KY--KDEIACIIIEPIAGNMNMIFPQDDFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRATN       KY--KDEIACIIVEPIAGNMNMIFPQDNFLAKLRAICDQNSSLLIFDEVMTGFRVA-LGG
GSA_FRAP2       KY--KNEIACIIVEPIAGNMNMIFPQDDFLAKLRAVCDENNSLLIFDEVMTGFRVA-LGG
GSA_LEGPC       KY--PNDIATVILEPVPGNMGFILPKIEFLKGLRELCDQYNALLIFDEVMTGFRVG-LHG
GSA_LEGPH       KY--PNDIATVILEPIPGNMGFILPKIEFLKGLRELCDQYNALLIFDEVMTGFRVG-LHG
GSA_LEGPL       KY--PNDIATVILEPVPGNMGFILPKIEFLKGLRELCDQYNALLIFDEVMTGFRVG-LHG
GSA_LEGPA       KY--PNDIATVILEPVPGNMGFILPKIEFLKGLRELCDQYNALLIFDEVMTGFRVG-LHG
GSA_CAMC1       NN--KDKIGVVIIEPIAGNMGLVPADKKFLRELRELCDKFGAVLILDEVMSGFRAS-RLG
GSA_CAMC5       SN--PGKIGAVIIEPIAGNMGLVPADKEFLQSLRALCDKFGAVLILDEVMSGFRAS-EFG
GSA_CAMFF       N----EDIGVIIVEPIAGNMGLVPADQVFLDALRKLCDEYGAVLIFDEVMSGFRAS-ATG
GSA_CAMHC       K----EDIGTIIIEPIAGNMGLVPADKEFLIKLRKICDEKKIVLILDEVMSGFRAG-ELG
GSA_CAMJE       KN---KDIACVIIEPIAGNMGLVPAKQDFLEELAKICKNNQTLLIFDEVMSGYRAS-YLG
GSA_CAMJ8       KN---KDIACVIIEPIAGNMGLVPAKQDFLEELAKICKNNQTLLIFDEVMSGYRAS-YLG
GSA_CAMJJ       KN---KDIACVIIEPIAGNMGLVPAKQDFLEELAKICKNNQTLLIFDEVMSGYRAS-YLG
GSA_CAMJR       KN---KDIACVIIEPIAGNMGLVPAKQDFLEELAKICKNNQTLLIFDEVMSGYRAS-YLG
GSA_CAMJD       KN---KDIACVIIEPIAGNMGLVPAKQDFLEELAKICKNNQTLLIFDEVMSGYRAS-YLG
GSA_HELPH       KK--G-NVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVMSGFRAS-LSG
GSA_HELP2       KK--G-DVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVMSGFRAS-LSG
GSA_HELPG       KK--G-DVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVMSGFRAS-LSG
GSA_HELPS       KK--G-DVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVMSGFRAS-LSG
GSA_HELPJ       KK--G-DVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVMSGFRAS-LSG
GSA_HELPY       KK--G-NVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVMSGFRAS-LSG
GSA_HELAH       QK--G-NVGCVIIEPIAGNMGLVPAQKEFLVGLKALCEKYQAVLILDEVMSGFRAS-LSG
GSA_HELHP       EQ--SKNVACVIIEALAGNMGFVPADKKFMQDLRALCDEYNALLIIDEVMSGFRAG-LKG
GSA_WOLSU       KK--SSGVACVILEPIAGNMGLVPATQEFIQGLRKLCDEQGSVLIFDEVMSGFRAS-FGG
GSA_SULDN       DS--KD-VACVIIEPIAGNMGLVPADKEFLRELRELCDANGALLIFDEVMSGFRAS-VHG
GSA_SULNB       DS--PEGIACVIIEPIAGNMGLVPADETFLQQLRALCDAHGTLLIFDEVMSGFRAS-LKG
GSA_STRSV       KY--GDDIACVILEAVAGNMGLIPADADFINTIRSLTQEYGSLFIVDEVMSGFRAH-YQG
GSA_CHLP8       EN--KGQVAAIIIEPVAGNTGVIPAKKEFLVALRELCDAEGIVLIFDEVMCGFRVA-LGG
GSA_CHLTE       EN--KGQVAAIIIEPVAGNTGVIPAKKEFLVALRELCDAEGIVLIFDEVMCGFRVA-LGG
GSA_CHLL2       EN--RGDIAAIIIEPVAGNTGVIPAKKEFLVALRELCDQEGIVLIFDEVMCGFRVA-LGG
GSA_CHLCH       EN--KGNVAAIIIEPVAGNTGVIPAQPGFLAALRQLCDEEGIVLIFDEVMCGFRVA-LGG
GSA_PELPB       EN--KGQIAAIIIEPVAGNTGVIPAKPGFLAALRELCTEEGIVLIFDEVMCGFRVA-LGG
GSA_CHLPD       EN--KNNIAAIIIEPVAGNTGVIPAKPGFLADLRNLCDQNGIVLIFDEVMCGFRVA-LGG
GSA_CHLPB       EN--KDSIAAIIIEPVAGNTGVIPAKTDFLQALRDLCTEEGIVLIFDEVMCGFRVA-LGG
GSA_PROA2       EN--KGNIAAIIIEPVAGNTGVIPAKPGFLQALRDLCTEEGIVLIFDEVMCGFRVA-LGG
GSA_PELLD       EN--KGNIAAIIIEPVAGNTGVIPAKKEFLQALRDLCDREGIVLIFDEVMCGFRVA-LGG
GSA_CHLPM       EN--KGNIAAIIIEPVAGNTGVIPAKKEFLQALRDLCDREGIVLIFDEVMCGFRVA-LGG
GSA_CHLT3       SN--KGNVAAIIIEAVGGNMGVVPSKKEFLVALRELCDKEGIVLIFDEVMTGFRVA-LGG
GSA_CYTH3       KN--KNKIAAIIIEPVAGNMGCVLPKAGFLEALREICDQENIVLIFDEVMSGFRLS-VSG
GSA_SALRD       AN--QGEVACIIVEPIAGNMGCIPPEPGFLEGLRELCDAHDIVLVFDEVMTGFRVA-PGG
GSA_HUNT2       QN--KGNIAAVIVEPVAANMGVVPPKDNFLEELRKLCDKEEALLIFDEVITGFRLA-IGG
GSA_FLAJ1       AN--KGEIAAIIIEAVAGNMGCIPPAEGFLQGLRDLCTANGILLIFDEVMTGFRLA-RGG
GSA_FLAPJ       AN--KNEIAAVIIEPVAGNMGCIPPQKGFLEALQQLCHENNALLIFDEVMTGFRLA-KGG
GSA_GRAFK       AN--KEEIACIILEPVAGNMGCIPPAEGFLEGLRKLCDETGILLIFDEVMTGFRLA-AGG
GSA_WIGBR       LY--PNKIACIIVEPIAGNMGCVLPEKNFLYKLRMLCNKFNSLLIMDEIITGFRIS-LGG
GSA_CHLTR       S--LGHKVAGVIFEPVCANMGVILPVPGFIEGVIQTCQQTGSFSIMDEVVTGFRVA-QGG
GSA_CHLTA       S--LGHKVAGVIFEPVCANMGVILPVPGFIEGVIQTCQQTGSFSIMDEVVTGFRVA-QGG
GSA_CHLT2       S--LGHKVAGVIFEPVCANMGVILPVPDFIEGVIQTCQQTGSFSIMDEVVTGFRVA-QGG
GSA_CHLTB       S--LGHKVAGVIFEPVCANMGVILPVPDFIEGVIQTCQQTGSFSIMDEVVTGFRVA-QGG
GSA_CHLMU       Q--IGHRVAGVIFEPICANMGVVLPLPGFIEGIIQTCRKTGSLSIMDEVVTGFRVS-KGG
GSA_CHLFF       Q--IGERVACVIFEPICINMGVILPKHGFIESILAMCRRYSALSIMDEVVTGFRMG-IRG
GSA_CHLCV       K--IGERVACVIFEPIAINMGVVLPEAGWIESIITTCRRYGALSIMDEVVTGFRMG-SRG
GSA_CHLAB       Q--VGERVACVIFEPIAINMGVVLPKPGFIEGVITISRRFAALTIMDEVVTGFRMG-IRG
GSA_CHLPN       A--LGPQVAGIIFEPICANMGIVLPKAEFLDDIIELCKRFGSLSIMDEVVTGFRVA-FQG
GSA_PARUW       HSDYRHKIAAIILEPIAGNMGVIPASQEFMQFLRKETLAMGALLIFDEVMTGFRVA-LKG
GSA_LEPIN       TE--GKNIAALIIEPLPANYGLLIQRKEFLLKIVETARKYGTLVVFDEVISGFRVG-FQG
GSA_LEPIC       TE--GKNIAALIIEPLPANYGLLIQRKEFLLKIVETARKYGTLVVFDEVISGFRVG-FQG
GSA_LEPBL       SE--GKNIAALIIEPLPANYGLLVQRKEFLLKIVEIAKKYGTLVVFDEVISGFRTG-FQG
GSA_LEPBP       RE--GSNIACLAIEPLPANYGLLPQRIEFLKKCRELTTKYGVLLLFDEVISGFRVS-FQG
GSA_BDEBA       AQ--GKDIAAVIIEPLPANYGLLVQRPEFLKKVAELCEKNGSLLIFDEVISGFRVG-LGG
GSA_FUSNN       N----KDVACVIVEPIPANMGLIETHKEFLQGLGKVTEKTGTILIFDEVISGFRLA-LGG
GSA_METI4       RQ--GKETAAVILEPVLANCGLIPPEEGFLECLFKTAREYGTLVIFDEVITGFRLA-LGG
GSA_AERPE       EY--GDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGFRLG-LEG
GSA_HYPBU       KH--GDEVAAIIVEPVAGNAGVIPPKKGFLQELRRIASEHGALLIMDEVITGFRLA-LGG
GSA_SULAC       S----EDIAGVIVEPVMGNMGVILPDKDFLERLREITLTYNSVLIFDEVITGFRLG-LGG
GSA_SULTO       T----EEIAGVIVEPVMGNMGVILPEQDFLNGLRELTKTYNSVLIFDEVITGFRLG-LSG
GSA_SACS2       N----EDIATVILEPVMGNAGVILPEKDFLFGLRELTKTYNSLLIFDEVITGFRIS-IGG
GSA_PYRAE       EV--GDRLAAVIVEPVAGNYGLIIPDVEFLKALREETQRAGALLIFDEVITGFRVG-LGG
GSA_PYRCJ       EV--GDRLAAVIVEPIAGNYGLILPEVEFLKALREETERVGALLIFDEVITGFRVG-LGG
GSA_THEAC       QY--GSRIAAVITEPIMGNAGVITPEPGFLEFLRDITQKNGSLLIFDEVITGYRFA-FSP
GSA_THEVO       KY--GDKIAAVITEPIMGNAGVILPKQGFLEFLRDITQKHGSLLIFDEVITGYRFA-FSP
GSA_PICTO       EY--GNDIAAVITEPILGNIGVINPEPGFLEFLREITNKYNSLLIFDEVITGFRFA-FSG
GSA_ARCFU       ----KNEVAALILEPVMGNSSLILPEKDYLKEVRKVTAENDVLLIFDEVITGFRVS-MGG
GSA_METAR       AH--KDEIACLIMEPVMGNMGPILPKDMYLRAVRNVTRDYDVLLIFDEVITGFRVS-IFG
GSA_METAC       KN--RDDLAAVIIEPVLGNIGPILPLPGYLKELRKLTKENDVLLIFDEVITGFRLA-MGG
GSA_METMA       KN--RDDLAAVIIEPVLGNIGPVLPLPGYLEELRKLTEENDVLLIFDEVITGFRLA-MGG
GSA_METBF       KN--RDELAAVIIEPVLGNIGPITPLPGYLEELRKLTLENDVLLIFDEVITGFRLA-MGG
GSA_METJA       EN--KDEIACIIVEPIMGNVGCILPKEGYLEFLREITEENDILLIFDEVITGFRLA-KGG
GSA_METMP       EN--KEEIACIILEPVMGNVGCIPPKDGYLQFLREITEENGILLIFDEVITGFRLS-KGG
GSA_METST       EN--KDEIACIIVEPVMGNIGCVPPKEGYLDFLREITLENGILLIIDEVITGFRIS-KGG
GSA_METTH       GA--GEDIACILVEPVMGNIGCIEPENGYLQFLRDITRENDIILIFDEVITGFRLA-PGG
GSA_METKA       RF--DEEIGAVIVEPVLGNAGCVPPDEEFLKVLREYCDGTERLLIFDEVITGFRLE-LGG
GSA_HALMA       EH--GDDIAAVLTEPILGNYGIVHPVEGYHDTLRQLCDDHGSLLIFDEVITGFRVGGLQC
GSA_HALLT       EH--GDDIAAVLVEPILANMGIVTPIDGYHETLRDLCDDHDSLLVFDEVITGFRVGGLGC
GSA_HALSA       TH--GDDIAAVLVEPILANKGIVEPVAGYHETLRDLTHDHGALLIWDEVITGFRVGGLGC
GSA_HALS3       TH--GDDIAAVLVEPILANKGIVEPVAGYHETLRDLTHDHGALLIWDEVITGFRVGGLGC
GSA_NATPD       AH--GDDIAAVLVEPVQANMGIVYPEDGYHEALRSLCDDYGSLLIFDEVITGFRVGGLQC
                        .    *    * .       :             . : **:: . *      

GSA1_BACAN      AQDLLGV-----------------------TPDLTALGKVIGGGLPIGAYGGKKEIMEQV
GSA1_BACHK      AQDLLGV-----------------------TPDLTALGKVIGGGLPIGAYGGKKEIMEQV
GSA1_BACCR      AQDLLGV-----------------------TPDLTALGKVIGGGLPIGAYGGKKEIMEQV
GSA1_BACCZ      AQDLLGV-----------------------TPDLTALGKVIGGGLPIGAYGGKKEIMEQV
GSA1_BACC1      AQDLLGV-----------------------TPDLTALGKVIGGGLPIGAYGGKKEIMEQV
GSA1_BACLD      AQDLLGV-----------------------KPDLTALGKIIGGGLPIGAYGGRKEIMEQV
GSAB_BACSU      AQDLLQV-----------------------KPDLTALGKIIGGGLPIGAYGGKQEIMEQV
GSA1_GEOKA      AQNLLGV-----------------------EPDLTAMGKIIGGGLPIGAYGGRQDIMEQV
GSA1_OCEIH      AQQIYGV-----------------------EPDMTAMGKIIGGGLPIGAYGGRKDIMEQV
GSA2_LISMO      AQNYLGV-----------------------IPDLTAMGKIIGGGLPIGAYGGRIDIMEKV
GSA2_LISMF      AQNYLGV-----------------------IPDLTAMGKIIGGGLPIGAYGGRIDIMEKV
GSA2_LISIN      AQNYLGV-----------------------IPDLTAMGKIIGGGLPIGAYGGRVDIMEKV
GSA1_BACSK      AQDYLNV-----------------------KPDMTALGKIIGGGLPIGAYGGRMDIMEQV
GSA1_BACHD      AQNYVGV-----------------------EPDMTALGKIIGGGLPIGAYGGRIDIMEKV
GSA2_STAAC      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAA3      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAAR      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAAB      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAAS      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAAW      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAAM      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAAN      AQDLLGV-----------------------IPDLTAFGKIVGGGLPIGGYGGRQDIMEQV
GSA2_STAES      AQDLLGV-----------------------KPDLTAFGKIVGGGLPIGGYGGRQDIMEHV
GSA2_STAEQ      AQDLLGV-----------------------KPDLTAFGKIVGGGLPIGGYGGRQDIMEHV
GSA1_STAS1      AQDLYKV-----------------------YPDLTAFGKIIGGGLPIGGYGGKQEIMEQV
GSA_SYMTH       AQTLLGI-----------------------EPDLTTLGKIIGGGLPLAAYGGRAEIMDWV
GSA_ACAM1       AQEKFGI-----------------------TPDLTTLGKVIGGGLPVGAYGGRRDIMSMV
GSA_CYAP4       AQEKFGV-----------------------LPDLTTLGKIIGGGLPVGAYGGRREIMSLV
GSA_NOSS1       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGRRDIMSMI
GSA_TRIV2       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGRRDIMSMI
GSA_NOSP7       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGRRDIMSMV
GSA_TRIEI       AQEKFNV-----------------------TPDLTTLGKIIGGGLPVGAYGGRQDIMSMV
GSA_SYNE7       VQEKFGV-----------------------TPDLTTLGKIIGGGLPVGAYGGKREIMQLV
GSA_SYNP6       VQEKFGV-----------------------TPDLTTLGKIIGGGLPVGAYGGKREIMQLV
GSA_SYNP2       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGRKDIMSMV
GSA_RIPO1       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGRQDIMEMV
GSA_MICAN       AQEKFGI-----------------------TPDLTTLGKVIGGGLPVGAYGGRADIMAMV
GSA_GLOC7       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGRKEIMSLV
GSA_SYNY3       AQARFGI-----------------------TPDLTTLGKVIGGGLPVGAYGGREEIMAMV
GSA_SYNJB       VQAKFGV-----------------------IPDLTTLGKVIGGGLPVGAYGGRREIMEMV
GSA_SYNJA       VQAKFGV-----------------------IPDLTTLGKVIGGGLPVGAYGGRREIMEMV
GSA_THEEB       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGRAEIMKMV
GSA_PROMA       AQGRFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRKDIMSMV
GSA_PROM4       AQERFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRKEIMSMV
GSA_PROM1       AQERFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRKEIMSMV
GSA_PROMT       AQERFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRKEIMSMV
GSA_PROM3       AQARFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRAEIMEMV
GSA_PROMM       AQARFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRAEIMEMV
GSA_SYNS9       AQAHFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRADIMQMV
GSA_SYNPX       AQAHFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRADIMGMV
GSA_SYNSC       AQAHFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRADIMGMV
GSA_SYNPW       AQAHFGV-----------------------TPDLTTMGKVIGGGLPVGAYGGRRDIMEMV
GSA_PROMS       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGKKEIMSMV
GSA_PROM0       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGKKEIMSMV
GSA_PROM2       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGKKEIMSMV
GSA_PROM9       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGKKEIMSMV
GSA_PROMP       AQEKFGV-----------------------TPDLTTLGKVIGGGLPVGAYGGKKEIMSMV
GSA_GLOVI       AQARYGI-----------------------EPDLTCLGKIIGGGLPVGAYAGRREIMQMV
GSA_CHLSY       AQALWGL-----------------------DPDLTCLGKVIGGGLPVGAYAGKRQLMQLV
GSA_CHLAA       AQALWGL-----------------------DPDLTCLGKVIGGGLPVGAYAGKRQLMQLV
GSA_CHLAD       AQALWNL-----------------------DPDLTCLGKVIGGGLPVGAYAGKRHLMQLV
GSA_ROSCS       AQGKYGI-----------------------TPDLTCLGKVIGGGLPAAAYGGRRDLMELI
GSA_ROSS1       AQGRYGI-----------------------TPDLTCLGKVIGGGLPAAAYGGRRELMELI
GSA_HERA2       AQAYFNV-----------------------MPDLTCLGKVVGGGLPAAAYGGRREIMQMV
GSA_FRACC       WWGNEGAI-------------------EDWSPDLFTFGKVMGGGLPAAAFGGRADVMARL
GSA_FRASN       WWGLEGAV-------------------EGWAPDLFTFGKVMGGGLPAAAFGGRADVMARL
GSA_THEFY       WYGLEGV-----------------------APDLMTFGKVMGGGLPAAAFGGRADLMDQL
GSA_STRAW       WYGVDGV-----------------------RPDLMTFGKVMGGGFPAAAFGGRRDVMAHL
GSA_STRCO       WFGVEGV-----------------------VPDLMTFGKVMGGGFPAAAFGGRADVMAHL
GSA_STRGG       WYGVDGV-----------------------RPDLMTFGKVMGGGFPAAAFGGRGDVMAHL
GSA_MYCA1       WYGIDPV-----------------------DADLFTFGKVMSGGLPAAAFGGRAEVMERL
GSA_MYCPA       WYGIDPV-----------------------DADLFTFGKVMSGGLPAAAFGGRAEVMERL
GSA_MYCMM       WYGIDPV-----------------------DADLFTFGKVMSGGLPAAAFGGRAEVMERL
GSA_MYCUA       WYGIDPV-----------------------DADLFTFGKVMSGGLPAAAFGGRAEVMERL
GSA_MYCBO       WYGIDPV-----------------------PADLFAFGKVMSGGMPAAAFGGRAEVMQRL
GSA_MYCTA       WYGIDPV-----------------------PADLFAFGKVMSGGMPAAAFGGRAEVMQRL
GSA_MYCBT       WYGIDPV-----------------------PADLFAFGKVMSGGMPAAAFGGRAEVMQRL
GSA_MYCBP       WYGIDPV-----------------------PADLFAFGKVMSGGMPAAAFGGRAEVMQRL
GSA_MYCTU       WYGIDPV-----------------------PADLFAFGKVMSGGMPAAAFGGRAEVMQRL
GSA_MYCLE       WYGLDPV-----------------------AADLFIFGKVMSGGMPAAAFGGRAEVMERL
GSA_MYCLB       WYGLDPV-----------------------AADLFIFGKVMSGGMPAAAFGGRAEVMERL
GSA_RHOOB       WYGLDGV-----------------------AGDLYTFGKVMSGGLPAAAFGGRADVMAHL
GSA_RHOJR       WFGLDGV-----------------------AGDLYTFGKVMSGGLPAAAFGGRADVMAHL
GSA_NOCFA       WYGREGV-----------------------AGDLYTFGKVMSGGLPAAAFGGRAEVMNQL
GSA_ACIC1       WWGRDPV-----------------------AADLFTFGKVIGGGLPIGAFGGRRDIMQLL
GSA_CORGL       WFGVDKV-----------------------AADLVTFGKVVSGGLPAAAFGGKAEIMNML
GSA_CORGB       WFGIDKV-----------------------AADLVTFGKVVSGGLPAAAFGGKAEIMNML
GSA_COREF       WFGVDKV-----------------------RADLVTFGKVVSGGLPAAAFGGRAEIMNML
GSA_CORDI       WYGVDGV-----------------------AGDLTTFGKVISGGLPAAAFGGRADIMRYL
GSA_CORA7       WFGVDGV-----------------------AGDLVTFGKVVSGGLPAAAFGGRADVMASL
GSA_CORJK       WYGKDGV-----------------------AGDLTTFGKVVSGGLPAAAFGGKAEIMDHL
GSA_CLAM3       YWGLDNAGLAAD-------------HPDAWTPDLVTYGKVIGGGLPVAALGGRADVMDHL
GSA_CLAMS       YWGLDNDGLAAD-------------HPDAWTPDLVTYGKVIGGGLPVAALGGRADVMDHL
GSA_LEIXX       FWGLDR----------------------GYTPDLVAFGKVIGGGMPLAAVGGRAELMDIL
GSA_KOCRD       YWGLSNAA------------------GESWAPDLFTFGKVIGGGLPTAALGGRREVMEYL
GSA_CUTAK       FWGLQQQA------------------GEDFAPDIFTFGKVVGGGMPLAALGGHADVMDLL
GSA_PROFF       AWGLQGAK-------------------EGWTPDLFTFGKVIGGGMPLAAVGGSAQLMDYL
GSA_TROW8       FWALETSLASQQPTQAVSEGSVSDSAYSAYVPDLFTFAKVLGGGLPIGAIGGRAEIMDLL
GSA_TROWT       FWALETSLASQQPTQAVSEGSVSDSAYSAYVPDLFTFAKVLGGGLPIGAIGGRAEIMDLL
GSA_ANAD2       ACGLYGL-----------------------RPDLVTFGKVIGAGLPVGAFGGRRDVMDRV
GSA_ANASK       ACGLYGL-----------------------RPDLVTFGKVIGAGLPVGAFGGRRDVMDRV
GSA_ANADE       ACGLYGL-----------------------RPDLVTFGKVIGAGLPVGAFGGRRDVMDRV
GSA_ANADF       ACGLFGV-----------------------RPDLVTFGKVIGGGLPVGAFGGRADVMDRV
GSA_MYXXD       AQELYGL-----------------------KPDLTTMAKVIGGGMPMGAYGGRRDIMEKV
GSA_CARHZ       AQVLYNV-----------------------EPDITTLGKIIGGGLPVGAYGGRREIMEMV
GSA_PELTS       AQELYGV-----------------------APDLTCLGKVIGGGLPVGAYGGRREIMEQV
GSA_MOOTA       AQALYGI-----------------------RPDLTCLGKIIGGGLPVGAYGGRREIMERV
GSA_THERP       AQERFGI-----------------------LPDLTCLGKVIGGGLPVGAYGGRRDLMEQV
GSA_THET2       ATELLGL-----------------------KPDLVTLGKVLGGGLPAAAYAGRREIMEKV
GSA_THET8       ATELLGL-----------------------KPDLVTLGKILGGGLPAAAYAGRREIMEKV
GSA_DEIRA       ATGLLSL-----------------------DPDLRCWGKIVGGGLPVGAYGGRADIMDFV
GSA_RHOBA       AQERFGV-----------------------TPDMTTLGKIVGGGMPLGAYGGRADIMNQV
GSA_SORC5       AQERFGL-----------------------RPDLTTLGKIVGGGMPLAAYGGRADVMRVV
GSA_CALBD       ARALYNV-----------------------EPDLVTFGKIIGGGLPCGAVGGKKEIMECL
GSA_CALS8       ARALYNV-----------------------EPDLVTFGKIIGGGLPCGAVGGKKEIMQCL
GSA_CLOAB       AQSLYGV-----------------------TPDLITFAKIMGGGFPCGAYGGKKEIMKQL
GSA_CLOTE       AQSRYGV-----------------------KPDLTTYAKIMGGGLPSGAYGGRRDIMEKL
GSA_CLOBA       AQTLFDI-----------------------KPDLITYAKIMGGGLPCGAYAGKKEIMEKL
GSA_CLOBB       AQTLFDI-----------------------KPDLITYAKIMGGGLPCGAYAGKKEIMEKL
GSA_CLOB8       AQSLFNV-----------------------KPDLVTYAKIMGGGLPCGAYGGRKEIMKNL
GSA_CLOP1       AQTLFDV-----------------------KPDLVTYAKIMGGGLPCGAYGGRREIMENL
GSA_CLOPS       AQTLFDV-----------------------KPDLVTYAKIMGGGLPCGAYGGRREIMENL
GSA_CLOPE       AQTLFDV-----------------------KPDLVTYAKIMGGGLPCGAYGGRREIMENL
GSA_CLOK5       AQSLYGI-----------------------KPDITTMAKIMGGGLPCGAYGGRKDIMENL
GSA_AQUAE       AQELFGI-----------------------EPDITCLGKILGGGLPVGAYGGRREIMERV
GSA_HYDS0       AAEYFGI-----------------------EPDIVCYGKIIGGGMPIGAYGAKNHIMERV
GSA_PERMH       AQELYGI-----------------------EPDLTTLGKVIGGGLPVGAYGGKREIMEYV
GSA_SULSY       AQELYDI-----------------------EPDLTTFGKVIGGGLPVGAYGGKGEIMEYV
GSA_DESVH       AQQRFGI-----------------------TPDLTTLGKIIGGGLPVGAYGGKREIMQRI
GSA_DESVV       AQQRFGI-----------------------TPDLTTLGKIIGGGLPVGAYGGKREIMQRI
GSA_DESVM       AQKRFDI-----------------------TPDLTTLGKIIGGGLPVGAYGGRADLMRRI
GSA_DESAG       AQQYFGI-----------------------TPDLTTLGKIIGGGMPVGAYGGRREIMERI
GSA_LAWIP       AQTRFDI-----------------------TPDLTTLGKIIGGGLPIGAYGGKAKYMEHI
GSA_SYNWW       YQNIVNI-----------------------EPDLTTLGKIIGGGLPVGAYGGKKEIMERI
GSA2_BACAN      GQGYYGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKAEIMRQV
GSA2_BACHK      GQGYYGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKAEIMRQV
GSA2_BACCZ      GQGYYGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKAEIMRQV
GSA2_BACCR      GQGYYGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKAEIMRQV
GSA2_BACC1      GQGYYGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKAEIMRQV
GSA2_BACLD      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKAEIMEKI
GSA_BACSU       AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKAEIMEQI
GSA2_GEOKA      AQGYYGI-----------------------EPDLTCLGKVIGGGLPVGAYGGKAEIMELV
GSA2_BACSK      AQGEFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKREIMEQI
GSA2_BACHD      AQGAFGI-----------------------TPDLTCLGKVIGGGLPVGAYGGKREIMEQI
GSA1_STAAU      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAAC      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAA8      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAA3      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAAM      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAAN      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAAR      AQGHFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAAS      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAAW      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDHI
GSA1_STAAB      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDQI
GSA1_STAES      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDYI
GSA1_STAEQ      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDYI
GSA2_STAS1      AQGYFDV-----------------------TPDLTCLGKVIGGGLPVGAFGGKKEIMDQI
GSA2_STAHJ      AQGYFGV-----------------------TPDLTCLGKVIGGGLPVGAFGGRKEIMDKV
GSA2_OCEIH      AQGHYDV-----------------------TPDLTCLGKVIGGGLPVGAYGGKREIMEQI
GSA1_LISMO      AQGYYVV-----------------------TPDLTCLGKVIGGGLPVGAYGGKKEIMEQI
GSA1_LISMF      AQGYYVV-----------------------TPDLTCLGKVIGGGLPVGAYGGKKEIMEQI
GSA1_LISIN      AQGYYVV-----------------------TPDITCLGKVIGGGLPVGAYGGKKEIMEQI
GSA_NATTJ       AQAYYGV-----------------------TPDLTCLGKVIGGGLPVGAYGGKEEIMEYI
GSA_THEYD       AQQYYGV-----------------------KPDLTCLGKVIGGGLPVGAYGGKKEIMALV
GSA_DESPS       AQQYYGV-----------------------TPDLTCLGKIIGGGLPVGAYGGKADIMNSV
GSA_SYNAS       FQKLCRL-----------------------EPDLTCLGKIIGGGLPVGAFGGKRTIMDFL
GSA_DESOH       AQARYRI-----------------------TPDITCLGKVIGGGMPVGAYGGSRQIMKHI
GSA_SYNFM       AQEFFGV-----------------------TPDLTCLGKIIGGGLPVGAYGGRRDIMMKM
GSA_GEODF       AQEVYGV-----------------------TPDMTTLGKIIGGGLPVGAFGGKKEIMTLL
GSA_GEOUR       AQELYNV-----------------------TPDMTTLGKIIGGGLPVGAFGGKKEIMSLL
GSA_GEOBB       VQELYGV-----------------------TPDMTTLGKIIGGGLPVGAFGGKKEIMSLL
GSA_PELPD       AQERYGV-----------------------TPDMTTLGKIIGGGLPVGAFGGRREIMEML
GSA_GEOLS       AQSLYGV-----------------------TPDMTTLGKIIGGGLPVGAFGGKREIMEKL
GSA_GEOMG       AQERYGI-----------------------TPDMTTLGKIIGGGLPVGAFGGKREIMQQL
GSA_GEOSL       AQELYGV-----------------------TPDMTTLGKIIGGGLPVGAFGGKKDIMKLL
GSA_PELCD       AQQLYGV-----------------------RGDLVCLGKVIGGGLPVGAFGGRQDIMRHL
GSA_ECOL6       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOL5       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO45       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOK1       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO27       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOUT       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO81       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO24       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO8A       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO55       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOLC       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOSE       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOHS       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOLU       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO57       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO5E       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SHISS       AQDYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECO7I       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECODH       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOLI       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ECOSM       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SHIB3       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SHIBS       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SHIDS       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SHIFL       AQDYF-----------------------AVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SHIF8       AQDYF-----------------------AVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ESCF3       AQDYY-----------------------DVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALDC       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALSV       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALA4       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALTI       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALG2       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALNS       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALEP       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALPB       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALCH       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALPC       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALPA       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALPK       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALHS       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALTY       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_SALAR       AQDYY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_CROS8       AQAYY-----------------------NVVPDLTCLGKIIGGGMPVGAFGGRREVMEAL
GSA_ENT38       AQSYY-----------------------DVVPDLTCLGKIIGGGMPVGAFGGRKDVMEAL
GSA_KLEP3       AQAYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRREVMDAL
GSA_KLEP7       AQAYY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRREVMDAL
GSA_YERPE       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERPP       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERPN       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERPG       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERPA       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERPS       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERPB       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERP3       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERPY       AQDYY-----------------------HVIPDLTCLGKIIGGGMPVGAFGGRREVMNAL
GSA_YERE8       AQDYY-----------------------NVIPDLTCLGKIIGGGMPVGAFGGRRDVMDAL
GSA_ERWT9       AQAHY-----------------------GVEPDLTCLGKIIGGGMPVGAFGGRREVMEAL
GSA_PECAS       AQSHY-----------------------GVVPDLTCLGKIIGGGMPVGAFGGKREVMQAL
GSA_PHOLL       AQSYY-----------------------DVEPDITCLGKIIGGGMPVGAFGGRYEVMEKL
GSA_PROMH       AQAYY-----------------------DVDPDLTCLGKIIGGGMPVGAFGGHKEVMSQL
GSA_SODGM       AQAYY-----------------------DVKPDLTCLGKIIGGGMPVGAFGGRREVMAAL
GSA_ACTPJ       AQAYY-----------------------DVKPDLTTLGKIIGGGMPVGAFGGKKEIMEYI
GSA_ACTP2       AQAYY-----------------------DVKPDLTTLGKIIGGGMPVGAFGGKKEIMEYI
GSA_ACTP7       AQAYY-----------------------DVKPDLTTLGKIIGGGMPVGAFGGKKEIMEYI
GSA_HAEPS       AQSYY-----------------------GVTPDLTTLGKIIGGGMPVGAFGGKKEIMEFI
GSA_ACTSZ       AQAYY-----------------------GVTPDLTALGKIIGGGMPVGAFGGKREIMEYI
GSA_HAES1       AQSYY-----------------------EVTPDLTTLGKVIGGGMPVGAFGGKKEIMQYI
GSA_HISS2       AQSYY-----------------------EVTPDLTTLGKVIGGGMPVGAFGGKKEIMQYI
GSA_PASMU       AQTYY-----------------------GVTPDLTCLGKVIGGGMPVGAFGGKKAIMQHI
GSA_MANSM       AQSYY-----------------------NVEPDLTCLGKVIGGGMPVGAFGGKKEIMQFI
GSA_AERHH       AQGHY-----------------------NIDPDLTTLGKIIGAGMPVGAFGGKKKVMQHI
GSA_AERS4       AQGYY-----------------------NIDPDLTTLGKIIGAGMPVGAFGGKKKVMQHI
GSA_SHEB8       AQGYY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEB2       AQGYY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEB5       AQGYY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEB9       AQGYY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEPC       AQGYY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHESW       AQGYY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHESM       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHESR       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKEVMQFI
GSA_SHESA       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKEVMQFI
GSA_SHEON       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEHH       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEPA       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHESH       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEWM       AQGHY-----------------------GITPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHEPW       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_SHELP       AQGHY-----------------------GITPDLTTLGKVIGGGMPVGAFGGRKEVMQFI
GSA_SHEAM       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGKKDVMQYL
GSA_SHEDO       AQAHY-----------------------GVVPDLTTLGKVIGGGMPVGAFGGKKAIMQYI
GSA_SHEFN       AQGHY-----------------------GVTPDLTTLGKVIGGGMPVGAFGGRKDVMQFI
GSA_ALIF1       AQGYY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRKEVMQYI
GSA_ALIFM       AQGYY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRKDVMQYI
GSA_ALISL       AQGYY-----------------------NIKPDLTCLGKVIGGGMPVGAFGGRKDIMQYI
GSA_VIBCH       AQAHY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRREVMQYI
GSA_VIBC3       AQAHY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRREVMQYI
GSA_VIBCM       AQAHY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRREVMQYI
GSA_VIBVU       AQAHY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRKEVMQYI
GSA_VIBVY       AQAHY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRKEVMQYI
GSA_VIBPA       AQAHY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGRKEVMQYV
GSA_VIBTL       AQAYY-----------------------NIKPDLTCLGKVIGGGMPVGAFGGRKDVMQYI
GSA_PHOPR       AQGYY-----------------------NIKPDLTTLGKIIGGGMPVGAFGGRKDIMQYI
GSA_COLP3       AQAHY-----------------------NIKPDLTTLGKVIGGGMPVGAFGGKQEIMDYI
GSA_PSEHT       AQAYY-----------------------NIKPDLTCLGKVIGGGMPVGAFGGKTEIMDYI
GSA_IDILO       AQDRY-----------------------KIKPDLTTLGKVIGGGMPVGAFGGKKEVMDYI
GSA_PSYIN       AQAYY-----------------------DIKPDLTTLGKVIGGGMPVGAFGGSKKVMQHI
GSA_PSEA6       AQAKY-----------------------NIVPDLTCLGKVIGGGMPVGAFGGKRDIMQHI
GSA_ACIF2       AQALY-----------------------GVRPDLTTLGKIIGGGLPVGAVGGPREIMEYL
GSA_ACIF5       AQALY-----------------------GVRPDLTTLGKIIGGGLPVGAVGGPREIMEYL
GSA_METCA       AQAHY-----------------------GICPDLTTLGKVIGGGMPVGAFGGRLDIMEQL
GSA_PSEAE       AQAYY-----------------------GVTPDLSTFGKIIGGGMPVGAFGGKREIMQQI
GSA_PSEA8       AQAYY-----------------------GVTPDLSTFGKIIGGGMPVGAFGGKREIMQQI
GSA_PSEAB       AQAYY-----------------------GVTPDLSTFGKIIGGGMPVGAFGGKREIMQQI
GSA_PSEA7       AQAYY-----------------------GVTPDLSTFGKIIGGGMPVGAFGGKREIMQQI
GSA_PSEE4       AQGYY-----------------------GITPDLSTFGKIVGGGMPVGCFGGKREIMGCI
GSA_PSEPW       AQGYY-----------------------GITPDLSTFGKIVGGGMPVGCFGGKREIMGCI
GSA_PSEP1       AQGHY-----------------------GITPDLSTFGKIVGGGMPVGCFGGKREIMGCI
GSA_PSEPK       AQGHY-----------------------GIKPDLSTFGKIVGGGMPVGCFGGKREIMGCI
GSA_PSEPG       AQGHY-----------------------GIKPDLSTFGKIVGGGMPVGCFGGKREIMGCI
GSA_PSEF5       AQAHY-----------------------GVTPDLSTFGKIIGGGMPVGCFGGKRKIMEHI
GSA_PSEPF       AQAYY-----------------------GVTPDLTTFGKIIGGGMPVGCFGGKRLIMERI
GSA_PSEMY       AQAHY-----------------------GVTPDLTTFGKIIGGGMPVGCFGGKRAIMECI
GSA_PSE14       AQAYY-----------------------GVTPDLSTFGKIIGGGMPVGCFGGKREIMSHI
GSA_PSEU2       AQAYY-----------------------GVTPDLSTFGKIIGGGMPVGCFGGKREIMSHI
GSA_PSESM       AQAYY-----------------------DVKPDLSTFGKIIGGGMPVGCFGGKREIMSHI
GSA_PSEU5       AQAYY-----------------------GVTPDLSTFGKIIGGGMPVGCFGGKRAIMERI
GSA_ACIB5       AQSVY-----------------------NVKPDLTTLGKIIGAGLPVGAFGGKREIMECI
GSA_ACIB3       AQSVY-----------------------NVKPDLTTLGKIIGAGLPVGAFGGKREIMECI
GSA_ACIBT       AQSVY-----------------------NVKPDLTTLGKIIGAGLPVGAFGGKREIMECI
GSA_ACIBY       AQSVY-----------------------NVKPDLTTLGKIIGAGLPVGAFGGKREIMECI
GSA_ACIBC       AQSVY-----------------------NVKPDLTTLGKIIGAGLPVGAFGGKREIMECI
GSA_ACIBS       AQSVY-----------------------NVKPDLTTLGKIIGAGLPVGAFGGKREIMECI
GSA_ACIAD       AQSVY-----------------------QVKPDLTTLGKIIGAGLPVGAFGGKREIMECI
GSA_PSYA2       AQAHF-----------------------GIDPDLTCFGKIIGAGLPVGAFGGKKEVMSCI
GSA_PSYCK       AQAHF-----------------------GIDPDLTCFGKIIGAGLPVGAFGGKKDIMSCI
GSA_RUTMC       AQAFY-----------------------NVKPDLTTLGKVIGGGLPVGAFGGKREIMQSI
GSA_VESOH       AQEFY-----------------------NVEPDLTTLGKIIGGGLPVGIFGGKCEIMKCI
GSA_HAHCH       AQQVY-----------------------GVKPDLTTLGKVIGAGLPVGAFGGRRDVMSHI
GSA_MARHV       AQGFY-----------------------GVKPDLTALGKVIGGGLPVGAFGGKREIMEHI
GSA_MARMS       AQAHF-----------------------GIVPDLTTLGKVIGAGMPVGAFGGKREIMEHI
GSA_HYDCU       AQGRY-----------------------NITPDLTTFGKVIGGGMPVGAFGGKKEVMQHI
GSA_ALKEH       AQGRY-----------------------GITPDLTCLGKVIGGGMPVGAFGGKAQIMADL
GSA_HALHL       AQGRY-----------------------GITPDLTCLGKVVGGGMPVGAFGGRREIMEGL
GSA_STRMK       AQAHY-----------------------GITPDLTTFGKIIGGGMPVGAYGGRRELMQQI
GSA_STRM5       AQAHY-----------------------GITPDLTTFGKIIGGGMPVGAYGGRRELMQQI
GSA_XANCH       AQAHY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGRRDLMEQV
GSA_XANC5       AQAHY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGRRDLMEQV
GSA_XANAC       AQAHY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGRRDLMEQV
GSA_XANOR       AQAHY-----------------------GVTPDLSTFGKIIGGGMPVGAYGGRRDLMEQI
GSA_XANOM       AQAHY-----------------------GVTPDLSTFGKIIGGGMPVGAYGGRRDLMEQI
GSA_XANCP       AQAHY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGGRDLMEQI
GSA_XANC8       AQAHY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGGRDLMEQI
GSA_XANCB       AQAHY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGGRDLMEQI
GSA_XYLF2       AQALY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGRRDLMQHI
GSA_XYLFT       AQALY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGRRDLMQHI
GSA_XYLFM       AQALY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGRRDLMQHI
GSA_XYLFA       AQALY-----------------------GVTPDLTTFGKIIGGGMPVGAYGGCRDLMQHI
GSA_CHRSD       AQAHF-----------------------GVTPDLTCLGKIVGGGMPVGAFGGTREIMEQL
GSA_NITOC       GQAFY-----------------------DVTPDLTTLGKVVGGGLPVGAFGGRQKIMEMI
GSA_THISH       AQAHY-----------------------GVKPDLTTLGKIIGGGMPVGAFGGRREVMEQL
GSA_ACISJ       AQSLYAQAIP------------------GFKPDITVLGKVIGGGMPLAAFGGSRAVMEQL
GSA_ACIET       AQSLYAQAIP------------------GFKPDITVLGKVIGGGMPLAAFGGSRAVMEQL
GSA_ACIAC       AQSVYARDIP------------------GFQPDITVLGKVIGGGMPLAAFGGPRAIMEQL
GSA_VEREI       AQSLYARDIP------------------GFQPDLTVLGKVIGGGMPLAAFGGSRALMEHL
GSA_RHOFT       AQSVYAKEIP------------------GFEPDMTVMGKVIGGGMPLAAFGAKRAVMEHL
GSA_LEPCP       AQSLYAQAIP------------------GFAPDVSVFGKVIGGGMPLAAFGASRKIMSLL
GSA_AZOSB       VQGLY-----------------------GITPDLTTLGKVIGGGMPVGAFGGRRDIMNCI
GSA_AROAE       VQGLY-----------------------GIMPDLTTLGKVIGGGMPVGAFGGRRDIMEKI
GSA_BORBR       VQGLT-----------------------GVRPDLTTLAKVIGGGMPVGAFGGRADLMAHI
GSA_BORPA       VQGLT-----------------------GVRPDLTTLAKVIGGGMPVGAFGGRADLMAHI
GSA_BORPE       VQGLT-----------------------GVRPDLTTLAKVIGGGMPVGAFGGRADLMTHI
GSA_BORPD       VQGLA-----------------------GIKPDLTTLAKVIGGGMPVGALGGRADLMAHL
GSA_BORA1       VQGLT-----------------------GITPDLTTLAKVIGGGMPVGAFGGRADLMRHI
GSA_BURCM       AQQHY-----------------------GITADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURA4       AQQHY-----------------------GITADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURL3       AQQHY-----------------------GITADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURCA       AQTYY-----------------------GIAADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURCH       AQTYY-----------------------GIAADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURCC       AQAYY-----------------------GIAADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURCJ       AQAYY-----------------------GIAADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURVG       AQQHY-----------------------GIAADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURM1       AQAHY-----------------------GIAADLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_BURMA       AQQHY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRGDIMSHL
GSA_BURP1       AQQHY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRGDIMSHL
GSA_BURPS       AQQHY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRGDIMSHL
GSA_BURM9       AQQHY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRGDIMSHL
GSA_BURP0       AQQHY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRGDIMSHL
GSA_BURTA       AQQHY-----------------------GIKPDLTCLGKVIGGGMPAAAFGGRGDIMSHL
GSA_PARPJ       AQEVY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_PARXL       AQEVY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_PARP8       AQQLY-----------------------GIRPDLTCLGKVIGGGMPAAAFGGRRDIMAHL
GSA_CUPTR       AQAHY-----------------------GIRPDMTCLGKVIGGGMPAAAFGGRRDIMASL
GSA_CUPNH       AQAHY-----------------------GIRPDLTCLGKVIGGGMPAAAFGGRRDIMARL
GSA_CUPPJ       AQSHY-----------------------GITPDMTCLGKVIGGGMPAAAFGGRRDIMAKL
GSA_CUPMC       AQAHY-----------------------GIKPDMTCLGKVIGGGMPAAAFGGRRDIMAKL
GSA_RALPJ       AQALY-----------------------GIKPDLTCLGKVIGGGMPAAAFGGRRDIMGFL
GSA_RALSO       AQALY-----------------------GITPDLTCLGKVIGGGMPAAAFGGRRDIMGFL
GSA_HERAR       AQSMY-----------------------DIKPDLTVLGKVIGGGLPVAAFGGRTDLMQHL
GSA_JANMA       AQSLY-----------------------GITPDLTVLGKVIGGGLPVAAFGGRADIMRHL
GSA_CHRVO       AQGLH-----------------------GVTPDLTTLGKVVGGGMPLAAFGGRADIMGKI
GSA_LARHH       AQSLH-----------------------GIQPDLTTLGKVVGGGMPIGAFGGRADIMNCI
GSA_NEIG1       AQSLH-----------------------GITPDLTTMGKVIGGGMPLAAFGGRKDIMECI
GSA_NEIG2       AQSLH-----------------------GITPDLTTMGKVIGGGMPLAAFGGRKDIMECI
GSA_NEIM0       AQSLH-----------------------GIMPDLTTMGKVIGGGMPLAAFGGRKDIMECI
GSA_NEIMF       AQSLH-----------------------GITPDLTTMGKVIGGGMPLAAFGGRKDIMECI
GSA_NEIMA       AQSLH-----------------------GITPDLTTMGKVIGGGMPLAAFGGRKDIMECI
GSA_NEIMB       AQSLH-----------------------GITPDLTTMGKVIGGGMPLAAFGGRKDIMECI
GSA_NITEU       AQGLY-----------------------GIKPDLTILGKVIGGGLPMAAFGGRRDVMECL
GSA_NITEC       AQGLY-----------------------GIRPDLTILGKVIGGGLPMAAFGGRRDVMECL
GSA_NITMU       AQGLY-----------------------GIKPDLTTLGKVIGGGMPMAAFGGRREIMQCL
GSA_DECAR       AQGLF-----------------------GITPDLSTFGKVVGGGMPLGAFGGKREIMEKI
GSA_METFK       AQQLF-----------------------GIKPDLTTLGKVIGGGLPVGAFGGRADVMAFL
GSA_THIDA       AQKLL-----------------------GIRPDLTTLGKVIGGGMPVGAFGGRADVMDAL
GSA_SACD2       AQGYY-----------------------GVQPDITTLGKVMGGGMPVGAFGGSKEVMDYI
GSA_COXBU       AQSLY-----------------------NIRPDLTALGKIIGGGMPVGAYGGRREIMNQL
GSA_COXBR       AQSLY-----------------------NIRPDLTALGKIIGGGMPVGAYGGRREIMNQL
GSA_COXB2       AQSLY-----------------------NIRPDLTALGKIIGGGMPVGAYGGRREIMNQL
GSA_COXB1       AQSLY-----------------------NIRPDLTALGKIIGGGMPVGAYGGRREIMNQL
GSA_COXBN       AQSLY-----------------------NIRPDLTALGKIIGGGMPVGAYGGRREIMNQL
GSA_FRATF       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRATO       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRATH       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRATM       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRATW       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRATT       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRAT1       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRATN       AQSIY-----------------------NVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKV
GSA_FRAP2       AQSIY-----------------------DVKPDLTTLGKVIGGGMPVGAFGGRKEIMQEV
GSA_LEGPC       AQGLF-----------------------GIKPDITTLGKIIGGGMPVGALGGKREIMSFL
GSA_LEGPH       AQGLF-----------------------GIKPDITTLGKIIGGGMPVGALGGKREIMSFL
GSA_LEGPL       AQGLF-----------------------GIKPDITTLGKIIGGGMPVGALGGKREIMSFL
GSA_LEGPA       AQGLF-----------------------GIKPDITTLGKIIGGGMPVGALGGKREIMSFL
GSA_CAMC1       SYPFHEV-----------------------DADLVTFGKVIGGGMNVAAFGGKAKIMDCL
GSA_CAMC5       SLPYHGI-----------------------LADLVTFGKVIGGGMNAAAFGGKREIMDCL
GSA_CAMFF       SYEFNKI-----------------------QADIITFGKVIGGGMSAAAFAAKNEIMEMI
GSA_CAMHC       SYGIYGI-----------------------KGDIVTFGKVIGGGMNVAAFAGKKEIMDMI
GSA_CAMJE       SYGINHI-----------------------QADIITFGKVIGGGLPAAAFASRAEIMDIL
GSA_CAMJ8       SYGINHI-----------------------QADIITFGKVIGGGLPAAAFASRAEIMDIL
GSA_CAMJJ       SYGINHI-----------------------QADIITFGKVIGGGLPAAAFASRAEIMDIL
GSA_CAMJR       SYGINHI-----------------------QADIITFGKVIGGGLPAAAFASRAEIMDIL
GSA_CAMJD       SYGINHI-----------------------QADIITFGKVIGGGLPAAAFASRAEIMDIL
GSA_HELPH       SQEFYGV-----------------------VPDLVTFGKVIGAGLPLACFGGRAEIMDLL
GSA_HELP2       SQEFYGV-----------------------VPDLVTFGKVIGAGLPLACFGGRAEIMDLL
GSA_HELPG       SQEFYGV-----------------------VPDLVTFGKVIGAGLPLACFGGRAEIMDLL
GSA_HELPS       SQEFYGV-----------------------VPDLVTFGKVIGAGLPLACFGGRAEIMDLL
GSA_HELPJ       SQEFYGV-----------------------VPDLVTFGKVIGAGLPLACFGGRAEIMDLL
GSA_HELPY       SQEFYGV-----------------------VPDLVTFGKVIGAGLPLACFGGRAEIMDLL
GSA_HELAH       SQEFYGV-----------------------VPDLVTFGKVIGAGLPLACFGGRAEIMDLL
GSA_HELHP       AIGLYDV-----------------------QADLVTYGKVIGGGMPLAAFGGRADIMDML
GSA_WOLSU       AQALYGV-----------------------IPDMATFGKVIGGGMPVGAFGGRSDIMACL
GSA_SULDN       AESITGV-----------------------KPDIVTLGKVIGGGMPVGAFGARAEIMAKL
GSA_SULNB       AQGITTV-----------------------KPDMVTLGKVIGAGMPVGAFGAGAETMAQL
GSA_STRSV       AVGLYQT-----------------------EPDLVCLGKVIGGGFPVAAFGGKAVYMDQV
GSA_CHLP8       AQELYGV-----------------------TPDLTTMGKIIGGGLPVGAFGGKRKIMENI
GSA_CHLTE       AQELYGV-----------------------TPDLTTMGKIIGGGLPVGAFGGKRHIMENI
GSA_CHLL2       AQELYGV-----------------------TPDLTTMGKIIGGGLPVGAFGGKRKIMENV
GSA_CHLCH       AQSLYGV-----------------------TPDLTTMGKIIGGGLPVGAFGGKRKLMERV
GSA_PELPB       AQSLYGV-----------------------TPDLTTMGKIIGGGLPVGAFGGKREIMERV
GSA_CHLPD       AQSLYGV-----------------------TPDLTTMGKIIGGGLPVGAFGGKRKIMERV
GSA_CHLPB       AQERYGI-----------------------TPDLTTMGKIIGGGLPVGAFGGKREIMQRV
GSA_PROA2       AQERYGV-----------------------TPDLTTMGKIIGGGLPVGAFGGKREIMERI
GSA_PELLD       AQELYGI-----------------------TPDLTTMGKIIGGGLPVGAFGGKRSLMENV
GSA_CHLPM       AQELYGI-----------------------TPDLTTMGKIIGGGLPVGAFGGKRSLMENV
GSA_CHLT3       AQEVYGI-----------------------TPDLTTMGKIIGGGLPVGAYGGKKEIMEHV
GSA_CYTH3       AQGVYGV-----------------------QPDMTTMGKIIGGGMPVGAYGGKKEIMQNV
GSA_SALRD       AQERYGV-----------------------IPDLTCLGKIIGGGLPVGAYGGKQEIMDYV
GSA_HUNT2       AQQYFGV-----------------------NADLVTYGKIIGGGMPVGAYGGRREIMECV
GSA_FLAJ1       VQELYGI-----------------------DADIVTFGKVIGGGLPVGAFAAREEIMNYL
GSA_FLAPJ       AQELFNV-----------------------QADIVCFGKVIGGGLPVGAFAARNEIMNYL
GSA_GRAFK       VQERAGV-----------------------KADIVCFGKVIGGGLPVGAFAARNEIMDYL
GSA_WIGBR       AQSYYNI-----------------------YPDITCLGKIIGGGLPIGAFGGKKRIMNHV
GSA_CHLTR       AAALYHV-----------------------KPDILVFGKILGGGLPASAVVTPKDIMDHL
GSA_CHLTA       AAALYHV-----------------------KPDILVFGKILGGGLPASAVVTPKDIMDHL
GSA_CHLT2       AAALYHV-----------------------KPDILVFGKILGGGLPASAVVAPKDIMDHL
GSA_CHLTB       AAALYHV-----------------------KPDILVFGKILGGGLPASAVVAPKDIMDHL
GSA_CHLMU       AAALHPL-----------------------KPDILVFGKILGGGLPASAVCAPAAIMDYL
GSA_CHLFF       MRSIMDV-----------------------TADITVYGKILGGGMPVAALLAHQNIMDHL
GSA_CHLCV       MRSILDV-----------------------TPDITVYGKILGGGMPVAAVLAHQSIMEHL
GSA_CHLAB       VRSIMDV-----------------------DSDITVYGKILGGGMPVAAFLAHHRIMDHL
GSA_CHLPN       AKDIFNL-----------------------SPDITIYGKILGGGLPAAALVGHRSILDHL
GSA_PARUW       AQDIYPV-----------------------EPDLTCFGKIIGGGFPAAAFGGREEIMNLL
GSA_LEPIN       MSGLLGI-----------------------WPDLVTYGKIIGGGFPVGCYAGKKDLLDLV
GSA_LEPIC       MSGLLGI-----------------------WPDLVTYGKIIGGGFPVGCYAGKKDLLDLV
GSA_LEPBL       MSGLLGI-----------------------RPDLVTYGKIIGGGFPVGCYAGRRDLLDLV
GSA_LEPBP       MAGITGI-----------------------IPDLVCYGKIIGGGFPVGAYAGKRELMDLV
GSA_BDEBA       MVEKTGI-----------------------RPDLVTYGKIIGGGFPVGCYGGKAELMNMV
GSA_FUSNN       AQEFFGI-----------------------TPDLTTLGKIIGGGYPVGAFGGKKEIMDLV
GSA_METI4       AQEIFGI-----------------------QPDLTVLGKIIGGGLPVGAVGGKKEIMDSL
GSA_AERPE       AQGYFNI-----------------------EGDIIVLGKIIGGGFPVGAVAGSREVMSLL
GSA_HYPBU       AQEYYRV-----------------------KADITTLGKIVGGGFPIGVVVADRKIMEHL
GSA_SULAC       AQGTFNV-----------------------TPDLTTLGKIIGGGLPIGAVAGKKEIIDML
GSA_SULTO       AQGYFKV-----------------------IPDLTTLGKIIGGGLPIGAVTGKKEIMSNL
GSA_SACS2       AQSYYQI-----------------------YPDITTLGKIIGGGFPIGAVAGKAEIIDNF
GSA_PYRAE       AQGLFGI-----------------------RPDLTTLGKVVGGGFPIGIFGGRGEVMDLV
GSA_PYRCJ       AQGLYGV-----------------------VPDLTTLGKVIGGGFPIGVFGGKSFIMDLV
GSA_THEAC       YQDIIGI-----------------------RPDLTTMGKIIGGGMPIGLFGGSADIMKKV
GSA_THEVO       FQDIMRI-----------------------DPDITTMGKIIGGGLPIGLFGGSEEIMKNI
GSA_PICTO       YQDIINI-----------------------KPDITTMGKIIGGGAPIGLFGSSSEIMDLI
GSA_ARCFU       AQEYYGV-----------------------KPDLTTLGKIAGGGLPIGIFGGRKEIMERV
GSA_METAR       AQGYYGV-----------------------EPDLTTLGKIAGGGLPIGIFGGRKDIMETV
GSA_METAC       AQEYFGV-----------------------VPDMTTLGKIVGGGLPIGVFGGRREIMEMI
GSA_METMA       AQEYFGV-----------------------VPDMTTLGKIVGGGLPIGVFGGKREIMEMI
GSA_METBF       AQEYFGI-----------------------VPDMTTLGKIVGGGLPIGVFGGKREIMEMI
GSA_METJA       AQEYFGV-----------------------VPDIATLGKILGGGFPIGAIVGRRELMEQF
GSA_METMP       AQEYYGI-----------------------KSDLATVGKILGGGFPIGAITGKKEYMEQF
GSA_METST       AQEYYNV-----------------------IPDLATFGKIVGGGFPIGAIAGKKEYMEQF
GSA_METTH       AQEYYRV-----------------------EPDLVTLGKIVGGGFPMGALAGRREIMENI
GSA_METKA       AQEYYGI-----------------------DADLVCLGKILGGGLPIGAFGGPEEYMSRV
GSA_HALMA       AQGAFDI-----------------------DPDITTFGKIVGGGFPVGAIGGKSEIIEQF
GSA_HALLT       AQSKFGV-----------------------TPDVTTFGKIIGGGFPVGAIGGQAEIIEEF
GSA_HALSA       AQSEFDI-----------------------TPDVTTFGKIIGGGFPVGAIGGRTDVMEEF
GSA_HALS3       AQSEFDI-----------------------TPDVTTFGKIIGGGFPVGAIGGRTDVMEEF
GSA_NATPD       AQGKFDI-----------------------DPDITTFGKIIGGGFPVGAIGGKTEYIEQF
                                                *:   .*: ..*   .        :  .

GSA1_BACAN      APLGPAYQAGTMAGNPASMASGIACLEVLQQ---EGLYEKLDELGAMLEKGILEQAAKHN
GSA1_BACHK      APLGPAYQAGTMAGNPASMASGIACLEVLQQ---EGLYEKLDELGAMLEKGILEQAAKHN
GSA1_BACCR      APLGPAYQAGTMAGNPASMASGIACLEVLQQ---EGLYEKLDELGAMLEKGILEQAAKHN
GSA1_BACCZ      APLGPAYQAGTMAGNPASMASGIACLEVLQQ---EGLYEKLDELGAMLEKGILEQAAKHN
GSA1_BACC1      APLGPAYQAGTMAGNPASMASGIACLEVLQQ---EGLYEKLDELGAMLEKGILEQAEKHN
GSA1_BACLD      APLGPAYQAGTMAGNPASILSGIACLEVLKE---KGTYEKLDRLGAMLEEGILAHAETHG
GSAB_BACSU      APLGPAYQAGTMAGNPASILSGIACLEVLKE---KGVYEKLDHLGAMLEEGILKHAETHG
GSA1_GEOKA      APLGPAYQAGTMAGNPASVLAGIACLEVLKQ---EGVYEHLDRLGAMLEEGILAHARQCG
GSA1_OCEIH      APLGPAYQAGTMSGNPASMAAGIACLEVLKE---EGVYEELDRLGKRLEEGILEQAREHG
GSA2_LISMO      APLGPAYQAGTHAGNPASILSGIACLEVLQE---EGLYERFEKYGSMLKDGIEKAAAKHN
GSA2_LISMF      APLGPAYQAGTHAGNPASILSGIACLEVLQE---EGLYERFEKYGSMLKDGIEKAALKHG
GSA2_LISIN      APLGPAYQAGTHAGNPASILSGIACLEVLQE---EGLYDRFEKYGSMLKEGIEKAAIKHG
GSA1_BACSK      APLGPAYQAGTMAGNPASMSAGIACLEVLRT---EGVYEKLDELGARLEEGLYLAAAKAN
GSA1_BACHD      APLGPAYQAGTMAGNPASMSAGIACLEVLQE---EGLYDELDRKGAILEKGIKAHAEAHG
GSA2_STAAC      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAA3      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAAR      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAAB      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAAS      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAAW      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAAM      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAAN      APLGPAYQAGTMAGNPLSMKAGIALLEVLEQ---DGVYEKLDSLGQQLEEGLLKLIEKHN
GSA2_STAES      APLGPAYQAGTMAGNPLSMRAGIALLEVLEQ---EGVYDKLDQLGRRLEEGLQKLIDKHH
GSA2_STAEQ      APLGPAYQAGTMAGNPLSMRAGIALLEVLEQ---EGVYDKLDQLGRRLEEGLQKLIDKHH
GSA1_STAS1      APLGPAYQAGTMAGNPLSMKGGIALLEVLEQ---DGVYEQLDALGKRLEDGLLSLINKHN
GSA_SYMTH       APLGPAYQAGTLAGNPLCMQVALTGLEILSR---PGVYERLDADAAYLADGLVRSARSHG
GSA_ACAM1       APAGPMYQAGTLSGNPLAMTAGIKTLELLR--R-SGTYDQLDRVTGKLISGLLQIAREAG
GSA_CYAP4       APAGPMYQAGTLSGNPLAMTAGIKTLELIR--Q-TGTYEYLDQITAKLINGLLTIAREAG
GSA_NOSS1       APAGPVYQAGTLSGNPLAMTAGIKTLELLQ--K-PGAYEYLERITKKLADGLLQVALETG
GSA_TRIV2       APAGPVYQAGTLSGNPLAMTAGIKTLELLQ--K-PGAYEYLERITKKLADGLLQVAQETG
GSA_NOSP7       APAGPVYQAGTLSGNPLAMTAGIKTLELLQ--K-PGTYDYLERITKKLADGLLQIAKETG
GSA_TRIEI       APAGPMYQAGTLSGNPLAMTAGIKTLELLK--K-PGTYDQLNKITKRLADGLLNIAKETN
GSA_SYNE7       APAGPMYQAGTLSGNPLAMTAGIKTLELLR--Q-PGTYEYLDQITKRLSDGLLAIAQETG
GSA_SYNP6       APAGPMYQAGTLSGNPLAMTAGIKTLELLR--Q-PATYEYLDQITKRLSDGLLAIAQETG
GSA_SYNP2       APAGPMYQAGTLSGNPLAMTAGIKTLELLQ--R-PGMYGQLETITKKLIDGLLSIAREAG
GSA_RIPO1       APSGPMYQAGTLSGNPLAMTAGIKTLELLQ--K-PGTYDYLNDITQKLADGLLKLAQDAG
GSA_MICAN       APAGPMYQAGTLSGNPLAMTAGIKTLELLQ--R-PGTYQYLDKVTKSLTEGLLKVARDAG
GSA_GLOC7       APSGPMYQAGTLSGNPLAMTAGIKTLELLQ--K-PGTYDYLDRITKKLINGLLTLAKEAG
GSA_SYNY3       APAGPMYQAGTLSGNPLAMTAGIKTLEILQ--K-PGSYEYLDKITKRLVDGLLAAAQDAG
GSA_SYNJB       APAGPMYQAGTLSGNPLAMTAGIQTLDILR--R-PGTYEYLERITEKLATGLLQIARETG
GSA_SYNJA       APAGPMYQAGTLSGNPLAMTAGIHTLDILR--R-PGTYEYLERITEQLATGLLQIAQETG
GSA_THEEB       APAGPVYQAGTLSGNPLAMTAGIKTLEILS--R-PGSYEHLDRITGKLVQGLLDAAREFG
GSA_PROMA       APAGPMYQAGTLSGNPLAMTAGIKTLEILQ--Q-EGTYERLASITNRLINGICESAKQAG
GSA_PROM4       APAGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYERLESLSQRLINGICESAKKAG
GSA_PROM1       SPSGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYEKLEALTKKLLDGILTAAKESN
GSA_PROMT       SPSGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYEKLEAITKKLLDGILTAAKESN
GSA_PROM3       APAGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYERLESTTERLINGILEAAKAAE
GSA_PROMM       APAGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYERLESTTERLIKGILEAAKAAE
GSA_SYNS9       SPAGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-PGTYEKLAATTERLISGIKTAAGEAG
GSA_SYNPX       APAGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-PGSYEKLTATTEKLIAGIKEAATAAG
GSA_SYNSC       APAGPMYQAGTLSGNPLAMTAGIKTLELLK--Q-PGTYEKLTATTQKLVAGIKDAAQSAG
GSA_SYNPW       APAGPMYQAGTLSGNPLAMTAGIKTLELLR--Q-PGTYEKLTATTEKLIAGIKEAASAAG
GSA_PROMS       APSGPVYQAGTLSGNPLAMTAGIKTLELLK--Q-DGTYDKLDLITSRLIEGIIQSAENNG
GSA_PROM0       APAGPVYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYDKLDSLTSRLIEGIIQSAENNG
GSA_PROM2       APSGPVYQAGTLSGNPLAMTAGIKTLELLK--Q-DGTYDKLDSTTSRLIEGIIQSAENNG
GSA_PROM9       APSGPVYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYEKLDAITSRLIEGIIQSAENNG
GSA_PROMP       APSGPVYQAGTLSGNPLAMTAGIKTLELLK--Q-EGTYEKLESTTSRLIEGIIQSAENNG
GSA_GLOVI       APAGPMYQAGTLSGNPLAMTAGIKTLEILQ--R-PGTYERLEGLSARLADGLLAAAREAG
GSA_CHLSY       APAGPMYQAGTLSGNPLAMTAGLTTLRTAFGGD-AGAFQQAVTRTARLADGLRMLGERYR
GSA_CHLAA       APAGPMYQAGTLSGNPLAMTAGLTTLRTAFGGD-AGAFQQAVTRTARLADGLRMLGERYR
GSA_CHLAD       APAGPMYQAGTLSGNPLAMIAGLTTLRTAFTDD-NTAFQRAVTLTTRLANGLRELGERYR
GSA_ROSCS       APAGPVYQAGTLSGNPLAMAAGAATLRAI--RA-PGVFEQLERAAAMLCSGFEHAAAEAD
GSA_ROSS1       APAGPVYQAGTLSGNPLAMAAGIATLRII--GA-PGVFERLEQATAALCAGFERAAADAD
GSA_HERA2       APAGTMYQAGTLSGNPLAMVAGIVTLREI--AK-PEVFERLTGVTSTLCQGFWKAAFKNG
GSA_FRACC       APAGPVYQAGTLSGNPIAVAAGLATLR-AC-TD--EVYATVDTRAADVAGIVSTALTEEG
GSA_FRASN       APAGPVYQAGTLSGNPLAVAAGLATLR-AC-TD--EVYATVDARAADVAGIVSTALNEQG
GSA_THEFY       SPEGSVYQAGTLSGNPLATAAGLATLR-NA-TP--EVYAHIDAAAARVSAAVSEALTAEG
GSA_STRAW       APAGPVYQAGTLSGNPVATAAGLAQLR-LL-DD--AAYAKVDAVSAEIRTLVTDALTKEG
GSA_STRCO       APAGPVYQAGTLSGNPVATAAGLAQLR-LL-DD--AAYDTVDAVSAQIQALVTEALTKEG
GSA_STRGG       APAGPVYQAGTLSGNPVATAAGLAQLR-LL-DD--AAYARIDAVSAGLRSLVGEALTKEG
GSA_MYCA1       APLGPVYQAGTLSGNPVAVAAGLATLR-HA-DA--AAYAALDANADRLARLLSDALTNAG
GSA_MYCPA       APLGPVYQAGTLSGNPVAMAAGLATLR-HA-DA--AAYAALDANADRLARLLSDALTNAG
GSA_MYCMM       APLGPVYQAGTLSGNPVAMAAGLATLR-AA-DD--GVYAALDANADRLARLLAGALTDAG
GSA_MYCUA       APLGPVYQAGTLSGNPVAMAAGLATLR-TA-DD--GVYAALDANADRLARLLAGALTDAG
GSA_MYCBO       APLGPVYQAGTLSGNPVAVAAGLATLR-AA-DD--AVYTALDANADRLAGLLSEALTDAV
GSA_MYCTA       APLGPVYQAGTLSGNPVAVAAGLATLR-AA-DD--AVYTALDANADRLAGLLSEALTDAV
GSA_MYCBT       APLGPVYQAGTLSGNPVAVAAGLATLR-AA-DD--AVYTALDANADRLAGLLSEALTDAV
GSA_MYCBP       APLGPVYQAGTLSGNPVAVAAGLATLR-AA-DD--AVYTALDANADRLAGLLSEALTDAV
GSA_MYCTU       APLGPVYQAGTLSGNPVAVAAGLATLR-AA-DD--AVYTALDANADRLAGLLSEALTDAV
GSA_MYCLE       APLGPVYQAGTLSGNPVAMAAGLATLR-AA-AD--AVYATLDRNADRLVAMLSEALTDAG
GSA_MYCLB       APLGPVYQAGTLSGNPVAMAAGLATLR-AA-AD--AVYATLDRNADRLVAMLSEALTDAG
GSA_RHOOB       APAGPVYQAGTLSGNPVAVAAGLASLR-AA-DQ--GVYDALERNSATLRTLLSDALTAAS
GSA_RHOJR       APAGPVYQAGTLSGNPVAVAAGLASLR-AA-DQ--GVYDALERNSATLRTLLSDALTAES
GSA_NOCFA       APLGPVYQAGTLSGNPVAVAAGLATLR-AA-DD--AVYAALDRNAERLGGLLTEALTAAG
GSA_ACIC1       APAGTVYQAGTLSGNPVAVAAGLATLR-ES-TP--DIYARLDHVAAVLARALRDEFGRIG
GSA_CORGL       APQGPVYQAGTLSGNPVAVAAGRASLK-LA-DE--SLYTTINANADRLHGLISDALTHEG
GSA_CORGB       APQGPVYQAGTLSGNPVAVAAGRASLK-LA-DE--SLYTTINANADRLHGLISDALTHEG
GSA_COREF       APQGPVYQAGTLSGNPVAVAAGRASLS-AA-TE--EVYRTIDANADRLHGLISDALTREG
GSA_CORDI       APEGPVYQAGTLSGNPVAMAAGMKSLE-LA-TP--EVYDMVRANADRLAGLLHEALDREG
GSA_CORA7       APSGPVYQAGTLSGNPVAMASGLASLE-LA-NA--ELYPRLQDNADRLTGLITEALSAAG
GSA_CORJK       APVGPVYQAGTLSGNPVAVASGLASLK-LA-DA--AAYQTLDANADALAGILSDALTKAS
GSA_CLAM3       APLGPVYQAGTLSGNPVAVAAGLTTLR-LA-DA--GVYRALDIAADILIYAVELAFDRAG
GSA_CLAMS       APLGPVYQAGTLSGNPVAVAAGLTTLR-LA-DA--DVYRALDIAADILIYAVELAFDRAG
GSA_LEIXX       APAGPVYQAGTLSGNPVAVAAGLATLA-HA-GE--AVYDRLDIVAGTLSAAVSDALTAEG
GSA_KOCRD       APTGPVYQAGTLSGNPVAMAAGLATLK-CA-DA--VAYQTIDRRSEQLRAGLREALDAAG
GSA_CUTAK       APTGPVYQAGTLSGNPLATVAGVKTLQ-LA-DA--EVYQRLDVRSEKWRNELESALDAAG
GSA_PROFF       APEGPVYQAGTLSGNPAACAAGLATLA-LM-DD--AAYSRLDATADRVSAMADAALESAG
GSA_TROW8       SPSGPVYQAGTLSGNPLATAAGLATLR-LA-DS--NIYEHMNRVARALINEIQSAFHDAG
GSA_TROWT       SPSGPVYQAGTLSGNPLATAAGLATLR-LA-DS--NIYEHMNRVARALINEIQSAFHDAG
GSA_ANAD2       APAGPIYQAGTLSGNPMAMAAGHAALK-LM-TE--AAYRKLEALSAALAEGLQAAAAEAN
GSA_ANASK       APAGPIYQAGTLSGNPMAMAAGHAALK-LM-TE--AAYRKLEALSAALAEGLQAAAAEAK
GSA_ANADE       APAGPIYQAGTLSGNPMAMAAGHAALK-LM-TE--AAYRKLETLSAALADGLSAAAAEAK
GSA_ANADF       APAGPIYQAGTLSGNPMAMAAGHATLR-LM-TG--AAYEKLERLSAKLADGLRERAAAAK
GSA_MYXXD       APAGPVYQSGTLSGNPVAVAAGLACLKALA-AP--GTYARLEEVSRMLEVGLLAEAKAAD
GSA_CARHZ       APAGPVYQAGTLSGNPLAMTAGIATLTVLK-EE--GVYEQLEEKSSYLESGLKEAARAAG
GSA_PELTS       APSGPVYQAGTLSGNPLAVSAGIATLEVLK-QP--GVYGRLEQTAAALEDALKQAARQTG
GSA_MOOTA       APSGPIYQAGTLSGNPLAVSAGLATLKVLK-KP--GTYERLESLSARLEKGLKEAAAEAG
GSA_THERP       APNGPVYQAGTLAGNPLSMVAGLATLELAR-EP--GVYGRLETLAAWLQRGLEETIQESG
GSA_THET2       APLGPVYQAGTLSGNPLAMAAGLATLELLE-EN-PGYYRYLEDLGARLERGLKEVLAQKG
GSA_THET8       APLGPVYQAGTLSGNPLAMAAGLATLELLE-EN-PGYYAYLEDLGARLEAGLKEVLKEKG
GSA_DEIRA       SPQGPVYQAGTLSGNPLAMAAGIATLRELK-AN-PGLYRQLDEYAARLAAGLRGAAERAG
GSA_RHOBA       LPAGKVFQAGTLSGNPVAVAAGSATLRLLK-EN--PPYEQLERLADRLADGLDRAATSAG
GSA_SORC5       SPLGPVYQAGTLSGNPLAVTAGLATLDRLT-P---ALYERLEELGASLEEGLRAAAEGAG
GSA_CALBD       APQGNVFQAGTMSGNPIVMSAGYATIKKLK-EN-PHFYSNLEMLAGKLEKELTQVFSNSN
GSA_CALS8       APQGNVFQAGTMSGNPIVMSAGYATIKKLK-EN-PDIYTYLELLAQKLEGNLAKVFSSSN
GSA_CLOAB       SPLGPVYQAGTMSGNPVVMAAGYASLRQLH-EN-PEYYTYMDKLGSKLEAGILEISKEKG
GSA_CLOTE       SPIGPVYQAGTMSGNPVVMAAGYTTLRKLY-NN-PSYYEHMEKIGAELQKGIEIVAKEKG
GSA_CLOBA       SPCGGVYQAGTMSGNPIVMAAGLATLTKLK-NN-TEFYDNVEKMGKKLQDGLIKISEENN
GSA_CLOBB       SPCGGVYQAGTMSGNPVVMSAGLATLTKLK-NN-IELYDHVEKIGEKLQEGLIKISKEND
GSA_CLOB8       SPLGGVYQAGTMSGNPIVMAAGIATLNKLK-NN-QNYYDHIENIGARLEEGIINISKKYD
GSA_CLOP1       SPLGGVYQAGTMSGNPIVMSAGLATVKKLY-EN-PSYYDHIEKIGSKLEKGVLEIAKKKG
GSA_CLOPS       SPLGGVYQAGTMSGNPIVMSAGLATVKKLY-EN-PSYYDHIEKIGSKLEKGIIEIAKKKG
GSA_CLOPE       SPLGGVYQAGTMSGNPIVMSAGLATVKKLY-EN-PSYYNHIEKIGSKLEKGVLEIAKKKG
GSA_CLOK5       SPLGPVYQAGTMSGNPIVMAAGLATLKKLN-EN-PDYYVKLEKLGKKLEKGIKQISKDKN
GSA_AQUAE       APEGEVYQAGTLAGNPLAMVSGSETLKDL--RD-KEPYKELEEKMEKLARGVKDILTEKG
GSA_HYDS0       APEGPIYQAGTLSGNPISVASGLAILKTLI-KD-IAIYDRLSELRAYLTYTLSKMLSEKG
GSA_PERMH       APVGPVYQAGTLSGNPLAMAGGLRQLQIL--KE-KNPYPDLDRKGKKLEEGLRYLSEKYG
GSA_SULSY       APVGPVYQAGTLSGNPLAMAAGLTQLQLL--KQ-LNPYQELNEKGRFLEEGFKKISQETG
GSA_DESVH       APCGEVYQAGTLSGNPLAMAAGIATLDVLS-RS-D--YAGLEARVAAFVKELEAILKGKG
GSA_DESVV       APCGEVYQAGTLSGNPLAMAAGIATLDVLS-RS-D--YAGLEARVSAFVKELEAILKGKG
GSA_DESVM       APCGEVYQAGTLSGNPLAMAAGIATLAELK-KS-D--YDALEARVAALATELQAILAAKG
GSA_DESAG       APCGDVYQAGTLAGNPVAMAAGIATLAELK-KA-D--YPALEKRVDALASEIEAILKAKG
GSA_LAWIP       APLGEIYQAGTLSGNPLVMTAGFETLQLLK-DI-N--YTILEKQVATFANELEVILKDKG
GSA_SYNWW       APEGDVYQAGTLSGNPLAMAAGSATLKILR-AG-KC-YELLESTAASLCGQLNQILAQHD
GSA2_BACAN      APSGPIYQAGTLSGNPLAMAAGYETLVQLT-PE---SYVEFERKAEMLEAGLRKAAEKHG
GSA2_BACHK      APSGPIYQAGTLSGNPLAMAAGYETLVQLT-PE---SYVEFERKAEMLEAGLRKAAEKHG
GSA2_BACCZ      APSGPIYQAGTLSGNPLAMAAGYETLVQLT-PE---SYVEFERKAEMLEAGLRKAAEKHG
GSA2_BACCR      APSGPIYQAGTLSGNPLAMAAGYETLVQLT-PE---SYVEFERKAEMLEAGLRKAAEKHG
GSA2_BACC1      APSGPIYQAGTLSGNPLAMAAGYETLVQLT-PE---SYVEFERKAEMLEAGLRKAAEKHG
GSA2_BACLD      APSGPIYQAGTLSGNPLAMTAGLETLKQLT-PE---SYREFSRKADRLEKGISEAAEKNG
GSA_BACSU       APSGPIYQAGTLSGNPLAMTAGLETLKQLT-PE---SYKNFIKKGDRLEEGISKTAGAHG
GSA2_GEOKA      APSGPVYQAGTLSGNPLAMTAGYETLRQLT-PE---TYEELGRKAARLADGLHQAAEKYD
GSA2_BACSK      APSGPIYQAGTLSGNPLAMTAGYYTLSQLT-KA---DYSEFARKAERLEAGLSAAAKQHG
GSA2_BACHD      APSGPIYQAGTLSGNPLAMTAGYETLVQLT-EA---NYEYFDRLGDRLAEGLSAVAKEYD
GSA1_STAAU      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAAC      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAA8      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAA3      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAAM      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAAN      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAAR      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAAS      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAAW      APLGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAAB      APLGNIYQAGTLSGNPLAMTSGYETLSQLA-PE---TYEYFNMLGDILEDGLKRVFAKHN
GSA1_STAES      APVGTIYQAGTLSGNPLAMTSGYETLSQLT-PE---SYEYFNSLGDILEKGLKEVFAKHN
GSA1_STAEQ      APVGTIYQAGTLSGNPLAMTSGYETLSQLT-PE---SYEYFNSLGDILEKGLKEVFAKHN
GSA2_STAS1      APTGDIYQAGTLSGNPLAMTSGYETLSQLT-PE---TYDYFNKLGDLLEQGLKDVFAKHN
GSA2_STAHJ      APVGNIYQAGTLSGNPLAMTSGYETLSQLT-PE---SYEYFQELGDILEEGLKKVFSKHN
GSA2_OCEIH      APTGPIYQAGTLSGNPLAMTAGYETLSSLS-EE---SYEDINNKVDTLVNGFRDAADKFD
GSA1_LISMO      APAGSIYQAGTLSGNPLAMNAGFETVRQLT-PQ---HYDVFRTLIKRMEEGLTEISARRQ
GSA1_LISMF      APAGSIYQAGTLSGNPLAMNAGFETVRQLT-PQ---HYDVFRTLIKRMEEGLTEISARRQ
GSA1_LISIN      APAGSIYQAGTLSGNPLAMNAGFETVRQLT-PQ---HYDVFRSLIKRMEEGLTEISNRHE
GSA_NATTJ       APAGSIYQAGTLSGNPIAMRAGIETLKVLR-QE-G-SYDQLESKSKHLAEGLAKVADKNG
GSA_THEYD       APDGGVYQAGTLSGNPIAMTAGIETLKVLS-KA-S-VYKRLEKTMQYLEEGLKDSAKQAG
GSA_DESPS       APDGPVYQAGTLSGNPLAMAAGKAALKLLQ-QD-G-FYEDLNQKSAAYADGLLEVAGRVG
GSA_SYNAS       APNGPVYQAGTLSGNPLAMSAGLATLETLR-SR-RDDYAALDRRTADLCAAMGKLFRTAE
GSA_DESOH       APEGNIYQAGTLSGNPVAMAAGIATLSELK-KP-G-VYEALEARTRRLADGLARAAADAG
GSA_SYNFM       APVGNVYQAGTLSGNPLAMAAGLATLDLLC-ED-G-VYESLEEKTNHLVDGLNEAAGAAG
GSA_GEODF       SPSGGVYQAGTLSGNPLAMTAGIETLKLLQ--A-EGFYRNLEEKSSYVAAGIARAAEKAG
GSA_GEOUR       SPSGGVYQAGTLSGNPLAMTAGIETLKLLQ--T-EGFYQDLDRKSDYVASGIAKAAKDAG
GSA_GEOBB       SPAGGVYQAGTLSGNPLAMTAGIETLKLLK--Q-PGFYQKLEEKSAFVAEGIAKAAKDAG
GSA_PELPD       SPSGSVYQAGTLSGNPLAMSAGIATLSLLK--Q-PGFYESLEEKSRHLAEGITDAARLAG
GSA_GEOLS       SPSGGVYQAGTLSGNPLAMTAGIETLKFLQ--Q-PGFYDRLEEKSSQLSEGISLAARDAG
GSA_GEOMG       SPSGGVYQAGTLSGNPLAMTAGIETLKLLQ--E-DGFYGRLEEKSRALAEGIADAARRAG
GSA_GEOSL       SPSGGVYQAGTLSGNPLAMTAGIETLKLLQ--A-DGFYEQLEQTSRRLAEGITEAAKSAG
GSA_PELCD       APDGGVYQAGTLSGNPLAMSAGIATLKLIR--E-EGVYEQLEQRSAYLAEGLRQAAAAAG
GSA_ECOL6       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECOL5       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECO45       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECOK1       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECO27       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECOUT       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECO81       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECO24       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTSRLAEGLLEAAEEAG
GSA_ECO8A       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTSRLAEGLLEAAEEAG
GSA_ECO55       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTSRLAEGLLEAAEEAG
GSA_ECOLC       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTSRLAEGLLEAAEEAG
GSA_ECOSE       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_ECOHS       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_ECOLU       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_ECO57       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_ECO5E       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_SHISS       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_ECO7I       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLREAAEEAG
GSA_ECODH       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_ECOLI       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_ECOSM       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_SHIB3       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_SHIBS       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_SHIDS       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLHELTTRLAEGLLEAAEEAG
GSA_SHIFL       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAG
GSA_SHIF8       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAG
GSA_ESCF3       APIGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLDELTTRLAEGLLEAAEEAG
GSA_SALDC       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAN
GSA_SALSV       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAN
GSA_SALA4       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAN
GSA_SALTI       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAN
GSA_SALG2       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEDAN
GSA_SALNS       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAN
GSA_SALEP       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAN
GSA_SALPB       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLLEAAEEAN
GSA_SALCH       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLCEAAQEVG
GSA_SALPC       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLCEAAQEVG
GSA_SALPA       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLCEAAQEAG
GSA_SALPK       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLCEAAQEAG
GSA_SALHS       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLCEAAQEAG
GSA_SALTY       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLDELTTRLAEGLCEAAQEAG
GSA_SALAR       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGIHETLNKLTTRLAEGLREAAQEAG
GSA_CROS8       APTGPVYQAGTLSGNPIAMAAGFACLSEVAQ---PGVHSTLDALTTQLAEGLLDAAQEAG
GSA_ENT38       APTGPVYQAGTLSGNPIAMAAGFACLTEVAQ---PGIHETLTDLTAQLANGLLEAAEETG
GSA_KLEP3       APTGPVYQAGTLSGNPIAMAAGFACLSEVAQ---PGVHETLTELTNQLADGLLNAARETG
GSA_KLEP7       APTGPVYQAGTLSGNPIAMAAGFACLNEVAQ---PGVHETLTELTNQLAQGLLDAARDAG
GSA_YERPE       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERPP       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERPN       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERPG       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERPA       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERPS       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERPB       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERP3       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERPY       APTGPVYQAGTLSGNPIAMAAGFACLTEISQ---VGVYETLTELTDSLATGLRHAAKEEN
GSA_YERE8       APTGPVYQAGTLSGNPIAMAAGFACLTEVAQ---VGIHETLTELTNLLADGLLDAAKAEN
GSA_ERWT9       APGGPVYQAGTLSGNPIAMAAGFACLTEVAQ---PGTHATLTELTNQLADGLLAAAKAEN
GSA_PECAS       APTGPVYQAGTLSGNPIAMAAGFACLTEVAK---PGVHEKLTALTNQLADGLLAAAKAEN
GSA_PHOLL       APIGPVYQAGTLSGNPIAMAAGLACLKEVSQ---PGVHQRLTELTDNLAAGLTKSAKAAN
GSA_PROMH       APIGPVYQAGTLSGNPIAMAAGLACLQEVSQ---PGVHQTLDELTTMLADGLLEKAQQAG
GSA_SODGM       APTGPVYQAGTLSGNPVAIAAGYACLREVAR---PGVHQQLTQQTERLAQGLLAAAEAAG
GSA_ACTPJ       APTGPVYQAGTLSGNPIAMAAGLACLTELSK---AGNEEKLAAQTKTLAEGFKALADKHN
GSA_ACTP2       APTGPVYQAGTLSGNPIAMAAGLACLTELSK---AGNEEKLAAQTKTLAEGFKALADKHN
GSA_ACTP7       APTGPVYQAGTLSGNPIAMAAGLACLTELSK---AGNEEKLAAQTKTLAEGFKALADKHN
GSA_HAEPS       APTGPVYQAGTLSGNPIAMSAGLACLTELSK---AGNEQLLAEKTKTLAEGFKALADKHG
GSA_ACTSZ       APTGPVYQAGTLSGNPIAMAAGLACLTELSK---PGNEQQLAEKTQQLAEGLKTLAKKHG
GSA_HAES1       APTGPVYQAGTLSGNPIAMSAGIACLNELKK---EGNEQRLAMLTKKLALGLKNLANQHN
GSA_HISS2       APTGPVYQAGTLSGNPIAMSAGIACLNELKK---EGNEQRLAMLTKKLALGLKNLANQHN
GSA_PASMU       APLGPVYQAGTLSGNPIAMAAGLACLTELKK---AGNAQRLAQQTEKLALGLKALADKHH
GSA_MANSM       APTGPVYQAGTLSGNPIAMAAGLACLTELQK---AGNQERLAQLTEKLALGLKALADKHH
GSA_AERHH       APTGPVYQAGTLSGNPVAMAAGLTMLDLLLE---PGLYEQLSAKTARVAEGLKAAAAKHG
GSA_AERS4       APTGPVYQAGTLSGNPVAMAAGLTMLDLLLE---PGLYEQLNAKTARVAEGLKAAAAKHG
GSA_SHEB8       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEELSAKTKRIAEGFKAAADKHG
GSA_SHEB2       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEELSAKTKRIAEGFKAAADKHG
GSA_SHEB5       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEKLSAKTKRIAEGFKAAADKHG
GSA_SHEB9       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEELSAKTKRIAEGFKAAADKHG
GSA_SHEPC       APTGPVYQAGTLSGNPIAMSAGLAQMDALCE---EGLYEALSAKTKRIAEGFKAAADKHG
GSA_SHESW       APTGPVYQAGTLSGNPIAMSAGLAQMDALCE---EGLYEALSAKTKRIAEGFKAAADKHG
GSA_SHESM       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEALSAKTKRIAEGFKAAADKHG
GSA_SHESR       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEALSAKTKRIAEGFKAAADKHG
GSA_SHESA       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEALSAKTKRIAEGFKAAADKHG
GSA_SHEON       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGLYEALSAKTKRIAEGFKAAADKHG
GSA_SHEHH       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGVYEQLAAKTQYIAEGFKAAANKHG
GSA_SHEPA       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---EGVYEQLAAKTQYIAEGFKAAANKHG
GSA_SHESH       APTGPVYQAGTLSGNPIAMSAGLAQMDALCE---EGVYEELAAKTKRIAEGFKAAANKHG
GSA_SHEWM       APTGPVYQAGTLSGNPIAMSAGLAQMEELCA---EGLYQELAAKTKRIAEGFKAAANKHG
GSA_SHEPW       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---DGVYEQLAAKTQYIAEGFKAAANKHG
GSA_SHELP       APTGPVYQAGTLSGNPIAMSAGLAQMEELCA---EGLYEELAAKTKRIAEGFKAAANKHG
GSA_SHEAM       APAGPVYQAGTLSGNPIAMTAGLAQLDALCA---DGLYEELAAKTKRIAEGFKAAADKHG
GSA_SHEDO       APTGPVYQAGTLSGNPIAMSAGLAQMEALCE---PGLYPALAEKTQRIALGMKAAADKHS
GSA_SHEFN       APTGPVYQAGTLSGNPIAMSAGLAQMDALCE---PGLYEALADKTKRVAEGFKAAADKHG
GSA_ALIF1       APTGPVYQAGTLSGNPVAMAAGFACLKVLTE---EGNEKRLADTTRHLANGFKELANKHG
GSA_ALIFM       APTGPVYQAGTLSGNPVAMAAGFACLKVLTE---EGNEKRLADTTKHLANGFKELANKHG
GSA_ALISL       APTGPVYQAGTLSGNPVAMAAGFACLKVLTE---EGNEKRLATTTKQLALGFKELANKHG
GSA_VIBCH       APTGPVYQAGTLSGNPIAMAAGYACLNLLRE---EGNEKRLAAKTKQLADGFKSLADQHG
GSA_VIBC3       APTGPVYQAGTLSGNPIAMAAGYACLNLLRE---EGNEKRLAAKTKQLADGFKSLADQHG
GSA_VIBCM       APTGPVYQAGTLSGNPIAMAAGYACLNLLRE---EGNEKRLAAKTKQLADGFKSLADQHG
GSA_VIBVU       APTGPVYQAGTLSGNPVAMAAGYACLTLLRE---EGNEKRLASKTKHLADGFKSLAAQHG
GSA_VIBVY       APTGPVYQAGTLSGNPVAMAAGYACLTLLRE---EGNEKRLASKTKHLADGFKSLAAQHG
GSA_VIBPA       APTGPVYQAGTLSGNPVAMAAGFACLNLLKE---EGNEKRLASKTKQLADGFKSLAEKHG
GSA_VIBTL       APTGPVYQAGTLSGNPVAMAAGYACLNLLRE---EGNEKRLASKTKQLANGFKQLADKHG
GSA_PHOPR       APTGPVYQAGTLSGNPVAMAAGHACLSVLTE---EGNEKRLANTTKILANGFKSLADKYN
GSA_COLP3       APVGPVYQAGTLSGNPIAMAAGLASLTELAQ---GNKHQQLSSATEKLAMGLKAAAERNG
GSA_PSEHT       APVGPVYQAGTLSGNPIAMAAGLKSLELLSE---PGLHAKLEATSKAICEGFEAGAKKAG
GSA_IDILO       APVGPVYQAGTLSGNPVAMAAGLAALQQLST---PGLYDQLYQRVDTLLDGLQERADRAG
GSA_PSYIN       APTGPVYQAGTLSGNPIAMHAGLAALTALDR---PE-YAQLAEKTKKLALGLKRVAKEEN
GSA_PSEA6       APSGPVYQAGTLSGNPVAMAAGLAALNQVKR---PGLYEELSEATKTLAEGIKAIANGLG
GSA_ACIF2       APTGPVYQAGTLSGNPVAMAAGLATLRLLTV---PGFHERLAAQTAVLCEGLAERAEAAG
GSA_ACIF5       APTGPVYQAGTLSGNPVAMAAGLATLRLLTV---PGFHERLAAQTAVLCEGLAERAEAAG
GSA_METCA       APVGQVYQAGTLSGNPVAMAAGLKTLELISQ---PKFFDELAEKTRHLAEGLRVRAEQAG
GSA_PSEAE       SPLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHDELTAYTTRMLDGLQQRADAAG
GSA_PSEA8       SPLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHDELTAYTTRMLDGLQQRADAAG
GSA_PSEAB       SPLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHNELTAYTTRMLDGLQQRADAAG
GSA_PSEA7       SPLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHDELGAYTTRMLEGLQQRADAAG
GSA_PSEE4       APLGPVYQAGTLSGNPLAMAAGLTTLKLISR---PGFHDELTAFTSRMLDGLQQRADAAG
GSA_PSEPW       APLGPVYQAGTLSGNPLAMAAGLTTLKLISR---PGFHDELSDFTSRMLDGLQQRADAAG
GSA_PSEP1       APLGPVYQAGTLSGNPLAMAAGLTTLKLISR---PGFHAELTDYTSRMLDGLQQRADAAG
GSA_PSEPK       APLGPVYQAGTLSGNPLAMAAGLTTLKLISR---PGFHAELTDYTSRMLDGLQQRADAAG
GSA_PSEPG       APLGPVYQAGTLSGNPLAMAAGLTTLKLISR---PGFHAELTDYTSRMLDGLQQRADAAG
GSA_PSEF5       APLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHAELSDYTSRLLEGLQQRADAAG
GSA_PSEPF       APLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHAELTDYTTRLLDGLQQRADAAG
GSA_PSEMY       APLGPVYQAGTLSGNPLAMAAGLTTLKLISR---PGFHTELSDYTTRMLDGLQQRADAAG
GSA_PSE14       APLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHDELSDYTRRLLEGLQQRADAAG
GSA_PSEU2       APLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHDELSDYTRRLLEGLQQRADAAG
GSA_PSESM       APLGPVYQAGTLSGNPLAMAAGLTTLRLISR---PGFHDELSDYTRRLLEGLQQRADAAG
GSA_PSEU5       APLGPVYQAGTLSGNPLAMAAGLTTLELISR---PGFHDELGAYTSRMLQGLQDRADAAG
GSA_ACIB5       APLGGVYQAGTLSGNPLAMRAGIEMFKHLRQ---PDFYSKLSAQLEKLLAGLQAAADEAG
GSA_ACIB3       APLGGVYQAGTLSGNPLAMRAGIEMFKHLRQ---PDFYSKLSAQLEKLLAGLQAAADEAG
GSA_ACIBT       APLGGVYQAGTLSGNPLAMRAGIEMFKHLRQ---PDFYSKLSAQLEKLLAGLQAAADEAG
GSA_ACIBY       APLGGVYQAGTLSGNPLAMRAGIEMFKHLRQ---PDFYSKLSAQLEKLLAGLQAAADEAG
GSA_ACIBC       APLGGVYQAGTLSGNPLAMRAGIEMFKHLRQ---PDFYSKLSAQLEKLLAGLQAAADEAG
GSA_ACIBS       APLGGVYQAGTLSGNPLAMRAGIEMFKHLRQ---PDFYNKLSVQLEKLLAGLQAAADEAG
GSA_ACIAD       APLGGVYQAGTLSGNPLAMRAGITMFKHLRE---PDFYSKLEAKLQKLLTGLQAAANEAG
GSA_PSYA2       APLGGVYQAGTLSGNPLAMRAGIAMFEDLTA---EGFYDELAVKVDRLVDGFQAAADKHG
GSA_PSYCK       APLGGVYQAGTLSGNPLAMRAGIAMFEDLTA---EGFYDELSAKVDHLVDGFQAAADKHG
GSA_RUTMC       APLGPVYQAGTLSGNPISMSAGLVMLNVLSK--DENFYTILNTKVQKLTKGILAKAKENN
GSA_VESOH       APLGPIYQAGTLSGNPISMSAGLAMLNVLSK--DKNFYTTLNIKVQKLTKGFLAKAKENN
GSA_HAHCH       APLGPVYQAGTLSGNPLAMACGLTMLNKISE---PGFYDALAAKTEALAKGLQERAQAAG
GSA_MARHV       SPLGPVYQAGTLSGNPLAMTAGLTTLNAISE---PGFHDRLTEKTNRVKDGFKAAADEAG
GSA_MARMS       SPLGPVYQAGTLSGNPVAMVAGLAVLNKISE---EGFHQTLGTKADRLVSGLKQAADEAG
GSA_HYDCU       APLGPVYQAGTLSGNPIAMTAGLKTLELISK---PGFFEELEAKTTKLVNGLQKAADEAG
GSA_ALKEH       APEGPVYQAGTLSGNPVAMAAGLATLALVDD---PATHRALEEATATLVDGLRERAEAAG
GSA_HALHL       APTGGVYQAGTLSGNPVTMAAGLATLERITA---PGAFEGLEQTTTRVVDGIKERADAAG
GSA_STRMK       APAGPIYQAGTLSGNPVAMAAGLAMLELVQQ---PGFHADLAERTARLCAGLEAAAADAG
GSA_STRM5       APAGPIYQAGTLSGNPVAMAAGLAMLELIQQ---PGFHADLAERTARLCAGLEAAAADAG
GSA_XANCH       APAGPIYQAGTLSGNPVAMAAGLAMLELVQE---PGFHTRLSEATSMLCEGLEDAARAAG
GSA_XANC5       APAGPIYQAGTLSGNPVAMAAGLAMLELVQE---PGFHTRLSEATSMLCEGLEDAARAAG
GSA_XANAC       APAGPIYQAGTLSGNPVAMAAGLAMLELVQE---PGFHTRLSEATSMLCEGLEDAARAAG
GSA_XANOR       APAGPIYQAGTLSGNPVAMAAGLAMLELVQE---PGFHMRLSEATSALCEGLKDAARTAG
GSA_XANOM       APAGPIYQAGTLSGNPVAMAAGLAMLELVQE---PGFHMRLSEATSALCEGLKDAARTAG
GSA_XANCP       SPAGPIYQAGTLSGNPVAMAAGLAMLQLVQE---PGFHARLSETTSLLCEGLEDAARAAG
GSA_XANC8       SPAGPIYQAGTLSGNPVAMAAGLAMLQLVQE---PGFHARLSETTSLLCEGLEDAARAAG
GSA_XANCB       SPAGPIYQAGTLSGNPVAMAAGLAMLQLVQE---PGFHARLSETTSLLCEGLEDAARAAG
GSA_XYLF2       APTGPIYQAGTLSGNPVAMAAGLAMLELIQA---PDFYTHLSNAAAALCTGLQQAASQAG
GSA_XYLFT       APTGPIYQAGTLSGNPVAMAAGLAMLELIQA---PDFYTHLSNAAAALCTGLQQAASQAG
GSA_XYLFM       APAGPIYQAGTLSGNPVAMAAGLAMLELIQA---PDFYTHLSNAAAALCTGLQQAASQAG
GSA_XYLFA       APAGPIYQAGTLSGNPVAMAAGLAMLELIQA---PDFYTHLSNAAAALCTGLQQAASQAG
GSA_CHRSD       SPLGPIYQAGTLAGNPLAMAAGIALLEKIRQ---PGFHDALAERVATLCDGLEARAREAG
GSA_NITOC       APLGPVYQAGTLSGNPVAMAAGLATLKLIQA---PGFYEHLSRQTQKLVNGILGRARDAD
GSA_THISH       APLGPVYQAGTLSGNPVAMAAGLKTLEIISR---PGFYDELTRKTRVMVDGVLTAAGEAG
GSA_ACISJ       APLGPVYQAGTLSGNPVATACGLATLREIAK---PGFYDALGARTRALIDGLAGAASAAG
GSA_ACIET       APLGPVYQAGTLSGNPVATACGLATLREIAK---PGFYDALGARTRALIDGLAGAASAAG
GSA_ACIAC       APLGPVYQAGTLSGNPVATACGLATLREIAR---PGFYEALGERTRALTGGLADAARAEG
GSA_VEREI       APLGAVYQAGTLSGNPVATACGLATLRAIGQ---PGFFAALSARTRALVEGLRGAAAAEG
GSA_RHOFT       APLGTVYQAGTLSGNPVATACGLATLREISK---PGFYESLARTTRSLTDGLKAAATAEG
GSA_LEPCP       APLGPVYQAGTLSGNPVATACGLATLREISQ---PGFFEALGARTRRLVDGLSAAAADAG
GSA_AZOSB       APLGPVYQAGTLSGSPVAVAAGLASLRLTQA---PGFYDALAARARSLVDGLSGVAREAG
GSA_AROAE       APLGSVYQAGTLSGSPVAVAAGLASLKLLRE---PGFYENLGARTTQLVTGLAAAANDAG
GSA_BORBR       APLGGVYQAGTLSGNPVAVAAGLATMRLIGE---PGFYERLSAQTARLAQGLQERARAAG
GSA_BORPA       TPLGGVYQAGTLSGNPVAVAAGLATMRLIGE---PGFYERLSAQTARLAQGLQERARAAG
GSA_BORPE       APLGGVYQAGTLSGNPVAVAAGLATMRLIGE---PGFYERLSAQTARLAQGLQERARAAG
GSA_BORPD       APLGGVYQAGTLSGNPVAVAAGLATLRLIAQ---PGFYEQLAAQTQRLTDGLRQRARAAG
GSA_BORA1       APLGSVYQAGTLSGNPVAVAAGLATLRLIGQ---PGFYEDLSARTQRLALGLTERAHAAG
GSA_BURCM       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLADGLAAEARAAG
GSA_BURA4       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLADGLAAEARAAG
GSA_BURL3       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLADGLAAEARAAG
GSA_BURCA       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLADGLAAEARAAG
GSA_BURCH       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLADGLAAEARAAG
GSA_BURCC       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLADGLAAEARAAG
GSA_BURCJ       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLTDGLAAEARAAG
GSA_BURVG       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALTAQTKRLADGLAAEARAAG
GSA_BURM1       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYEALTAQTKRLADGLAAEARAAG
GSA_BURMA       APLGGVYQAGTLSGNPVAVAAGLATLRLIQA---PGFHDALADKTRRLADGLAAEARAAG
GSA_BURP1       APLGGVYQAGTLSGNPVAVAAGLATLRLIQA---PGFHDALADKTRRLADGLAAEARAAG
GSA_BURPS       APLGGVYQAGTLSGNPVAVAAGLATLRLIQA---PGFHDALADKTRRLADGLAAEARAAG
GSA_BURM9       APLGDVYQAGTLSGNPVAVAAGLATLRLIQA---PGFHDALADKTRRLADGLAAEARAAG
GSA_BURP0       APLGGVYQAGTLSGNPVAVAAGLATLRLIQA---PGFHDALADKTRRLADGLAAEARAAG
GSA_BURTA       APLGGVYQAGTLSGNPVAVAAGLATLRLIQA---PGFHDALADKTRRLADGLAAEARAAG
GSA_PARPJ       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDTLATRTARLVQGLANVAREAK
GSA_PARXL       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDTLAARTTRLAQGLANVAREAR
GSA_PARP8       APLGGVYQAGTLSGNPIAVAAGLKTLQLIQA---PGFYDALSRRTTRLVQDLTEAAREAK
GSA_CUPTR       APLGGVYQAGTLSGNPLAVAAGLTTLKLIQA---PGFYDRLAAQTRKLADGLAEAARAAG
GSA_CUPNH       APLGGVYQAGTLSGNPLAVAAGLATLKLIQA---PGFYDRLASQTRKLADGLAEAAKAAG
GSA_CUPPJ       APLGGVYQAGTLSGNPLAVAAGLTTLRLIQA---PGFYDKLTAQTRKLADGLSEAARAAG
GSA_CUPMC       APLGGVYQAGTLSGNPLAVAAGLTTLRLIQA---PGFYDRLATQTRKLADGLTKAAREAG
GSA_RALPJ       APLGSVYQAGTLSGNPLAVAAGLTTLRLIAA---EGFHDRLATQTRKLVDGLAEIAREVG
GSA_RALSO       APLGSVYQAGTLSGNPLAVAAGVTTLRLIAA---DGFHDRLAAQTRKLVDGLAGIARDAG
GSA_HERAR       APLGGVYQAGTLSGNPVTVAAGLATLKLIQV---PGFYESLATQTGKLVAGLSAAARAAN
GSA_JANMA       APLGGVYQAGTLSGNPVTVAAGMATLKLIQA---PGFYENLTAQTTKLVHGFSAAAREAD
GSA_CHRVO       APLGTVYQAGTLSGNPLSVAAGLATLKLIQQ---PGFYETLGSRTARLAQGLAEEARKAG
GSA_LARHH       APLGSVYQAGTLSGNPVAVAAGLATLRLIQQ---PGFYDALAARTARLVDGMVAAAREAG
GSA_NEIG1       SPLGGVYQAGTLSGNPIAVAAGLKTLEIIQR---EGFYENLTALTQRLANGI-AAAKAHG
GSA_NEIG2       SPLAGVYQAGTLSGNPIAVAAGLKTLEIIQR---EGFYENLTALTQRLANGI-AAAKAHG
GSA_NEIM0       SPLGGVYQAGTLSGNPIAVAAGLKTLEIIRR---EGFYENLTARTEQLVQGFRTAADAAG
GSA_NEIMF       SPLGGVYQAGTLSGNPIAVAAGLKTLEIIRR---EGFYENLTARTEQLVQGFRTAADAAG
GSA_NEIMA       SPLGGVYQAGTLSGNPIAVAAGLKTLEIIRR---EGFYENLTARTEQLVQGFRTAADAAG
GSA_NEIMB       SPLGGVYQAGTLSGNPIAVAAGLKTLEIIQR---EGFYENLTARTEQLVQGFRTAADAAG
GSA_NITEU       APLGSVYQAGTLSGNPVAVAAGLETLHQIQV---PGFFDKLSTMTRKLTEGLTAVAAKHS
GSA_NITEC       APLGPVYQAGTLSGNPVAVAAGLETLRQVQT---PGFFDKLSMMTRKLTDGLTSVAIKNG
GSA_NITMU       APVGAVYQAGTLSGNPVAVAAGLATLKLVQV---PGFYDKLAARTRKLTEGLAAAAAKQG
GSA_DECAR       APLGPVYQAGTLSGNPIATAAGLATLKLIQA---PGFYEALTAKTKALCDGLVAAAKKHG
GSA_METFK       APLGPVYQAGTLSGNPVAVAAGLATLKQLQR---PGFHEELALKTRQLTDGLARAARDAG
GSA_THIDA       APVGPVYQAGTLSGNPVAVAAGLATLASVSE---PGFYPALAARTEKLVKGLTAAAREAG
GSA_SACD2       APTGPVYQAGTLSGNPVAMAAGLATVQKLEN---PDFYAPLFAKTKTLCEGIQTLAKEAG
GSA_COXBU       SPEGPVYQAGTLSGNPVAMAAGLATLKELTA---ENFYSNLKEKTERLVMGILSRAKAAK
GSA_COXBR       SPEGPVYQAGTLSGNPVAMAAGLATLKELTA---ENFYSNLKEKTERLVMGILSRAKAAK
GSA_COXB2       SPEGPVYQAGTLSGNPVAMAAGLATLKELTA---ENFYSNLKEKTERLVMGILSRAKAAK
GSA_COXB1       SPEGPVYQAGTLSGNPVAMAAGLATLKELTA---ENFYSNLKEKTERLVMGILSRAKAAK
GSA_COXBN       SPEGPVYQAGTLSGNPVAMAAGLATLKELTA---ENFYSNLKEKTERLVMGILSRAKAAK
GSA_FRATF       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---PGFFDELGAKAQKLVDGLNEAAKAYD
GSA_FRATO       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---PGFFDELGAKAQKLVDGLNEAAKAYD
GSA_FRATH       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---PGFFDELGVKAQKLVDGLNEAAKAYD
GSA_FRATM       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---LGFFDELGAKAQKLVDGLNEAAKAYD
GSA_FRATW       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---PGLFDELGAKAQKLVDGLNEAAKAYD
GSA_FRATT       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---PGFFDELGAKAQKLVDGLNEAAKAYD
GSA_FRAT1       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---PGFFDELGAKAQKLVDGLNEAAKAYD
GSA_FRATN       SPAGPVYQAGTLSGNPIAMTAGIKTLEKISQ---PGFFDELGAKAQKLVDGLNEAAKAYD
GSA_FRAP2       SPAGPVYQAGTLSGNPIAMAAGIKTLEKVSQ---DDFFVKLEAKAKQLVDGLNEAARVYD
GSA_LEGPC       APEGPVYQAGTLSGNPLAMAAGLATLKEIEK---INFFEDLSNATNKLTEALADAAENAN
GSA_LEGPH       APEGPVYQAGTLSGNPLAMAAGLATLKEIEK---INFFEDLSNTTNKLTEALADAAENAN
GSA_LEGPL       APEGPVYQAGTLSGNPLAMAAGLATLKEIEK---INFFEDLSSTTNKLTEALSDAAENAN
GSA_LEGPA       APEGPVYQAGTLSGNPLAMAAGLATLKEIEK---INFFEDLSNTTNKLTEALADAAENAN
GSA_CAMC1       SPEGAVYQAGTLSGNPVAMSAGIAAISKINSD--VNLYVRLEKLALKLMDGFKEAAKSAG
GSA_CAMC5       SPDGAVYQAGTLSGNPIAMSAGIAALSKINAS--KNLYAKLENLARRLMQGFKAAANEAD
GSA_CAMFF       SPLGGVYQAGTLSGNPVAMAAGLASLSKIYNS--PNLYKDLENKSKFIVEALENSAKKAG
GSA_CAMHC       SPLGPVYQAGTLSGNPVSMAAGIASLTKIFAS--RNLYTKLENLANMFMIGLKNIAKNHG
GSA_CAMJE       SPLGGVYQAGTLSGNPLAMAAGIASLTKAKKK--TKLYDKLGKLAKKLTQGMKKLADEKG
GSA_CAMJ8       SPLGGVYQAGTLSGNPLAMAAGIASLTKAKKK--TKLYDKLGKLAKKLTQGMKKLADEKG
GSA_CAMJJ       SPLGGVYQAGTLSGNPLAMAAGIASLTKAKKK--TKLYNKLGKLAKKLTQGMKKLADEKG
GSA_CAMJR       SPLGGVYQAGTLSGNPLAMAAGIASLTKAKKK--TKLYDKLGKLAKKLTQGMKKLADEKG
GSA_CAMJD       SPLGGVYQAGTLSGNPLAMAAGIASLTKAKKK--TKLYDKLGTLAKKLTQGMKKLADEKG
GSA_HELPH       SPIGGVYQAGTLSGNPLAVCAGLSALYKIKRD--KTLYTRLNALAIRLTQGLKKSAQSYN
GSA_HELP2       SPIGGVYQAGTLSGNPLAVCAGLSALYKIKRD--KTLYTRLNALAVRLTQGLKRSAQNYN
GSA_HELPG       SPIGGVYQAGTLSGNPLAVCAGLSALYKIKRD--KTLYTRLNALAVRLTQGLKKSAQNYN
GSA_HELPS       SPIGGVYQAGTLSGNPLAVCAGLSALYKIKRD--KTLYTRLNALAVRLAQGLKKSAQSYN
GSA_HELPJ       SPIGGVYQAGTLSGNPLAVCAGLSALYKIKRD--KTLYTRLNALAVRLTQGLQKSAQNYN
GSA_HELPY       SPIGSVYQAGTLSGNPLAVCAGLSALYKIKRD--KTLYTRLDALAIRLTQGLQKSAQNYN
GSA_HELAH       SPIGGVYQAGTLSGNPLAVCAGLSTLYKIKRD--KTLYSRLNALAIRLTQGLKKSAKSYN
GSA_HELHP       SPVGGVYQAGTLSGNPIAVSAGLATLLQIKAN--PTLYEHLEVLAKRLIKGLKEAAQSYE
GSA_WOLSU       SPEGAVYQAGTLSGNPVAMAAGIASIRKIKQGG-EALFSRLESLALRLMEGFKKCAQKHQ
GSA_SULDN       SPEGPVYQAGTLSGNPVAMAAGLAAITKLKQN--GQIISVLNSRATRLVEGMQEAAKTYG
GSA_SULNB       SPEGPVYQAGTLSGNPVAMAAGLTSLRKLKAN--PAIYVELGNKAKKLVEGLKRAADSVN
GSA_STRSV       APLGSIYQAGTLSGNPVAMTAGYETLKQLTPE----LFAEIEEKTSYLCDGLRSLADKYS
GSA_CHLP8       APLGSVYQAGTLSGNPLALTAGLETLKILMEEN-P--YPELERKAAFLEAGFKDNMNKLG
GSA_CHLTE       APLGSVYQAGTLSGNPLALTAGLETLKILMEEN-P--YPELERKAAFLEAGFKANMEKLG
GSA_CHLL2       APLGSVYQAGTLSGNPLALTAGLETLKILMEED-P--YPELERKAAFLEAGFRENMQKLG
GSA_CHLCH       APLGDVYQAGTLSGNPLALTAGLETLKILMDEN-P--YPELERKAVILEEGFKANLAKLG
GSA_PELPB       APLGDVYQAGTLSGNPLALTAGLETLKILIDEN-P--YPELERKAVILESGFNDNLKKLG
GSA_CHLPD       APLGDVYQAGTLSGNPLALTAGLETLKILMDEN-P--YPELERKAAILEAGFRDNMQKLG
GSA_CHLPB       APIGDVYQAGTLSGNPLALTAGLETLKILRDDN-P--YPELERKAAFLEEGFRDNMNKLG
GSA_PROA2       APLGDVYQAGTLSGNPLALTAGLETLKILRDEN-P--YPELERKAAFLEEGFRNNMNKLG
GSA_PELLD       APLGGVYQAGTLSGNPLALTAGIETLKILMEEN-P--YPELDRKGAFLEAGFRDNMQKLG
GSA_CHLPM       APLGGVYQAGTLSGNPLALTAGIETLKILKDEN-P--YPELERKAAFLEAGFRDNMQKLG
GSA_CHLT3       SPVGTVYQAGTLSGNPLAMSAGLATIKILAEEN-P--YPELEKKAVIIEEGFKSNLEKLG
GSA_CYTH3       SPSGPIYQAGTLSGNPIAMSAGLAILQYLQASP-AL-YTQLNDQTDYLIHGMRKANNLLG
GSA_SALRD       APTGPVYQAGTLSGNPLAMRAGHAILSKIAEEK-DRIYDQLEDYAEALQKGTEHNLDALG
GSA_HUNT2       APVGDVYQAGTLSGNPIAMSAGIATLRELYENP-G-IFENINRLGQRLSEGLGKITK---
GSA_FLAJ1       APLGPVYQAGTLSGNPLAMAAGYAMLKALDNDR-E-IFTRLEEKTAYLEAGIDRVLKANN
GSA_FLAPJ       APLGPVYQAGTLSGNPLAMAAGLAMLKALNENQ-E-VFARLEEKTAYLAKGIADVLTSNN
GSA_GRAFK       APVGPVYQAGTLSGNPLAMAAGLAMLTELDSKR-G-IFESLEKKTKYLHEGMEKVLTENK
GSA_WIGBR       SPSGSVYQAGTFSGNPISMISGYACLKLLKS---PDLYNKLNKKTEYLVNELRSSACDNK
GSA_CHLTR       APEGKIFQAGTLSGNPLAMIAGKVSVNLCREQ---GFYTQLATIEQNFLSPIEHMIRTTG
GSA_CHLTA       APEGKIFQAGTLSGNPLAMIAGKVSVNLCREQ---GFYTQLATIEQNFLSPIEHMIRTTG
GSA_CHLT2       APEGKIFQAGTLSGNPLAMIAGKVSVNLCREQ---GFYTQLATIEQNFLSPIEHMIRTTG
GSA_CHLTB       APEGKIFQAGTLSGNPLAMIAGKVSVNLCREQ---GFYTQLATIEQNFLSPIEHMIRTTG
GSA_CHLMU       APVGKVFQAGTLSGNPLAMSAGKASIALCREK---NFYTQLSAIEDDFLSPIEQMIQQSG
GSA_CHLFF       LPLGTVFQAGTLSGNPVAMAAGKASIELCCEP---NFYSKLENLTEGFLSPIEEIIRSKG
GSA_CHLCV       MPVGTVFQAGTLSGNPIAMAAGQASIELCQER---DFYPKLENLTEGFLSPIEDFIRCKG
GSA_CHLAB       LPLGQVFQAGTLSGNPIAMAVGKASLELCREV---DFYPKLENLAQSFFAPIEEVICHQG
GSA_CHLPN       MPEGTIFQAGTMSGNFLAMATGHAAIQLCQSE---GFYDHLSQLEALFYSPIEEEIRSQG
GSA_PARUW       APLGSVYQAGTLSGNPIAMEAGLQSLRLIQQP---GFYEELHRKTDLLLNPIKETIKKNN
GSA_LEPIN       APSGPVYQAGTLSANPFGMRAGLATLKKVQRD---SIYSVLDDRTKIFTDTMTKLLNKKS
GSA_LEPIC       APSGPVYQAGTLSANPFGMRAGLATLKKAQRD---SIYSVLDDRTKIFTDTMTKLLNKKS
GSA_LEPBL       APSGPVYQAGTLSANPFGMRAGLATLKKAERD---SIYSVLEVRTKTFADEMVKLLNGKT
GSA_LEPBP       APSGPVYQAGTLSANPIGMRAGLKTLTKAWTE---NPYPALESATKQLTDGILTLLSEKG
GSA_BDEBA       APSGDVYQAGTLSANPIGMRAGLTTLKKMQRV---DGWNVLEQRTKKFTDAIKAGFVKKG
GSA_FUSNN       APVGRVYHAGTLSGNPIASKAGFATISYLKENP--NIYKELEEKTNYLIDNI-EILAKKY
GSA_METI4       SPLGSVYQAGTLSGNPLAMAAGIAQLEQIKKA---PPYSHLETLGSELESAI-KDIQRKL
GSA_AERPE       TPQGKVFNAGTFNAHPITMAAGLATLKALEE---EPVYSVSREAAKALEEAASEVLDRT-
GSA_HYPBU       TPSGKVFNAGTFNAHPVTMAAGLATIEVLEE---GTPYRVASEAGRALAEELESLVLSY-
GSA_SULAC       TPAGKVFNAGTFNANPLTMTAGLATIEVLER---ENVHEVANRAVNVILEELVNALDKKI
GSA_SULTO       TPEGKVFNAGTFNANPLTMAAGIATIEVLET---TNAYDIANKASKEIAEELDNSLSKK-
GSA_SACS2       TPAGKVFNAGTFNANPISMIAGIATIEELEK---EYPYIIANQAAKTLVEELERLLKTK-
GSA_PYRAE       APSGPVYNAGTYNAHPVSIAAGLAVLKELET---GEPYRIANEAAERLAKGVEDVAGRL-
GSA_PYRCJ       APQGPVYNAGTFNAHPVSIAAGLAVLEELEG---GQVYSVANDAARRMAEGIRDLAERV-
GSA_THEAC       SPSGDVYQSGTFSGNPVTMAAGFAALKKLQ----GMDYASLVRRTEKLMNGIDDILAKR-
GSA_THEVO       SPSGNVYEAGTFSGNPMSMAAGYAAMEKLS----KQDYSILKKRTQKLVSGIDDILDRK-
GSA_PICTO       SPSGNVYESGTFSGNPLSMAAGIAAMEKLQ----GMDYSRINNYTADLVKSLYDIFNDK-
GSA_ARCFU       APSGDVYQAGTFSGNPLSLTAGYATVKFMEE---NGVIEKVNSLTEKLVSGIADVLEDK-
GSA_METAR       APQGGVYQAGTYNGNPLSLTAGMATVEVLEK---ESVHHKVNAKGKALWQSLTDIVRGL-
GSA_METAC       APSGAVYQAGTFSGSPCSVAAGIAVLDYLKK---EDIHAKLNSTGDYMRAVVSEIVEDE-
GSA_METMA       APSGAVYQAGTFSGSPCSVAAGIAMVDYLNE---ENIHAKLNSAGDYMRAALSEIVEDE-
GSA_METBF       SPSGPVYQAGTFSGSPCSIAAGIAVLDYLEQ---EKIHEKVNSKGDYIRAVLTEIVEDE-
GSA_METJA       SPLGAIYQAGTFNGNPISITAGIATLKQLD----DRFYKETARTAKILADTLRELADKH-
GSA_METMP       SPNGQIYQAGTFNGNPISVTAGIETLKNLD----DKFYKETTKKAGILSNCLRETAEKY-
GSA_METST       TPSGKIYQAGTFSGNPMSINGGLAAFEVLD----DNSYKQLHKSGEYFRNGIVDILDKL-
GSA_METTH       SPAGNVYQAGTFNGNPVSVTAGRETLRLLD----GRMYSDLERKGSTLRAGLRDLLSDL-
GSA_METKA       APEGKVYQAGTFNGNPVSATAGLVTLEVLER---ERPYDELSSKAERLASALEDGLEDR-
GSA_HALMA       TPAGDVFQSGTFSGHPVTMAAGLETLRYAAE---HDVYGHVNDLGERLRAGLQDILEDQ-
GSA_HALLT       TPAGDVFQSGTFSGHPVTMAAGKASLEYAAE---NDVYEHVNRLGRKLREGITEICTER-
GSA_HALSA       TPTGDVFQAGTFSGHPVTMAAGLETLQYAAE---NDVYEHVNRLGGRLREGLAAVVAEH-
GSA_HALS3       TPTGDVFQAGTFSGHPVTMAAGLETLQYAAE---NDVYEHVNRLGGRLREGLAAVVAEH-
GSA_NATPD       TPSGDVFQAGTFSGHPVTMAAGLETLKFCAE---EDVYDHVNELGRQLREGLSDIVADQ-
                 * .  :.:**  .       .   .                                  

GSA1_BACAN      -IDITLNR--LKGALTVYFTTNT----IEDYDAAQD------------------------
GSA1_BACHK      -IDITLNR--LKGALTVYFTTNT----IENYDAAQD------------------------
GSA1_BACCR      -IDITLNR--LKGALTVYFTTNT----IEDYDAAQD------------------------
GSA1_BACCZ      -IDITLNR--LKGALTVYFTTNT----IEDYDAAQD------------------------
GSA1_BACC1      -IDITLNR--LKGALTVYFTTNT----IEDYDAAQD------------------------
GSA1_BACLD      -IDITVNR--LKGALTVYFTNEK----VENYEQAEN------------------------
GSAB_BACSU      -ITITVNR--LKGALTVYFSDEK----VENYEQAER------------------------
GSA1_GEOKA      -LPVTVNR--LKGALTVFFTDEK----VENYKQAQR------------------------
GSA1_OCEIH      -IHITVNR--LCGALTVYFGVDQ----ITNYAEADA------------------------
GSA2_LISMO      -IAVTVNQ--IVGALTVYFTEDP----VTNYAEAGA------------------------
GSA2_LISMF      -IAVTVNQ--IVGALTVYFTEDP----VTNYAEAGA------------------------
GSA2_LISIN      -IAVTVNQ--IVGALTVYFTDEP----VTNYAEAGA------------------------
GSA1_BACSK      -VPISINR--LKGALTVYFTDEP----VIDYEGAKR------------------------
GSA1_BACHD      -ITISINR--LKGALTVYFTDET----VTCYEQAER------------------------
GSA2_STAAC      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAA3      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAAR      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAAB      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAAS      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAAW      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAAM      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAAN      -ITATINR--IYGSLTLYFTDEK----VTHYDQVEH------------------------
GSA2_STAES      -ITATINR--IYGSLTLYFTNEK----VTHYEQVEN------------------------
GSA2_STAEQ      -ITATINR--IYGSLTLYFTNEK----VTHYEQVEN------------------------
GSA1_STAS1      -ITATVNR--VYGALTLYFTNET----VVHYDQAEN------------------------
GSA_SYMTH       -HTVQLGR--AGSMFTLFFCDEP----VVDYRTAQR------------------------
GSA_ACAM1       -HEVCGGH--INGMFGMFFA----PGPVHSYDDAKA------------------------
GSA_CYAP4       -HQVCGGH--ISGMFGLFFT----AGPVHNYEDAKK------------------------
GSA_NOSS1       -HAACGGH--ISAMFGLFFT----SGPVHNYEDAKN------------------------
GSA_TRIV2       -HAACGGH--ISAMFGLFFT----SGPVHNYEDAKN------------------------
GSA_NOSP7       -HTACGGQ--ISAMFGLFFT----SGPVHNYEDAKK------------------------
GSA_TRIEI       -NDIWGGH--ISAMFGIFFN----KGPVHNYDDAKK------------------------
GSA_SYNE7       -HAACGGQ--VSGMFGFFFT----EGPVHNYEDAKK------------------------
GSA_SYNP6       -HAACGGQ--VSGMFGFFFT----EGPVHNYEDAKK------------------------
GSA_SYNP2       -HEVTGGN--ISGMFGMFFT----GEPVRNYEDAKK------------------------
GSA_RIPO1       -HAVCGGH--IGAMFGLFLT----AGPVHNYEDAKK------------------------
GSA_MICAN       -HSVSGGY--ISAMFGMFFT----GSPVHNYEDAKK------------------------
GSA_GLOC7       -HEVYGGS--ISGMFGLFFT----GEAVHNYEDAKK------------------------
GSA_SYNY3       -HEVCGGS--ISAMFGIFFA----PGPVRNYEDAKL------------------------
GSA_SYNJB       -HEMCGGY--LPGMFGFFFT----AGPVRNYEEAKT------------------------
GSA_SYNJA       -HEMCGGY--LPGMFGFFFT----AGPVRNYEEAKR------------------------
GSA_THEEB       -HEVCGGH--ISGMFGLFFT----AGPVTNYEQAKQ------------------------
GSA_PROMA       -IPITGSS--ISGMFGFYLC----EGPVRNFEEAKQ------------------------
GSA_PROM4       -IPITGSF--ISGMFGFYLC----EGPVRNFQEAKQ------------------------
GSA_PROM1       -IPIYGQS--ISAMFGFYLC----EGPVRNFEEAKS------------------------
GSA_PROMT       -IPIYGQS--ISAMFGFYLC----EGPVRNFEEAKS------------------------
GSA_PROM3       -VPITGNS--IGAMFGFFLC----EGPVRNFEDAKA------------------------
GSA_PROMM       -VPITGNS--IGAMFGFFLC----EGPVRNFEDAKA------------------------
GSA_SYNS9       -FPITGGS--VSAMFGFFLC----EGPVRNFEEAKA------------------------
GSA_SYNPX       -LPFTGGS--VSAMFGFFLC----EGPVRNFEDAKA------------------------
GSA_SYNSC       -MSITAAS--VSAMFGFFLC----EGPVRNFEEAKA------------------------
GSA_SYNPW       -LPITGGS--VSAMFGFFLC----EGPVRNFEEAKA------------------------
GSA_PROMS       -IAINGGS--VSAMFGFFLC----DGPVRNFNEAKT------------------------
GSA_PROM0       -IAINGGS--VSAMFGFFLC----DGPVRNFNEAKT------------------------
GSA_PROM2       -IAINGGS--ISGMFGFFLC----DGPVRNFEEAKT------------------------
GSA_PROM9       -IAIYGGS--VSAMFGFFLC----DGPVRNFDEAKT------------------------
GSA_PROMP       -IAINGGS--VSAMFGFFLC----EGPVRNFEEAKT------------------------
GSA_GLOVI       -HAATGNR--VGAMFTLFFT----EGPVRNFADAKR------------------------
GSA_CHLSY       -IPVQVGN--VGTMFGCYFLRQE-GSQITSYAEAKAY-----------------------
GSA_CHLAA       -IPVQVGN--VGTMFGCYFLRQE-GSQITSYAEAKAY-----------------------
GSA_CHLAD       -IPLQVGN--VGTMFGCYFLRHA-DAQITNYVEAKAN-----------------------
GSA_ROSCS       -IALRTAY--AGSMWGFFFT----DEPVVDYVSAKK------------------------
GSA_ROSS1       -IPLRAAY--AGSMWGFFFT----GDPVVDYASAKK------------------------
GSA_HERA2       -IPFQAHK--AGSMWGFFFA----GDEVYDFTSAKR------------------------
GSA_FRACC       -VAHLPSS--AGSLFSFFFTDA---ATVVDYAGAQA------------------------
GSA_FRASN       -VPHLLNS--AGSLFSVFFTDA---TAVIDYAGAKR------------------------
GSA_THEFY       -VPHRIQH--GGNLFTVFFTD----TEVVDFDGARA------------------------
GSA_STRAW       -VAHRLQN--ASNMFSVFFTD----RPVNNYEDAKG------------------------
GSA_STRCO       -VAHTLQN--ASNMFSVFFTD----RPVVNYEDAKA------------------------
GSA_STRGG       -VAHTVSA--ASNMFSVFFTD----RPVRDYEDAKQ------------------------
GSA_MYCA1       -VPHQIPR--AGNMLSVFFTD----TPVTDFASARA------------------------
GSA_MYCPA       -VPHQIPR--AGNMLSVFFTD----TPVTDFASARA------------------------
GSA_MYCMM       -VAHQIPR--AGNMLSVFFSE----TPVTDFAAARN------------------------
GSA_MYCUA       -VAHQIPR--AGNMLSVFFSE----TPVTDFAAARN------------------------
GSA_MYCBO       -VPHQISR--AGNMLSVFFGE----TPVTDFASARA------------------------
GSA_MYCTA       -VPHQISR--AGNMLSVFFGE----TPVTDFASARA------------------------
GSA_MYCBT       -VPHQISR--AGNMLSVFFGE----TPVTDFASARA------------------------
GSA_MYCBP       -VPHQISR--AGNMLSVFFGE----TPVTDFASARA------------------------
GSA_MYCTU       -VPHQISR--AGNMLSVFFGE----TPVTDFASARA------------------------
GSA_MYCLE       -VPHQIPR--AGNMFSVFFSE----APVTDFASACN------------------------
GSA_MYCLB       -VPHQIPR--AGNMFSVFFSE----APVTDFASACN------------------------
GSA_RHOOB       -VPHRVQT--AGTMLSVFFSE----DPVTNYEEAKA------------------------
GSA_RHOJR       -VPHRVQT--AGTMLSVFFSE----DPVTNYAEAKA------------------------
GSA_NOCFA       -VEHQVQF--AGNMVSVFFSD----RPVTDYATAKA------------------------
GSA_ACIC1       -LPHQVQQ--AGNLFSVFFTT----EPVRNYAQATG------------------------
GSA_CORGL       -VAHHIQR--ASNMLSIRFAE----GEGHNFSDMKA------------------------
GSA_CORGB       -VAHHIQR--ASNMLSIRFAE----GEGHNFSDMKA------------------------
GSA_COREF       -VAHHIQR--ASNMLSIRFAE----GEGHNFTDMKN------------------------
GSA_CORDI       -VAHHIQR--AATMLSVRFAE----GEGHNFDDMKA------------------------
GSA_CORA7       -VEHYIQR--AETMFSIRFAE----GQGRNFADMQA------------------------
GSA_CORJK       -VAHHIQR--AGSMLSVRFAE----GEGANFADMKA------------------------
GSA_CLAM3       -LAYSVQR--AGSLFSFTFGTPP-EHGITDYATVQA------------------------
GSA_CLAMS       -LAYSVQR--AGSLFSFTFGTPP-EHGITDYATVQA------------------------
GSA_LEIXX       -VAHSVQR--AGNLFSFVFGDVA-AAPRT-FAEVQR------------------------
GSA_KOCRD       -VDYSIQE--VGSLFSLAFGT-R-STGVHDYADAKG------------------------
GSA_CUTAK       -VTYRLQN--AGNLFSVFLGV---DSPVRNYDNAKS------------------------
GSA_PROFF       -VPHRINK--VSNLFSVFLTD----APVTDFASASK------------------------
GSA_TROW8       -VPCTVQS--AGNLFGISFSA----IAPRDFTQATS------------------------
GSA_TROWT       -VPCTVQS--AGNLFGISFSA----IAPRDFTQATS------------------------
GSA_ANAD2       -VPVQVNR--VGSMLTVFFSD----RPVFDAASARA------------------------
GSA_ANASK       -VPVQVNR--VGSMLTVFFSD----RPVFDAASARA------------------------
GSA_ANADE       -VPVQVNR--VGSMLTVFFSH----KPVFDAATARA------------------------
GSA_ANADF       -VPVQVNR--VGSMLTVFFAE----QPVFDAASARA------------------------
GSA_MYXXD       -VPVTVNR--VGSMLTVFFTG----EPVYDYTSAKK------------------------
GSA_CARHZ       -LKLWFNR--VGSMLCTFFTSEE----VVDYKTACT------------------------
GSA_PELTS       -AEVCFNR--AGSMLCAFFTGEE----VKDYASACT------------------------
GSA_MOOTA       -VPVTFNR--VGAMFTTFFNPGP----VTDYATATA------------------------
GSA_THERP       -LPAHVQR--VGSMLTLFFSQQP----VTDAQTAER------------------------
GSA_THET2       -IPHAVNR--VGSMVTVFFTEGP----VVTFQDAKR------------------------
GSA_THET8       -LPHTVNR--VGSMITVFFTEGP----VVTFQDARR------------------------
GSA_DEIRA       -VAVSINH--IGSMLTVFFQDAP-DGSVRDYAAAAR------------------------
GSA_RHOBA       -MAHTVAK--AGAMLTLFFNPEP----VDCWAVADR------------------------
GSA_SORC5       -AAACVQR--VGSMITLFFTKGP----VRSWADAAT------------------------
GSA_CALBD       -LTFCINR--VGSMLTIFFG----VEKVENFEMAKM------------------------
GSA_CALS8       -LTFCINR--VGSMLTVFFG----VEKVENFEMAKK------------------------
GSA_CLOAB       -IPLVVNR--CVNMMTIFFNK---AKEVKSYSDAKA------------------------
GSA_CLOTE       -LPVVVNR--CGAMLTPFFSK---RDKVADYEDAKS------------------------
GSA_CLOBA       -LPLIVNR--VGGMLTLFFTE---LEKVNTYEDVKT------------------------
GSA_CLOBB       -VPLIINR--VGGMLTLFFTE---LEKVNTYEDVKT------------------------
GSA_CLOB8       -LPVVMNR--VGGMMTLFFND---LKEVRTYDDVKK------------------------
GSA_CLOP1       -LGLVVNR--QGGMMTLFFTD---LKEVKCYDDVKT------------------------
GSA_CLOPS       -LGLVVNR--QGGMMTLFFTD---LKEVKCYDDVKT------------------------
GSA_CLOPE       -LGLVVNR--QGGMITLFFTD---LKEVKCYDDVKT------------------------
GSA_CLOK5       -IPMVINR--CGAMFSIFFTS---DSEVKNYKDARK------------------------
GSA_AQUAE       -IQHTINK--VGSMMTVFFT----DKKVVDFQTAKT------------------------
GSA_HYDS0       -IPHRINE--IASMFTIFFT----DKDVIDFKSAKT------------------------
GSA_PERMH       -IPATVNR--VGSMITAFFT----DKEVVDFETAKS------------------------
GSA_SULSY       -VPVVVNR--VGSMITVFFT----DKEVVDFATAKT------------------------
GSA_DESVH       -VPVRINT--LASMFTVFFT----NDPVTDFASAKT------------------------
GSA_DESVV       -VPVRINT--LASMFTVFFT----NDPVTDFASAKT------------------------
GSA_DESVM       -VPVRVNT--IASMFTVFFT----DQPVTDFASAKT------------------------
GSA_DESAG       -VPVTVNR--LASMFTIFFT----EEPVTDYDSAKK------------------------
GSA_LAWIP       -VPVQVSN--FASMFTVFFT----NNELKSFDDVKT------------------------
GSA_SYNWW       -GLLSMNR--VASLFSLFFT----GDKVRDYSSVMR------------------------
GSA2_BACAN      -IPHHINR--AGSMIGIFFT----DEPVINYDAAKS------------------------
GSA2_BACHK      -IPHHINR--AGSMIGIFFT----DEPVINYDAAKS------------------------
GSA2_BACCZ      -IPHHINR--AGSMIGIFFT----DEPVINYDAAKS------------------------
GSA2_BACCR      -IPHHINR--AGSMIGIFFT----DEPVINYDAAKS------------------------
GSA2_BACC1      -IPHHINR--AGSMIGIFFT----DEPVINYDAAKS------------------------
GSA2_BACLD      -IPCTFNR--AGSMIGFFFT----NGPVINYDTAKQ------------------------
GSA_BACSU       -IPHTFNR--AGSMIGFFFT----NEPVINYETAKS------------------------
GSA2_GEOKA      -IPHTINR--AGSMIGFFFT----NEPVVNYETAKT------------------------
GSA2_BACSK      -IPHSINR--AGSMIGLFFT----DERVYNFEKAQT------------------------
GSA2_BACHD      -IPHYTSR--AGSMVGFFFT----DKKVKNFADASS------------------------
GSA1_STAAU      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAAC      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAA8      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAA3      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAAM      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAAN      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAAR      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAAS      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAAW      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAAB      -VPITVNR--AGSMIGYFLN----EGPVTNFEQANK------------------------
GSA1_STAES      -VPITVNR--AGSMIGYFLN----EGPVTNFEEANK------------------------
GSA1_STAEQ      -VPITVNR--AGSMIGYFLN----EGPVTNFEEANK------------------------
GSA2_STAS1      -VPITVNR--AGSMIGYFLN----AGPVTNFEQANN------------------------
GSA2_STAHJ      -VPITINR--AGSMIGYFLN----EGPVTNFEEANK------------------------
GSA2_OCEIH      -IPIHINR--AGSMVGVFFT----DEEVINFETAQT------------------------
GSA1_LISMO      -VPLSINK--AGSMFGFFFT----DQKVINFDTAKT------------------------
GSA1_LISMF      -VPLSINK--AGSMFGFFFT----DQKVINFDTAKT------------------------
GSA1_LISIN      -VPLSINK--AGSMFGFFFT----DQKVTNFDTAKT------------------------
GSA_NATTJ       -VSVTINR--VGTMVGMYFT----EGPVTDFESATS------------------------
GSA_THEYD       -INVKFYR--AGTMFCTYFT----ENEVIDAKTAKT------------------------
GSA_DESPS       -LPMQLNR--VGSVMTSFFT----ATPVTDFETAMK------------------------
GSA_SYNAS       -LPVRINR--AGSLFTVFFT----DSDVFDYETASH------------------------
GSA_DESOH       -VPVQAHA--VGAMLGLFFA----DRPVTDFASAKT------------------------
GSA_SYNFM       -VPVFTSR--IASLGCGFFT----SEPVFDFASALA------------------------
GSA_GEODF       -FPIYSAR--VGSMFCAFFSK----DPVYDWTTAAK------------------------
GSA_GEOUR       -FPIYSTR--VGSMFCAFFSK----KPVYDWTSAAA------------------------
GSA_GEOBB       -FPIYSTR--VGSMFCAFFSK----DPVYDWDSAAK------------------------
GSA_PELPD       -YPIQTTR--VGSMFCAFFSG----QEVYDWAGASG------------------------
GSA_GEOLS       -YPLYSTR--VGSMFCAFFTP----HEVFDWTTAAA------------------------
GSA_GEOMG       -YPIYSTR--VGSMFCAFFTN----GEVHDWTSAAM------------------------
GSA_GEOSL       -YPIYPTR--VGSMFCTFFTS----NEVKDWPTATT------------------------
GSA_PELCD       -VPACLQR--VGSMFCNYFQT----GPVTSFADAKA------------------------
GSA_ECOL6       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOL5       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO45       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOK1       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO27       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOUT       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO81       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO24       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO8A       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO55       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOLC       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOSE       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOHS       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOLU       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO57       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO5E       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SHISS       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECO7I       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECODH       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOLI       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ECOSM       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SHIB3       -TPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SHIBS       -TPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SHIDS       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SHIFL       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SHIF8       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_ESCF3       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALDC       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALSV       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALA4       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALTI       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALG2       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALNS       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALEP       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALPB       -IPLVVNH--VGGMFGIFFTDAE--S-VTYYQDVMA------------------------
GSA_SALCH       -IPLVVNH--VGGMFGIFFTDAE--T-VTCYQDVMA------------------------
GSA_SALPC       -IPLVVNH--VGGMFGIFFTDAE--T-VTCYQDVMA------------------------
GSA_SALPA       -IPLVVNH--VGGMFGIFFTDAE--T-VTCYQDVMA------------------------
GSA_SALPK       -IPLVVNH--VGGMFGIFFTDAE--T-VTCYQDVMA------------------------
GSA_SALHS       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALTY       -IPLVVNH--VGGMFGIFFTDAE--S-VTCYQDVMA------------------------
GSA_SALAR       -IPLVVNH--VGGMFGIFFTDAG--S-VTCYQDVMA------------------------
GSA_CROS8       -VPLVVNH--VGGMFGFFFTDAD--S-VTCYHDVVK------------------------
GSA_ENT38       -VPLVVNH--VGGMFGIFFTDAK--T-VTCYQDVVK------------------------
GSA_KLEP3       -IPLVVNN--VGGMFGIFFTDAE--T-VTCYQDVVK------------------------
GSA_KLEP7       -IPLVVNN--VGGMFGIFFTDAE--T-VTCYQDVVK------------------------
GSA_YERPE       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERPP       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERPN       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERPG       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERPA       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERPS       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERPB       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERP3       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERPY       -IPLVVNH--VGGMFGLFFTNAD--T-VTCYQDVMN------------------------
GSA_YERE8       -IPLVVNH--VGGMFGLFFTDAP--T-VTCYQDVMN------------------------
GSA_ERWT9       -IPLVVNH--VGGMFGLFFTDAA--S-VTRYADVIR------------------------
GSA_PECAS       -IPLVVNQ--AGGMFGLFFTDAE--S-VTCYQDVMK------------------------
GSA_PHOLL       -IPLVVNH--VGGMFGIFFTDAE--T-VTCYQDVMN------------------------
GSA_PROMH       -IPMVVNH--VGGMFGLFFTDAK--E-VTCYQDVMN------------------------
GSA_SODGM       -VPLVVNR--VGGMFGLFFTESP--T-VTCFQDVQA------------------------
GSA_ACTPJ       -VPFTAQY--VGGMFGLFFTEQA--E-ITNFQEVMK------------------------
GSA_ACTP2       -VLFTAQY--VGGMFGLFFTEQA--E-ITNFQEVMK------------------------
GSA_ACTP7       -VPFTAQY--VGGMFGLFFTEQA--E-ITNFQEVMK------------------------
GSA_HAEPS       -IPMTVQY--VGGMFGLFFTEQT--K-IESYQDVMK------------------------
GSA_ACTSZ       -VPFIAQY--VGGMFGLFFTDVP--E-VTNFQDVMK------------------------
GSA_HAES1       -IPLVVNY--VGGMFGIFFTTQN--E-VTSYQQAIQ------------------------
GSA_HISS2       -IPLVVNY--VGGMFGIFFTTQN--E-VTSYQQAIQ------------------------
GSA_PASMU       -VPFVVNY--VGGMFGIFFTEQK--T-VSSYQAVMA------------------------
GSA_MANSM       -VPFTVNY--VGGMFGLFFTDKA--Q-VTCYQDVMA------------------------
GSA_AERHH       -IPLAINY--VGGMFGFFFTDEP--E-VTRYEQVTR------------------------
GSA_AERS4       -IPLAINY--VGGMFGFFFTDEP--E-ITRYEQVTR------------------------
GSA_SHEB8       -IPMAINY--VGGMFGFFFTEQP--E-ITRFDQVTQ------------------------
GSA_SHEB2       -IPMAINY--VGGMFGFFFTEQP--E-ITRFDQVTQ------------------------
GSA_SHEB5       -IPMAINY--VGGMFGFFFTEQP--E-ITRFDQVTQ------------------------
GSA_SHEB9       -IPMAINY--VGGMFGFFFTEQP--E-ITRFDQVTQ------------------------
GSA_SHEPC       -IPMAINY--VGGMFGFFFTEQE--Q-ITRFDQVTK------------------------
GSA_SHESW       -IPMAINY--VGGMFGFFFTEQE--Q-ITRFDQVTK------------------------
GSA_SHESM       -IPMAINY--VGGMFGFFFTEQE--Q-ITRFDQVTK------------------------
GSA_SHESR       -IPMAINY--VGGMFGFFFTEQE--Q-ITRFDQVTK------------------------
GSA_SHESA       -IPMAINY--VGGMFGFFFTEQE--Q-ITRFDQVTK------------------------
GSA_SHEON       -IPMAINY--VGGMFGFFFTEQE--H-ITRFDQVTK------------------------
GSA_SHEHH       -IPMAINY--VGGMFGFFFTDEA--T-VTNFAQVTK------------------------
GSA_SHEPA       -IPMAINY--VGGMFGFFFTSEE--T-VTNFAQVTK------------------------
GSA_SHESH       -IPMSINY--VGGMFGLFFTEEE--K-VTSFEQVTK------------------------
GSA_SHEWM       -IPMSINY--VGGMFGFFFTEEE--K-VTRFDQVTQ------------------------
GSA_SHEPW       -IPMAINY--VGGMFGFFFTDEE--K-VTSFEQVTK------------------------
GSA_SHELP       -IPLSINY--VGGMFGFFFTELE--Q-VTRFDQVTQ------------------------
GSA_SHEAM       -IPMAINY--VGGMFGFFFTDEQ--H-ITRFDQVTR------------------------
GSA_SHEDO       -IPLSITY--VGGMFGFFFTTDS--APMTSFAQVTQ------------------------
GSA_SHEFN       -IPLNITY--VGGMFGFFFTEDN--TPMTSFAQVTK------------------------
GSA_ALIF1       -IPMVVNQ--VGGMFGFFFTDQE--T-VTSYADVAK------------------------
GSA_ALIFM       -IPMVVNQ--VGGMFGFFFTDQE--T-VTSYADVAK------------------------
GSA_ALISL       -LPMVVNY--VGGMFGFFFTDQE--T-ITTYEDVTK------------------------
GSA_VIBCH       -IPLLVHQ--VGGMFGFFFTEQE--T-VTCYEDVAR------------------------
GSA_VIBC3       -IPLLVHQ--VGGMFGFFFTEQE--T-VTCYEDVAR------------------------
GSA_VIBCM       -IPLLVHQ--VGGMFGFFFTEQE--T-VTCYEDVAR------------------------
GSA_VIBVU       -IPLVVNQ--VGGMFGFFFTEQE--Q-ITCYEDVTK------------------------
GSA_VIBVY       -IPLVVNQ--VGGMFGFFFTEQE--Q-ITCYEDVTK------------------------
GSA_VIBPA       -IPLVVNQ--VGGMFGFFFTDQE--T-VTCYEDVTK------------------------
GSA_VIBTL       -IPMLVHQ--VGGMFGFFFTDQE--T-VTCYEDVTK------------------------
GSA_PHOPR       -IPLAINQ--VGGMFGFFFTEQK--T-VTSYADVTK------------------------
GSA_COLP3       -VSLSVNY--VGAMFGFFFTEDK--NPITTYEQATQ------------------------
GSA_PSEHT       -IALTTNY--AGGMYGFFFT-DA--EKVTTYKQATE------------------------
GSA_IDILO       -VPMTTNR--AGSMFGFFFTEEP--E-VTTYAQATQ------------------------
GSA_PSYIN       -VPLAINY--AGGMFGFFFT-EA--EQVSNYTQACA------------------------
GSA_PSEA6       -IPMSVNY--AGSMFGLFFT-DV--ECVTNYQQAIN------------------------
GSA_ACIF2       -VPMQINH--VPGMFGWFFAEQP-VR---GFDTVMA------------------------
GSA_ACIF5       -VPMQINH--VPGMFGWFFAEQP-VR---GFDTVMA------------------------
GSA_METCA       -IPLCVNW--VGGMFGLFFTEQQGVS---RFDQVMA------------------------
GSA_PSEAE       -IPFVTTQ--AGGMFGLYFSGADAIV---TFEDVMA------------------------
GSA_PSEA8       -IPFVTTQ--AGGMFGLYFSGADAIV---TFEDVMA------------------------
GSA_PSEAB       -IPFVTTQ--AGGMFGLYFSGADAIV---TFEDVMA------------------------
GSA_PSEA7       -IPFVTTQ--AGGMFGLYFTDAEAIV---TFEDVMT------------------------
GSA_PSEE4       -VPFVTTQ--AGAMFGLYFSGADDIV---TFDDVMA------------------------
GSA_PSEPW       -VPFVTTQ--AGAMFGLYFSGADDIV---TFDDVMA------------------------
GSA_PSEP1       -VPFVTTQ--AGAMFGLYFSGADDIV---TFEDVMA------------------------
GSA_PSEPK       -VPFVTTQ--AGAMFGLYFSGADDIV---TFEDVMA------------------------
GSA_PSEPG       -VPFVTTQ--AGAMFGLYFSGADDIV---TFEDVMA------------------------
GSA_PSEF5       -IPFVTTQ--AGGMFGLYFSGADDIV---TFDDVMA------------------------
GSA_PSEPF       -IPFVTTQ--AGGMFGLYFSGADDIV---TFEDVMA------------------------
GSA_PSEMY       -IPFVTTQ--AGAMFGLYFSGADDIV---TFADVMA------------------------
GSA_PSE14       -IAFVTTQ--AGGMFGLYFSEAREIV---TFEDVMT------------------------
GSA_PSEU2       -IPFVTTQ--AGGMFGLYFSEADEIV---TFEDVMT------------------------
GSA_PSESM       -IAFVTTQ--AGGMFGLYFSDASEIV---TFEDVMT------------------------
GSA_PSEU5       -IPFVTTQ--VGGMFGLYFSGADDIV---TFADVMA------------------------
GSA_ACIB5       -IPFKTQQ--AGAMFGLYFTDQEDIT---SFDSMLA------------------------
GSA_ACIB3       -IPFKTQQ--AGAMFGLYFTDQEDIT---SFDSMLA------------------------
GSA_ACIBT       -IPFKTQQ--AGAMFGLYFTDQEDIT---SFDSMLA------------------------
GSA_ACIBY       -IPFKTQQ--AGAMFGLYFTDQEDIT---SFDSMLA------------------------
GSA_ACIBC       -IPFKTQQ--AGAMFGLYFTDQEDIT---SFDSMLA------------------------
GSA_ACIBS       -IPFKTQQ--AGAMFGLYFTDQEDIT---SFDSMLA------------------------
GSA_ACIAD       -IAFKTQQ--VGGMFGLYFTDQEDIT---SFDSMLA------------------------
GSA_PSYA2       -INLRTNK--LGGMFGMFFVTDGDTAVPQNFDEVTE------------------------
GSA_PSYCK       -INMRTNK--LGGMFGMFFVKDSATTVPQNFDDVTE------------------------
GSA_RUTMC       -IGMTANV--VGGMFGLFFTDSQSVT---NFKETSQ------------------------
GSA_VESOH       -IGMTANV--VGGMFGLFFTDAKSVT---NFKEVSQ------------------------
GSA_HAHCH       -VPLTINQ--VGGMFGFFFSEEKKVS---RFEQVTR------------------------
GSA_MARHV       -IPLAVQS--AGAMFGFFFTAEPSIT---RFDQVMA------------------------
GSA_MARMS       -VPFCVVS--VGGMFGFFFTEAEVVA---TFADVQK------------------------
GSA_HYDCU       -IAFTTNQ--VGAMFGFFFSEEKDIR---RFSQVAK------------------------
GSA_ALKEH       -VSVSLNQ--AGSMFGLFFTDQNP---VTTFEQVQA------------------------
GSA_HALHL       -IPLATNQ--AGSMFGLFFTDDAP---VTRFEQVKA------------------------
GSA_STRMK       -VAVTTTR--VGAMFGLFFTSEK----VETYAQATA------------------------
GSA_STRM5       -VVVTTTC--VGAMFGLFFTSEK----VETYAQATA------------------------
GSA_XANCH       -IAVTTNQ--VGGMFGLFFTDDV----VESYAQATA------------------------
GSA_XANC5       -IAVTTNQ--VGGMFGLFFTDDI----VESYAQATA------------------------
GSA_XANAC       -IAVTTNQ--VGGMFGLFFTDDI----VESYAQATA------------------------
GSA_XANOR       -IAVTTNQ--VGGMFGLFFTDDI----VESYAQATA------------------------
GSA_XANOM       -IAVTTNQ--VGGMFGLFFTDDI----VESYAQATA------------------------
GSA_XANCP       -VAVTTNQ--VGGMFGLFFTDQI----VENYAQATA------------------------
GSA_XANC8       -VAVTTNQ--VGGMFGLFFTDQI----VENYAQATA------------------------
GSA_XANCB       -VAVTTNQ--VGGMFGLFFTDQI----VENYAQATA------------------------
GSA_XYLF2       -IAMTTQQ--IGGMFGLFFTDQQ----VETYAQATA------------------------
GSA_XYLFT       -IAMTTQQ--IGGMFGLFFTDQQ----VETYAQATA------------------------
GSA_XYLFM       -IAMTTQQ--IGGMFGLFFTDQQ----VETYAQATA------------------------
GSA_XYLFA       -IAMTTQQ--IGGMFGLFFTDQQ----VETYAQATA------------------------
GSA_CHRSD       -VDLITQR--AGGMFGVFFTAQQR---VDNFAQATA------------------------
GSA_NITOC       -IPMTANQ--VGGMFGLFFTGEEE---ITCYEQATN------------------------
GSA_THISH       -IPMTANQ--VGGMFGLFFS-EQP---VTNFYQATQ------------------------
GSA_ACISJ       -VPLCGDT--QGGMFGFFLL----PQLPQNYPEVLN------------------------
GSA_ACIET       -VPFCGDT--QGGMFGFFLL----PQLPQNYPEVLN------------------------
GSA_ACIAC       -LPFSADS--EGGMFGFFLL----PELPRNYPTVMT------------------------
GSA_VEREI       -VAFSADS--EGGMFGFFLL----PALPRNYAQVLQ------------------------
GSA_RHOFT       -LAFSADS--EGGMFGFFLL----DTLPQNYVQVMK------------------------
GSA_LEPCP       -VPFVGDC--QGGMFGFFFPRNRGEGLPQNYATVMA------------------------
GSA_AZOSB       -VPFSADS--IGGMFGIYFS----PSVPASFAEVMA------------------------
GSA_AROAE       -VTFSADS--VGGMFGVYFS----AAVPKSFADVMA------------------------
GSA_BORBR       -VPFSADA--IGGMFGLYFG----DRVPASFAEVSA------------------------
GSA_BORPA       -VPFSADA--IGGMFGLYFG----DRVPASFAEVSA------------------------
GSA_BORPE       -VPFSADA--IGGMFGLYFG----DRVPASFAEVSA------------------------
GSA_BORPD       -IPFAADA--IGGMFGLYFQ----DSVPTSFAEVSA------------------------
GSA_BORA1       -VTFSADA--IGGMFGLYFR----DKVPTSFAEVQT------------------------
GSA_BURCM       -VPFAADS--IGAMFGLYFA----ERVPTSFAEVTK------------------------
GSA_BURA4       -VPFAADS--IGAMFGLYFA----ERVPTSFAEVTK------------------------
GSA_BURL3       -VPFVADS--IGAMFGLYFT----ERVPTSFAEVTK------------------------
GSA_BURCA       -VPFAADS--IGAMFGLYFA----ERVPGSFAEVTK------------------------
GSA_BURCH       -VPFAADS--IGAMFGLYFA----ERVPGSFAEVTK------------------------
GSA_BURCC       -VPFAADS--IGAMFGLYFA----ERVPGSFAEVTK------------------------
GSA_BURCJ       -VPFAADS--IGAMFGLYFA----ERVPTSFAEVTK------------------------
GSA_BURVG       -VPFAADS--IGAMFGLYFA----ERVPASFAEVTK------------------------
GSA_BURM1       -VPFAADS--IGAMFGLYFA----ERVPTSFAEVTK------------------------
GSA_BURMA       -VPFSADA--IGGMFGLYFT----EQVPASFADVTK------------------------
GSA_BURP1       -VPFSADA--IGGMFGLYFT----EQVPASFADVTK------------------------
GSA_BURPS       -VPFSADA--IGGMFGLYFT----EQVPASFADVTK------------------------
GSA_BURM9       -VPFSADA--IGGMFGLYFT----EQVPASFADVTK------------------------
GSA_BURP0       -VPFSADA--IGGMFGLYFT----EQVPASFADVTK------------------------
GSA_BURTA       -VPFSADA--IGGMFGLYFT----EQVPASFADVTK------------------------
GSA_PARPJ       -VPFAADS--LGGMFGLYFT----DSIPTSFAEVTK------------------------
GSA_PARXL       -VPFAADS--LGGMFGLYFT----ESIPTSFAEVTQ------------------------
GSA_PARP8       -IPFTADS--VGGMFGLYFS----ESVPASFAEISR------------------------
GSA_CUPTR       -VPFSADA--VGGMFGLYFR----DGVPASFAEVTQ------------------------
GSA_CUPNH       -VPFAADA--IGGMFGIYFR----EGVPGSFAEVTR------------------------
GSA_CUPPJ       -VPFAADA--IGGMFGIYFR----DGVPGSFAEVTK------------------------
GSA_CUPMC       -VPFCADA--IGGMFGIYFT----NEVPGSFAEVTK------------------------
GSA_RALPJ       -VPFAADS--VGGMFGIYFR----EGVPTSFAEVTK------------------------
GSA_RALSO       -VPFAADS--VGGMFGLYFR----EGVPTSFAEVTQ------------------------
GSA_HERAR       -IAFSANS--VGGMFGMYFA----AEKPQSYTEMMK------------------------
GSA_JANMA       -IAFCANS--VGGMFGLYFA----SEVPVSYDTMMK------------------------
GSA_CHRVO       -VTLSTDS--VGGMFGFYFS----DKAPKSYAEATG------------------------
GSA_LARHH       -IPFSGDC--VGGMFGLYFA----ADVPTSYAEVTA------------------------
GSA_NEIG1       -IEFAADS--VGGMFGLYFA----AHVPRNYADMAR------------------------
GSA_NEIG2       -IEFAADS--VGGMFGLYFA----AHVPRNYADMAR------------------------
GSA_NEIM0       -IEFTADS--VGGMFGLYFA----AHAPRNYADMAR------------------------
GSA_NEIMF       -IEFTADS--VGGMFGLYFA----AHAPRNYADMAR------------------------
GSA_NEIMA       -IEFTADS--VGGMFGLYFA----AHAPRNYADMAR------------------------
GSA_NEIMB       -IEFTADS--VGGMFGLYFA----AHAPRNYADMAR------------------------
GSA_NITEU       -VAFCAQA--VGGMFGLYFR----KSPPESFAEVME------------------------
GSA_NITEC       -VVFSAQA--VGGMFGIYFR----KTPPVSFTEIME------------------------
GSA_NITMU       -VVFCAEA--VGGMFGLYFR----ESAPKSYAEVMS------------------------
GSA_DECAR       -VAFSAQN--IGGMFGLYFA----EQCPGTYDEVLA------------------------
GSA_METFK       -VTFSAQS--VGGMFGLYFS----AECPASFAEVMQ------------------------
GSA_THIDA       -VTFCADS--VGGMFGLYFA----AEPPASFAEVMR------------------------
GSA_SACD2       -IPLTGNY--VGTMWGLFFTE---EEKVTNYQQVMA------------------------
GSA_COXBU       -IPLTANF--SCGIFGLIFTSEE---RVTRYAQAVN------------------------
GSA_COXBR       -IPLTANF--SCGIFGLIFTSEE---RVTRYAQAVN------------------------
GSA_COXB2       -IPLTANF--SCGIFGLIFTSEG---RVTRYAQAVN------------------------
GSA_COXB1       -IPLTANF--SCGIFGLIFTSEE---RVTRYAQAVN------------------------
GSA_COXBN       -IPLTANF--SCGVFGLIFTSEE---RVTRYAQAVN------------------------
GSA_FRATF       -FNFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRATO       -FNFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRATH       -FNFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRATM       -FKFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRATW       -FNFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRATT       -FNFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRAT1       -FNFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRATN       -FNFHAKC--LGGMFGLFFCSDKI--AVNTFVDLGK------------------------
GSA_FRAP2       -FNFHAKY--LGGMFGLFFCNEKV--AVNTFTDLGK------------------------
GSA_LEGPC       -IPFFAAS--LGGMFGFCFTDKN---SVENYLDVAS------------------------
GSA_LEGPH       -IPFFAAS--LGGMFGFCFTDKN---SVENYLDVAS------------------------
GSA_LEGPL       -IPLFAAS--LGGMFGFCFTDKN---SVENYLDVAS------------------------
GSA_LEGPA       -IPFFAAS--LGGMFGFCFTDKN---SVENYFDVAS------------------------
GSA_CAMC1       -ITIQTEV--RGSMFGYFFTDHV----VKNYDDALKS-----------------------
GSA_CAMC5       -IALQTNV--RGSMFGYFFTPHA----VKNYDDALKS-----------------------
GSA_CAMFF       -IALQTEV--RGSMWGYFFNDRP----VKNYKDALNS-----------------------
GSA_CAMHC       -IAIQVAV--RGSMFGYFFTDKA----VKNYNDALSA-----------------------
GSA_CAMJE       -LPLQACH--VGSMFGYFFTKDP----VSNYQDALKS-----------------------
GSA_CAMJ8       -LPLQACH--VGSMFGYFFTKDP----VSNYQDALKS-----------------------
GSA_CAMJJ       -LPLQACH--VGSMFGYFFTKDP----VSNYQDALKS-----------------------
GSA_CAMJR       -LPLQVCH--VGSMFGYFFTKDP----VSNYQDALKS-----------------------
GSA_CAMJD       -LPLQACH--VGSMFGYFFTKDP----VSNYQDALKS-----------------------
GSA_HELPH       -IALETLN--RGSMFGFFFNENA----VCDFDDALKS-----------------------
GSA_HELP2       -IALETLN--RGSMFGFFFNENA----VCDFDDALKS-----------------------
GSA_HELPG       -IALETLN--MGSMFGFFFNENA----VCDFDDALKS-----------------------
GSA_HELPS       -IALETLN--RGSMFGFFFNENA----VRDFDDALKS-----------------------
GSA_HELPJ       -IALETLN--MGSMFGFFFNENA----VRDFDDALKS-----------------------
GSA_HELPY       -IALETLN--MGSMFGFFFNENA----VHDFDDALKS-----------------------
GSA_HELAH       -IALQTLN--RGSMFGFFFNENA----VCDFDDALKS-----------------------
GSA_HELHP       -IPLQVDC--RGSMFGFFFNQKE----VKNFDDAKCS-----------------------
GSA_WOLSU       -IPLQTTV--RGSMFGFFFNHAP----VSNFEEALQS-----------------------
GSA_SULDN       -IAMQIDT--RGSMFGFFFNEKP----VKNFADACNS-----------------------
GSA_SULNB       -VPMVTDV--RGSMFGFFFSDKP----VKNFADAMEN-----------------------
GSA_STRSV       -ISLQVVS--KGTMFGFFFSQKP----VRNFEDSKAA-----------------------
GSA_CHLP8       -LNYTQNR--VGSMACLFFTENE----VYDYNSAITA-----------------------
GSA_CHLTE       -LNYTQNR--VGSMACLFFTETP----VVDYKSAITA-----------------------
GSA_CHLL2       -LNYVQNR--VGSMACLFFTETP----VVDYKSAITA-----------------------
GSA_CHLCH       -LNYVQNR--VGSMSCLFFTETP----VVNYTTAITA-----------------------
GSA_PELPB       -LNYVQNR--VGSMSCLFFTETP----VVDYSTAVTA-----------------------
GSA_CHLPD       -LNFVQNR--VGSMACLFFTETP----VESYASAITA-----------------------
GSA_CHLPB       -LSYVQNR--VGSMACLFFTETP----VENYDTAITC-----------------------
GSA_PROA2       -LNYVQNR--VGSMACLFFTETP----VTDYDTAVTA-----------------------
GSA_PELLD       -LNFVQNR--VGSMACLFFTETP----VESYDSAITA-----------------------
GSA_CHLPM       -LNFVQNR--VGSMACLFFTETP----VESYDSAITC-----------------------
GSA_CHLT3       -LNLCQTR--VGSMSCLFFTDKE----VVDFETANSS-----------------------
GSA_CYTH3       -LDYTFNH--VGSMFTMFFTNIG----VYDFETAKKS-----------------------
GSA_SALRD       -LDYTTHQ--VGAMGSLFFTDAE----VVDQDTAQTA-----------------------
GSA_HUNT2       ---YTVKA--VGSLVCVFMTEEE----VNDYDSAVKS-----------------------
GSA_FLAJ1       -VVFTINR--VGSMISVHFDAGP----VTDFKTAAKG-----------------------
GSA_FLAPJ       -VVHTINR--VGSMVSVHFDANP----VFDFETAKNG-----------------------
GSA_GRAFK       -VDFTINR--IGSMISVHFGTEP----VTDFASAAKS-----------------------
GSA_WIGBR       -IPVVINS--LGSMFSIFFTNLD---KIKCYKDVSS------------------------
GSA_CHLTR       -IPVTLVR--YGSLFSFFFNPNR---P-NNLADAQL------------------------
GSA_CHLTA       -IPVTLVR--YGSLFSFFFNPNR---P-NNLADAQL------------------------
GSA_CHLT2       -IPVTLVR--YGSLFSFFFNPNR---P-NNLADAQL------------------------
GSA_CHLTB       -IPVTLVR--YGSLFSFFFNPNR---P-NNLADAQL------------------------
GSA_CHLMU       -IPVTLVR--YGNLFSFFFSENR---P-NNLKEVQL------------------------
GSA_CHLFF       -FPVSLVR--SGSMFSFFFRDTP---P-ANLSEVQQ------------------------
GSA_CHLCV       -FPIALVR--AGSMFSFFFRETP---P-RNLRDVQE------------------------
GSA_CHLAB       -FPVSLVR--AGSMFSFFFRETP---P-TNLREVQE------------------------
GSA_CHLPN       -FPVSLVH--QGTMFSLFFTESA---P-TNFDEAKN------------------------
GSA_PARUW       -WPICIQQ--AGSMFTLFFCKNR---V-RNLEDALK------------------------
GSA_LEPIN       NQEWEAVI--HSSLFWFRKKTQQ---PIRRIDLIPE------------------------
GSA_LEPIC       NQEWEAVI--HSSLFWFRKKTQQ---PIRRIDLIPE------------------------
GSA_LEPBL       DQEWEAVT--HSSLFWFRKKTQQ---AVRRIDQIPE------------------------
GSA_LEPBP       DTNWEAVT--FGSLFWLKGKTEN---PIRRIDQIPG------------------------
GSA_BDEBA       -VNLEISQ--VASLFWIHGPTAS---PIRSIDHIPA------------------------
GSA_FUSNN       SVNVCVNS--MGSLFTIFFVDID---KVENLEDSLK------------------------
GSA_METI4       PIPFQFNR--RGSLFSFFF-TAK---NIRSATDVYS------------------------
GSA_AERPE       GLPYTINR--VESMMQLFIGVEE----VSNAA------------------------QARK
GSA_HYPBU       GIDAAVNH--VESMLQIFFVKGE----VWSPE------------------------DAAK
GSA_SULAC       PNNFVINH--IGSMFQVFFGVKK----VSNAT------------------------EAKL
GSA_SULTO       NFKYTINR--IQSMFQFFIGISK----VTNAD------------------------DARL
GSA_SACS2       ---HTINH--VGSMFQIFFGIDE----VRNYS------------------------DAKR
GSA_PYRAE       GFDVVVKR--MASMFQFYFKKGD----VKTPQ------------------------DVRE
GSA_PYRCJ       GFDVVVKH--IASMFQFYFKKGD----VKTPQ------------------------DVRE
GSA_THEAC       KIRHVVNG--YRSMFQFFFAES-----AKNYD------------------------EVMK
GSA_THEVO       HITHTIKY--YGTMFQVFFADH-----VNNYD------------------------DALK
GSA_PICTO       NIDVNINH--YGSMFQIFFNKNE----VKTYD------------------------DAIK
GSA_ARCFU       KAECEVGS--LASMFCIYFG-PT----PRNYA------------------------EALQ
GSA_METAR       RMEGQVTPTGIASMFQLFFG-PQ----PENYE------------------------QALK
GSA_METAC       GLDYTVCG--IASMFKIFFG-AE----PHNYQ------------------------EALK
GSA_METMA       GLDYHVCG--IASMFKIFFG-DE----PHNYQ------------------------EVLK
GSA_METBF       GIDYSVCG--IASMFKIFFG-AE----PHNYQ------------------------EALK
GSA_METJA       NIKAKVYN--IASMFQIYFNDKE----VVNYE------------------------IAKQ
GSA_METMP       NIPAKVYN--VASIFQVYFNDKE----IVTYE------------------------DAKS
GSA_METST       NINFHVNG--VESMTQIYFTENE----VYDYK------------------------TAQT
GSA_METTH       DLEYQVTG--PASMFQLYFTGEE----VRNYG------------------------DAKK
GSA_METKA       GIEGVVNR--VESMFQVYFGIEE----VRDYA------------------------DVNS
GSA_HALMA       APEYTVVG--RDSMFKVIFTRDG----PDSLEGQCEAGCQQQESCPRFEYCPKTGHDVTQ
GSA_HALLT       APEYTVVG--TDSMFKTIFTRDA----PDDPDACCAGGCRQNPDCDRYDTCPKNGADVAR
GSA_HALSA       APAYTVVG--RDSMFKVVFTR-D----GDAQSGACTDGCRQDPDCERHAACPKTGADVGD
GSA_HALS3       APAYTVVG--RDSMFKVVFTR-D----GDAQSGACTDGCRQDPDCERHAACPKTGADVGD
GSA_NATPD       APEYTVVG--TDSLFKVVFTRGD----GTPQGEACRNGCRQSSDCSRYGTCPTSATDVRD
                                                                            

GSA1_BACAN      TDGEMFGKFFKLML-QEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK--
GSA1_BACHK      TDGEMFGKFFKLML-QEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK--
GSA1_BACCR      TDGEMFGKFFKLML-QEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK--
GSA1_BACCZ      TDGEMFGKFFKLML-QEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK--
GSA1_BACC1      TDGEMFGKFFKLML-QEGINLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALANNK--
GSA1_BACLD      TDGDMFAAFFKLML-ERGINLAPSKYEAWFITTAHTEEDIKDTLKAVDDSFKQLKQRM--
GSAB_BACSU      SDGETFSTFFKLML-ERGINLAPSKYEAWFITTAHTEQDIKDTLTAVEDAFKHLKN----
GSA1_GEOKA      SDGELFAKFFKLML-KQGINLAPSKYEAWFITLAHTEDDIAYTIDAVGKAFRQL------
GSA1_OCEIH      SDGEAFAKFFQLML-REGINLAPSKYEAWFLTTEHKDSDIENTIDAVGRSFAEMAKTL--
GSA2_LISMO      TNGELFGRFFKGML-EEGINLAPSKYEAWFITSAHSEADILETIQAVDTVFGKMVQDN--
GSA2_LISMF      TNGELFGRFFKGML-EEGINLAPSKYEAWFITSAHSEADILETIQAVDTVFGKMVQDN--
GSA2_LISIN      TNGDLFGRFFKGML-EEGINLAPSKYEAWFITSAHSEADILETIQAVDTVFGKLVQGK--
GSA1_BACSK      SNGDQFSVFFKAML-NEGIHLAPSKYEAWFLTIAHTKNDIDETIEAAYRSFKTVAAGFYS
GSA1_BACHD      SDGEKFSLFFKEML-NQGINLAPSKYEAWFLTIAHTDEDIEKTLQAVDHAFSVMAAKGYH
GSA2_STAAC      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIKQTLKAADYAFSQMK-----
GSA2_STAA3      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIKQTLKAADYAFSQMK-----
GSA2_STAAR      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIKQTLKAADYAFSQMK-----
GSA2_STAAB      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIKQTLKAADYAFSQMK-----
GSA2_STAAS      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIQQTLKAADYAFSQMK-----
GSA2_STAAW      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIQQTLKAADYAFSQMK-----
GSA2_STAAM      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIQQTLKAADYAFSQMK-----
GSA2_STAAN      SDGEAFGKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIQQTLKAADYAFSQMK-----
GSA2_STAES      SDGDAFAQFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIDRTLEAADYAFSKMK-----
GSA2_STAEQ      SDGDAFAQFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIDRTLEAADYAFSKMK-----
GSA1_STAS1      SDGEAFAKFFKLML-NQGINLAPSKFEAWFLTTEHTEEDIDSTLKAVDYAFSQMK-----
GSA_SYMTH       SDPAKFAAMFRGLL-DRGIALAPSRFEAWMLTVQHTRADLEETLQIADEVFAQMAGQ---
GSA_ACAM1       ADAAKFAKFHRGML-EQGVYLAPSQFEAGFTSLAHTDADIDQTLEAAKVVLANI------
GSA_CYAP4       SDLAKFSAFHRGML-EQGVYLAPSQFEAGFTSLAHTEADIDRTLEAARVVLNQL------
GSA_NOSS1       SDTAKFGRFHRGML-ERGVYLAPSQFEAGFTSLAHTDEDIDQTIAIAREVLSSI------
GSA_TRIV2       SDTAKFGRFHRGML-ERGVYLAPSQFEAGFTSLAHTDEDIDQTIAIAREVLSSI------
GSA_NOSP7       SDTAKFGRFHRGML-ERGVYLAPSQFEAGFTSFAHTEEDIDQTLAIARDVMSSL------
GSA_TRIEI       SDLTKFSKFHRGML-EHGIYLAPSQFEAGFTSLAHTEEDIDRTLATAKKVMSSL------
GSA_SYNE7       SDLQKFSRFHRGML-EQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMSAL------
GSA_SYNP6       SDLQKFSRFHRGML-EQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMSAL------
GSA_SYNP2       SDLHKFSRYHRGML-EQGIYLAPSQFEAGFTSLAHTDEDIEKTLAAAKVVLNNL------
GSA_RIPO1       SDLVKFGRFHRAML-ERGVYLAPSQFEAGFTSLAHTQADIDRTLAMAKEVFSHL------
GSA_MICAN       ADVAKFGRFHRGML-ERGVYLAPSQFEAGFTSLAHTEADIERTLAAAKEVLASL------
GSA_GLOC7       SDTAKFGRFHRGML-ERGIYLAPSQFEAGFTSLAHSDEDVEKTLQAAKEVFATL------
GSA_SYNY3       ADTNKFARFHRGML-ERGIYLAPSQYEAGFPSLAHTQEQIDQTIAVAKEVFATL------
GSA_SYNJB       SDLQKFARFHRGML-ERGVYLAPSQFEAGFTSLAHTEADVEKTLAAAREVLSTL------
GSA_SYNJA       SDLQKFARFHRGML-ERGVYLAPSQFEAGFTSLAHTEADVERTLEAAREVLRTL------
GSA_THEEB       SDLKKFAAFHRGML-EQGIYLAPSQFEAGFTSLAHTEADIERTIAAARTVLSQL------
GSA_PROMA       TNSDYFGKLHRAML-AKGVYLAPSAFEAGFTSLAHSEEDIDSTLKAFNECFNELSQ----
GSA_PROM4       TNAELFGKLHRAML-EKGIYLAPSAFEAGFTSLAHSNDDIETTIKAFEASFSEIV-----
GSA_PROM1       SDTELFSKIHRLML-QKGVYLAPSAFEAGFTSLAHSEDDINATIKAFQEIFSEIS-----
GSA_PROMT       SDTELFSKIHRLML-QKGVYLAPSAFEAGFTSLAHSEDDINATIKAFKEIFSEMS-----
GSA_PROM3       TDAERFGKLHRAML-ERGIYLAPSAFEAGFTSLAHSEADIETTLKAFRESFAAVA-----
GSA_PROMM       TDTELFGKLHRAML-ERGIYLAPSAFEAGFTSLAHSEADIETTLKAFRESFAAVA-----
GSA_SYNS9       TDSERFGRLHRAML-ERGVYLAPSAYEAGFTSLAHSDADIEATINAFRESFAVIG-----
GSA_SYNPX       TDSERFGKLHRAML-ERGVYLAPSAFEAGFTSLAHSEADIEATVNAFRESFAEVA-----
GSA_SYNSC       TDSERFGKLHRAML-EHGVYLAPSAFEAGFTSLAHSEADIEATINAFRESFAAVA-----
GSA_SYNPW       TDAERFGKLHRAML-QRGVYLAPSAFEAGFTSLAHSDGDIEATLQAFRESFAEIA-----
GSA_PROMS       NDAELFGKLHKEML-RRGIYLAPSPFEAGFTSLAHSEEEIDKTIEAFDESFNAIKK----
GSA_PROM0       NDAELFGKLHREML-RRGIYLAPSPFEAGFTSLAHSEEEIDKTIEAFDESFNEIKK----
GSA_PROM2       NNSELFGKLHREML-QRGIYLAPSPFEAGFTSLAHSEDEIDQTIEAFDESFNAIKN----
GSA_PROM9       NDAKLFGKLHREML-RRGVYLAPSPFEAGFTSLAHNEEEIDKTIEVFDQCFNTIKNQ---
GSA_PROMP       NNSELFGKLHREML-KRGVYLAPSPFEAGFTSLAHSEEEIDRTLEAFDQSFSVIKN----
GSA_GLOVI       SDLQKFARFHRGML-ERGVYLAPSQFEAGFMSLAHTEEDIDYTVAAARTVLAAL------
GSA_CHLSY       ADSQRYARFFWAMA-DQGIYLAPSQFEAGFLSTAHSDADIDETLAAAEVAFAGLVSSAE-
GSA_CHLAA       ADSQRYARFFWAMA-DQGIYLAPSQFEAGFLSTAHSDADIDETLAAAEVAFAGLVSSAE-
GSA_CHLAD       ADTQRYARFFWAMA-DRGIYLAPSQFEAGFVSTAHTDADIDQTLTAVEEAFAQL------
GSA_ROSCS       SDTQRYAQFFHAML-ERGIYLAPAQFEASFVSLAHSDALIQETIAAAADALRSIQNAARK
GSA_ROSS1       ADTRRYARFFHAML-ERGVYLAPAQFEAAFVSLAHSDALIQETIAAAADALRSL------
GSA_HERA2       ADTAMFGKFFHAML-EQGVYLAPSQFEAAFVSTAHTDELVAQTINAAQAAFASIRS----
GSA_FRACC       QNTARYAAFFHSML-DAGIYLPPSAFEAWFVSAAHDDETVERIAAAAPAAARAAAAVPEP
GSA_FRASN       QASERYAAFFHSML-DAGVYLPPSAFEAWFVSAAHDDEAVERIAAAAPAAARAAAAVGAP
GSA_THEFY       QNTARYAAFFQAML-EQGVYLPPAAFEAWFFSAAHDDAALDRVVSALPAAAKAAAQVA--
GSA_STRAW       QESFRFTAFFHSLL-AQGVYLPPSSFESWFVSTAHDEQAVQRIADALPAAARAAAEATA-
GSA_STRCO       QESFRFTAFFHSLL-ANGVYLPPSSFESWFVSTAHDERAVQRIADALPAAARAAAEATA-
GSA_STRGG       QDVFRFTAFFHSML-AQGVYLPPSAFESWFVSTAHDERAVERVAAALPAAARAAAEATA-
GSA_MYCA1       TQTWRYPPFFHALL-DAGVYPPCSAFETWFVSTALDDDAFDRIAAALPAAARAAAGADEG
GSA_MYCPA       TQTWRYPPFFHALL-DAGVYPPCSAFETWFVSTALDDDAFDRIAAALPAAARAAAGADEG
GSA_MYCMM       SQSWRFAPFFHALL-DAGVYPPCSAFEAWFVSAALDDTAFERIADALPTAARAAANATPE
GSA_MYCUA       SQTWRFAPFFHALL-DAGVYPPCSAFEAWFVSAALDDTAFERIADALPTAARAAANATPE
GSA_MYCBO       SQTWRYPAFFHAML-DAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQERPA
GSA_MYCTA       SQTWRYPAFFHAML-DAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQERPA
GSA_MYCBT       SQTWRYPAFFHAML-DAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQERPA
GSA_MYCBP       SQTWRYPAFFHAML-DAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQERPA
GSA_MYCTU       SQTWRYPAFFHAML-DAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQERPA
GSA_MYCLE       SQVWRYPAFFHALL-DAGVYPPCSTFEAWFVSAALDDAAFGRIVDALPGAAAAAVAARHR
GSA_MYCLB       SQVWRYPAFFHALL-DAGVYPPCSTFEAWFVSAALDDAAFGRIVDALPGAAAAAVAARHR
GSA_RHOOB       AQTWRFPAFFHGLL-SRGVYPPPSAFEAWFVSAAMDDTAFSIIADALPSAAKAAAAAVQP
GSA_RHOJR       AQTWRFPAFFHGLL-SRGVYPPPSAFEAWFVSAAMDDRAFSIIADALPHAAKAAAAAVQP
GSA_NOCFA       SQTWRFPAFFHALL-DGGVYAPPSAFEAWFVSAALDEDAFARIAAALPAAARAAAAATPE
GSA_ACIC1       QEAWRYPPFFHALL-DRGVHPPPSVYEAWFVSAAHDDAAVNQILDALPAAVRAAADARPP
GSA_CORGL       ADIFRFAPFFHTLL-DNGVYAPPSVFETWFVSSALTDDDFSKIEQALKPAARAAAEAKAS
GSA_CORGB       ADTFRFAPFFHTLL-DNGVYAPPSVFETWFVSSALTDDDFSKIEQALKPAARAAAEAKAS
GSA_COREF       ADTFRFAPFFHALL-DHGVYAPPSVFETWFVSSALTDDDFQKIDDALVPAARAAAAATA-
GSA_CORDI       ADTFRFPAFFHALL-DNGIYASPSVFETWFVSAALTDDDFDKIEKALRPAAQAAGKAK--
GSA_CORA7       ADTWRFAPFFHALL-EGGVYVPPSAFETWFVSDALTDNDFEVIEAALKPAAQAAASAQRP
GSA_CORJK       ADTFRYPAFFHAFL-DHGVFAPPSVFETWFVSTALTGADFEKIAAAATPAAEAAAAATPS
GSA_CLAM3       QETWRYPAFFHSML-DQGVSLPPSVFEAWFVSAAMDEASLDRVIRALPAAARAAAAATPP
GSA_CLAMS       QETWRYPAFFHSML-DQGVSLPPSVFEAWFVSAAMDEASLDRVIRALPAAARAAAAATPP
GSA_LEIXX       QEAFRYRAFFHAML-DAGVSLPPSVFEAWFVTAAHDDAAVGRVLEALPAAARAAASACPG
GSA_KOCRD       QEAFRYTPFFHAML-DAGVYLPPSVFEAWFLSAAHDDSAMDRILSALPAAARAAAEAQPP
GSA_CUTAK       QNAEAYTAFFHAML-DAGVNLPPSCFEAWFLSDAHDDEAFEVFRAALPRAAQAAAQVISA
GSA_PROFF       QDTKAFSRFFHAAL-DAGLWLAPSGFEAWFCSTALDDDDLEVIDAGLHKAAQAAAQGLSS
GSA_TROW8       QEHWRYSNFFHSML-NSGVLLPPSVYEAWFVSAAFDDRAIERVVNALPDAVRAAGSAPAR
GSA_TROWT       QEHWRYSNFFHSML-NSGVLLPPSVYEAWFVSAAFDDRAIERVVNALPDAVRAAGSAPAR
GSA_ANAD2       CNTRRFGAFFHAML-EHGAYLPPSQFEAAFLSTAHTDDDVARTVAAARLAFAEAAKVA--
GSA_ANASK       CNTRRFGAFFHAML-EHGAYLPPSQFEAAFLSTAHTDDDVARTVAAARLAFAEAAKVA--
GSA_ANADE       CNTRRFGAFFHAML-EHGAYLPPSQFEAAFLSTAHTDDDVARTVAAARVAFAEAAKVA--
GSA_ANADF       ASTKRFGAFFHRML-EGGAYLPPSQFEAAFLSTAHSEGDVEQTLHASEAAFAEAAKV---
GSA_MYXXD       ADTARFGKFFHAML-NESVYLPPSQFEAAFVSLAIGEPEVAHVLAAARKAFRSLGKTG--
GSA_CARHZ       SDTQKFAVFFKTLL-ENGIYIAPSQFEAMFVSLAHSKDDLDKTIEASYKAFKAAAEN---
GSA_PELTS       SDTARYAAFFRSML-EQGVYLAPSQFEAAFVSLAHGKEEIERTAEAARHAFKAAVEQK--
GSA_MOOTA       SDTRAFAAFFRAML-RQGIYLAPSQFEAAFMSLAHREDDIDCTIAAAREAFKGIAIGDS-
GSA_THERP       CDTARFAAFHRAMR-AQGILLPPSQFEAWFVSLAHREEDIDRTIEAARKALAEVARG---
GSA_THET2       TDTELFKRFFHGLL-DRGIYWPPSNFEAAFLSVAHTEEDVEKTLEALGEAL---------
GSA_THET8       TDTELFKRFFHGLL-DRGIYWPPSNFEAAFLSVAHREEDVEKTLEALRKAL---------
GSA_DEIRA       SDTAAFAAWFQGLL-ARGIYWAPSQFESIFISAAHGEPELAATLEAAAQAFEGVKP----
GSA_RHOBA       CDREAFGRYFWGLI-DEGIYMPCSQFEALFFSQQHTEAMIDETIAAAEKVLKSL------
GSA_SORC5       SDTKRFSAFHAAML-ARGIYWPPSQYEAAFLSGAHSEEDIERTIAACREALAA-------
GSA_CALBD       SDLDLFRSFAEYMI-KNHIYVPSSQFEAMFLSVAHSENDVEKFVEIAEEFCSSKRK----
GSA_CALS8       SNLSMFKKFAEYMI-TNGIYIPSSQFEAMFLSSAHTESDIERFAEVAEGFAKFVKKP---
GSA_CLOAB       SDTKMFARFAEHMI-TSGIYVPPSQFEAMFLGVKHTEEDIERFLDVMKKL----------
GSA_CLOTE       SDTELYGRFFEHMI-KSGIYIAPSQFEAMFIGVKHDIYEVERFLEAMRKF----------
GSA_CLOBA       CDNERFKRYFKHML-NEGFNIAPSQFEAMFLSVKHTEEHIDKFLDAFKRFAINEK-----
GSA_CLOBB       CDNERFKRYFKHML-NEGFNIAPSQFEAMFLSVKHTEEHIDKFLDAFKRFAINEK-----
GSA_CLOB8       CDVNRFNRYFEHML-KSGFNLPPSQFEALFLSVQHKESHIDAFLKAFEEFALNENKMSL-
GSA_CLOP1       CDGERFKRYFLHML-NKGFNIPPSQFEAMFLSVKHTEEHIDKFLEAFESFEG--------
GSA_CLOPS       CDGERFKRYFLHML-NKGFNIPPSQFEAMFLSVKHTEEHIDKFLEAFESFEG--------
GSA_CLOPE       CDGERFKRYFLHML-NKGFNIPPSQFEAMFLSVKHTEEHIDKFLEAFETFEG--------
GSA_CLOK5       CDTTIFAKFFQHML-ERGIYIAPSQFEAIFLNVKHTEEHIDKFLQAVNTF----------
GSA_AQUAE       SDTELFAKFFRALL-NKGVLIPPSQFEAWFLTTAHEEEVIDEALERIRDAVKEL------
GSA_HYDS0       SDTALFGKFFRNAL-KEGVLMPPSQFEAWFLSTAHTKDVVDTTLEKLKKAIDLL------
GSA_PERMH       SDLDRFAKFFRLML-EKGVYLAPSQFEAAFLSTAHSDEDIDETLNKAEDCFKQLL-----
GSA_SULSY       SDTKKFAKFFRCML-EKGIYLPASQFEAFFLSTAHSQRDLEDTLNKAYECFKQLS-----
GSA_DESVH       ADGALYTSFYKQMR-AQGIYLAPSPFEAAMVSFAHTDDDLAAMLDAARKVTF--------
GSA_DESVV       ADGALYTSFYKQMR-AQGIYLAPSPFEAAMVSFAHTDDDLAAMLDAARKVTF--------
GSA_DESVM       ANAALYTSYYKQMR-DKGIYLAPSPFEAAMVSFAHTDADLAALLDAARAITLSA------
GSA_DESAG       ADGTLYTRFYQQMR-DQGIYLAPSGFECAMVSLAHTEDDFAAMLAAVRNVTF--------
GSA_LAWIP       TNTQLYSILFRSMQ-KNNIFLVPSPFETNMVSFAHKEKEFEKALIAAKKIMFNITDVN--
GSA_SYNWW       SDTGKYASFHQQLL-QGGVYFPPSQFEVCFISAAHDEGDVEKTLKTIDKALQQTMVEQ--
GSA2_BACAN      SNLQFFAAYYREMV-EQGVFLPPSQFEGLFLSTVHSDADIEATIAAAEIAMSKLKA----
GSA2_BACHK      SNLQFFAAYYREMV-EQGVFLPPSQFEGLFLSTAHSDADIEATIAAAEIAMSKLKA----
GSA2_BACCZ      SNLQFFAAYYREMV-EQGVFLPPSQFEGLFLSTAHSDADIEATIAAAEIAMSKLKA----
GSA2_BACCR      SNLEFFAAYYREMV-EQGVFLPPSQFEGLFLSTAHSDADIEATIAAAEIAMSKLKA----
GSA2_BACC1      SNLEFFAAYYREMV-EQGVFLPPSQFEGLFLSTAHSDADIEATIAAAEIAMSKLKA----
GSA2_BACLD      SDLGLFAEYYKGMA-DEGVFLPPSQFEGLFLSTAHTDDDIEHTIKAAERVFERISRSR--
GSA_BACSU       SDLKLFASYYKGMA-NEGVFLPPSQFEGLFLSTAHTDEDIENTIQAAEKVFAEISRR---
GSA2_GEOKA      SDLELFAAYYREMA-NEGIFLPPSQFEGLFLSTAHSDDDIEYTIAAAERVFARLRG----
GSA2_BACSK      SDLDLFAAYFRGML-AEGISLAPSQFEGLFLSTAHSNEDIEATIAAAERVFQAIATK---
GSA2_BACHD      SDLEFFAKYFKEML-HLGVSLPPSQFEGMFLSTKHTEADIDFTVDAARQAFKRLKK----
GSA1_STAAU      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAAC      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAA8      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAA3      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAAM      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAAN      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAAR      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAAS      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAAW      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAAB      SDLKLFAEMYREMA-KEGVFLPPSQFEGTFLSTAHTKEDIEKTIQAFDTALSRIVK----
GSA1_STAES      SDLKLFSNMYREMA-KEGVFLPPSQFEGTFLSTAHTKDDIEKTIQAFDNALSRIV-----
GSA1_STAEQ      SDLKLFSNMYREMA-KEGVFLPPSQFEGTFLSTAHTKDDIEKTIQAFDNALSRIV-----
GSA2_STAS1      SDLEMFSQMYREMA-KEGVFLPPSQFEGTFLSTSHTEEDINKTIQAFDTALSRIV-----
GSA2_STAHJ      SNLELFSQMYREMA-KEGVFLPPSQFEGTFLSTAHSKEDIEKTIQAFDTALSRIV-----
GSA2_OCEIH      SNLDYFAQYYRSMV-NEGIFLPPSQFEGLFLSTAHTDDDIEKTVKAIHKAFEQIEK----
GSA1_LISMO      SNLEFFRNYYREML-GQGIFLPPSQFEGVFISTMHTENEIDKTLEAFDTTCKILRG----
GSA1_LISMF      SNLEFFRNYYREML-GQGIFLPPSQFEGVFISTMHTEKEIDKTLEAFDTTCKILRG----
GSA1_LISIN      SDLEFFRNYYREML-AQGIFLPPSQFEGVFISTMHTEKEIDATLEAFDVTCKMLRG----
GSA_NATTJ       SDNDKFVKYFETML-SEGVYLAPSQFEAMFMSLVHTQEDIEKTIQIADKALSKAAQV---
GSA_THEYD       SDTEKFKQFFLGML-QKGVYIAPSQFEAGFISLAHSEKDIEKTVQAAYKIFKKL------
GSA_DESPS       ADTGLYGRHYRQML-DSGIYLAPSQFECSFMSSTHSDADLKRALLETEKSFSLLKNA---
GSA_SYNAS       CNLERYARFFKGML-DRGVYLAPSAFEAAFVSFAHSDEDLEKTLQACAETIKTLGGNP--
GSA_DESOH       SDLSRFAAYYRAML-EKGIFLAPSQFEAIFVSTAHTDDHIDRTVNAAKAVFADL------
GSA_SYNFM       SNTDAYAVFFREML-NRGVYFAPAQFEAFFLSMAHESKDLDFTIEAAGNAFVRVKELCAF
GSA_GEODF       CDTEAFAKYFRLML-GEGIYLAPSQYETAFVSIAHATEDLDRTIAAAEKSFRAL------
GSA_GEOUR       CDTKAFAKYFRLML-DEGIYLAPSQFETAFVSIAHSTDDLDKTIAAAAKAFKSL------
GSA_GEOBB       CDTKAFAAYFKAML-NEGIYLAPSQFETAFVGISHSTEDLEQTIAAAAKCFKAL------
GSA_PELPD       CDTAAFAAYFKAML-NEGIYLAPSQFETAFVSAAHTDADIEATIRAAARCFKLIS-----
GSA_GEOLS       CDTKAFARYFLAML-EEGVYLAPSQFETAFMSAAHSQQDIEATIAAARKCFKLIR-----
GSA_GEOMG       CDTKSFATFFRSML-EEGIYLAPSQFETAFVSIAHSSEDIEKTIAAAFSCFKKL------
GSA_GEOSL       CDTKAFAAFFRMML-EKGIYLAPSQFETAFVSIAHTEVEIEKTIVAARSCFAAL------
GSA_PELCD       SDTEAFARYFGQML-DNGVHLAPSQFEAGFVSLAHTVEDIDRTVEAAHRSLKAI------
GSA_ECOL6       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOL5       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO45       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOK1       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO27       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOUT       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO81       CDVERFKRFFHMML-DEGVYLAPSAFEADFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO24       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO8A       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO55       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOLC       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOSE       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOHS       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOLU       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO57       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO5E       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_SHISS       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECO7I       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECODH       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOLI       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ECOSM       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_SHIB3       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_SHIBS       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_SHIDS       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_SHIFL       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_SHIF8       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_ESCF3       CDVERFKRFFHMML-DEGVYLAPSAFEAGFMSVAHSMEDINNTIDAARRVFAKL------
GSA_SALDC       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRVFAKL------
GSA_SALSV       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRVFAKL------
GSA_SALA4       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRVFATL------
GSA_SALTI       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRVFAKL------
GSA_SALG2       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKL------
GSA_SALNS       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKL------
GSA_SALEP       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKL------
GSA_SALPB       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKL------
GSA_SALCH       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKQ------
GSA_SALPC       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKQ------
GSA_SALPA       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKL------
GSA_SALPK       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKL------
GSA_SALHS       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRVFATL------
GSA_SALTY       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRVFAKL------
GSA_SALAR       CDVERFKRFFHLML-DEGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRVFAKL------
GSA_CROS8       CDVERFKRFFHLML-EEGVYFAPSAFEAGFMSVAHSEEDINNTIDAARRVFAKL------
GSA_ENT38       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSVEDINKTIDAARKVFAKL------
GSA_KLEP3       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSIAHSEEDINNTIDAARRVFAKL------
GSA_KLEP7       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSEEDIDNTIDAARRVFAKL------
GSA_YERPE       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERPP       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERPN       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERPG       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERPA       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERPS       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERPB       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERP3       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERPY       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL------
GSA_YERE8       CDVERFKRFFHLML-EEGVYLAPSAFEAGFMSVAHSKEDIQKTVDAARRCFAKL------
GSA_ERWT9       CDVERFKRFFHLML-AEGVYLAPSAFEAGFMSLAHGQAEIQHTIDAARRSFAKL------
GSA_PECAS       CDVERFKRFFHMML-EEGIYLAPSAFEAGFMSLAHTPQDIERTIEAAQICFSRL------
GSA_PHOLL       CDIERFKHFFHLML-DEGVYLAPSAFEAGFMSIAHTDEDIQRTVNAAARCFAKLK-----
GSA_PROMH       CDVERFKQFFHLML-EKRIYLAPSAFEAGFMSIAHSKEDIQRTIDAAEYAFSKMKA----
GSA_SODGM       CDVDRFKRFFHLML-AAGVYLAPSAFEAGFMSLAHGDAEIRHTVEAAAQSFAQL------
GSA_ACTPJ       CDAAKFNRFFHLML-EQGVYLAPSAFEAGFMSLAHSDEDIQATLAAADKAFAQL------
GSA_ACTP2       CDAAKFNRFFHLML-EQGVYLAPSAFEAGFMSLAHSDEDIQATLAAADKAFAQL------
GSA_ACTP7       CDAAKFNRFFHLML-EQGVYLAPSAFEAGFMSLAHSDEDIQATLVAADKAFAQL------
GSA_HAEPS       CDVKAFNTFFHKML-EKGVYLAPSAFEAGFMSLAHSDEDIAYTLEMADLALAEMK-----
GSA_ACTSZ       CDVAKFNRFFHLML-EQGVYLAPSAFEAGFMSLAHSDADIEQTLKAADNAFAVLA-----
GSA_HAES1       CDVEKFNLFFHKML-EQGVYLAPSAFEAGFMSLAHTDADIDRTLQAADIAFASLCSSSFS
GSA_HISS2       CDIERFNLFFHKML-EQGVYLAPSAFEAGFMSLAHTDADIDRTLQAADIAFASLRSSSFS
GSA_PASMU       CDTEKFNRFFHAML-AQGIYLAPSAFEAGFMSLAHSDQDIERTLQAADQVFSQLA-----
GSA_MANSM       CDTEKFKVFFHKML-DEGVYLAPSAFEAGFMSLAHTDADIDRTLTAADKAFAALA-----
GSA_AERHH       CDMERFKRFYHLML-EEGVYLAPSAYEAGFLSLAHGDKEIEHTLAAAERSFAKLAG----
GSA_AERS4       CDMERFKRFYHLML-EEGVYLAPSAYEAGFLSLAHGDKEIEHTLAAAERSFAKLAG----
GSA_SHEB8       CNIEQFRIFYHGML-DEGVYLAPSAYEAGFLSMAHGEEEMRLTLEAADRVLASMKAAS--
GSA_SHEB2       CNIEQFRIFYHGML-DEGVYLAPSAYEAGFLSMAHGEEEMRLTLEAADRVLASMKAAS--
GSA_SHEB5       CNIEQFRIFYHGML-DEGVYLAPSAYEAGFLSMAHGEEEMRLTLEAADRVLASMKAAS--
GSA_SHEB9       CNIEQFRIFYHGML-DEGVYLAPSAYEAGFLSMAHGEEEMRLTLEAADRVLASMKAAS--
GSA_SHEPC       CNIEHFRTFYHGML-DEGVYLAPSAYEAGFLSMAHGEEELRLTLEAADRVLASMKTES--
GSA_SHESW       CNIEHFRTFYHGML-DEGVYLAPSAYEAGFLSMAHGEEELRLTLEAADRVLASMKTES--
GSA_SHESM       CNIEHFRTFYHGML-DEGVYLAPSAYEAGFLSMAHGEEELRLTLEAADRVLARMKAAM--
GSA_SHESR       CNIEHFRTFYHGML-DEGVYLAPSAYEAGFLSMAHGEEELRLTLEAADRVLARMKAAM--
GSA_SHESA       CNIEHFRTFYHGML-DEGVYLAPSAYEAGFLSMAHGEEELRLTLEAADRVLGRMKAAM--
GSA_SHEON       CNIEHFRTFYHGML-DEGVYLAPSAYEAGFLSMAHGEEELRLTLEAADRVLARMKAAN--
GSA_SHEHH       CDTALFAEFYHLML-DEGVYLAPSAYEAGFLSLAHGEEELEATLAAADRVFAKLAKR---
GSA_SHEPA       CDTALFAEFYHMML-DEGVYLAPSAYEAGFLSLAHGEEELEATLAAADRVFAKLAKA---
GSA_SHESH       CDADKFPEFYHGML-DEGVYLAPSAYEAGFLSMAHGEKELEETLAAADRVFAKMAK----
GSA_SHEWM       CDAEKFPEFYHGML-DEGVYLAPSAYEAGFLSMAHGEKELEETLAAAERVFAKMAK----
GSA_SHEPW       CDAEKFPEFYHGML-DEGVYLAPSAYEAGFLSLAHGEAELEATLAAAERVFAKMAKG---
GSA_SHELP       CDAEAFRTFYHGML-DEGVYLAPSAYEAGFLSMAHGEKELEETLAAADRVFARMAK----
GSA_SHEAM       CNMDHFRAFYHGML-DEGVYLAPSAYEAGFLSMAHGDKEIEETLAAADRVLARMK-----
GSA_SHEDO       CNMEHFRYFYHAML-AQGVYLAPSAYEAGFLSMAHGEDELAMTLKAVDSVFAEMKVAFKL
GSA_SHEFN       CNMEHFRHFYHAML-DEGIYLAPSAYEAGFMSMAHGDAEIEYTLAAVDRIFAAMK-----
GSA_ALIF1       CDIERFKRFFHLML-KKGVYLAPSAFEASFTSLAHGPKEIEATLEAADQCFAIIASEAK-
GSA_ALIFM       CDIERFKRFFHLML-KKGVYLAPSAFEASFTSLAHGPKEIEATLEAADQCFAIIASETK-
GSA_ALISL       CDIERFKRFFNLML-AHGVYLAPSAFEAGFTSLAHGPKEIEATLEAADRCFAKIAAESK-
GSA_VIBCH       CDVERFKRFFHLML-QHGVYLAPSAFEASFTSLAHGSKEIEATLEAADRSFAILAAEAKA
GSA_VIBC3       CDVERFKRFFHLML-QHGVYLAPSAFEASFTSLAHGSKEIEATLEAADRSFAILAAEAKA
GSA_VIBCM       CDVERFKRFFHLML-QHGVYLAPSAFEASFTSLAHGSKEIEATLEAADRSFAILAAEAKA
GSA_VIBVU       CDIERFKRFFHLMI-DHGVYLAPSAFEASFTSLAHGSKEIEATLEAADRCFAILAAESK-
GSA_VIBVY       CDLERFKRFFHLMI-DHGVYLAPSAFEASFTSLAHGSKEIEATLEAADRCFAILAAESK-
GSA_VIBPA       CDIERFKRFFHLML-DHGVYLAPSAFEASFTSLAHGSKEIDATLEAADRCFAIIAAEAK-
GSA_VIBTL       CDVERFKRFFHLML-DHGVYLAPSAFEASFTSLAHGSKELDATLEAADRSLAIIAAESK-
GSA_PHOPR       CDIERFKRFFNLML-KSGVYLAPSAYEACFTSLAHGDKEIEATLNAAERAFATLAKEANA
GSA_COLP3       CDGEMFKRFFHLML-DEGVYLAPSSYETGFLSTSHTDDIIEKTLVAADKCFAQL------
GSA_PSEHT       CDLERFKRFFHLML-EEGVYLAPSAFEAGFVCAAHNEQEIKDTIAAAERAFAKL------
GSA_IDILO       CNMEHFKTFYHAML-EQGVYLAPSAFEGGFMSAAHSEEDIQNTLNAAEKAFAKLV-----
GSA_PSYIN       CDIEKFKKFFHLML-EQGIYLAPSAFEAGFLSLAHSDQDIEDTLTAAKKAFSML------
GSA_PSEA6       CNTEQFNHFYHGML-ENGVYLAPASYEAGFVSAQHSPEIIQQTLQIAEKVLADVAKKFG-
GSA_ACIF2       ADSKRYARFFHGLL-ARGVYLAPSAYEAGFLSAAHGDTEIAATLDAAEAVLATLKEDA--
GSA_ACIF5       ADSKRYARFFHGLL-ARGVYLAPSAYEAGFLSAAHGDTEIAATLDAAEAVLATLKEDA--
GSA_METCA       CDQERFRRFFHGML-EEGVYLAPSAFEAGFVSAAHDYQILDRTLTAAERVFAGL------
GSA_PSEAE       SDVERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDKELEITLNAAEKAFAALK-----
GSA_PSEA8       SDVERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDKELEITLNAAEKAFAALK-----
GSA_PSEAB       SDVERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDKELEITLNAAEKAFAALK-----
GSA_PSEA7       SDVERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDRELEITLNAAEKAFAALK-----
GSA_PSEE4       SDAERFKRFFHLML-EGGVYLAPSAFEAGFTSIAHGDKELQITLDAAERAFAKLK-----
GSA_PSEPW       SDAERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDKELQITLDAAERAFAALK-----
GSA_PSEP1       SDAERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDKELQITLDAAEKAFAALK-----
GSA_PSEPK       SDAERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDKELQITLDAAEKAFAALK-----
GSA_PSEPG       SDAERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDKELQITLDAAEKAFAALK-----
GSA_PSEF5       SDANLFKRFFHLML-EGGVYLAPSAFEAGFTSIAHGEAELQLTLDAAERAFAALK-----
GSA_PSEPF       SDAALFGRFFHLML-EGGVYLAPSAFEAGFTSIAHGEAELKLTLDAAERAFAKLK-----
GSA_PSEMY       SDSARFNRFFHLML-EGGVYLAPSAFEAGFTSIAHGDKELEITFAAAERAFAELKKA---
GSA_PSE14       SDAERFKRFFHLML-EGGVYLAPSAFEAGFTSIAHGDAELKLTLDAAEKAFAALK-----
GSA_PSEU2       SDSERFKRFFHLML-DGGVYLAPSAFEAGFTSIAHGDAELKLTLDAAEKAFAALK-----
GSA_PSESM       SDAERFKRFFHLML-EGGVYLAPSAFEAGFTSIAHGDAELKLTLDAAEKAFAALK-----
GSA_PSEU5       SDADRFKRFFHLML-EGGVYLAPSAFEAGFTSIAHGDKELAITLDAAERAFAKLK-----
GSA_ACIB5       CDIEAFKKFFHGML-KRGVNLAPSAFEAGFISSAHSDEDIEFTIQAAKETFAEMK-----
GSA_ACIB3       CDIEAFKKFFHGML-KRGVNLAPSAFEAGFISSAHSDEDIEFTIQAAKETFAEMK-----
GSA_ACIBT       CDIEAFKKFFHGML-KRGVNLAPSAFEAGFISSAHSDEDIEFTIQAAKETFAEMK-----
GSA_ACIBY       CDIEAFKKFFHGML-KRGVNLAPSAFEAGFISSAHSDEDIEFTIQAAKETFAEMK-----
GSA_ACIBC       CDIEAFKKFFHGML-KRGVNLAPSAFEAGFISSAHSDEDIEFTIQAAKETFAEMK-----
GSA_ACIBS       CDIEAFKKFFHGML-KRGVNLAPSAFEAGFISSAHSDEDIEFTIQAAKETFAEMK-----
GSA_ACIAD       CDTDAFKKFFHGML-ERGVNLAPSAFEAGFISSAHSDEDIELTIQAAKETFAEMK-----
GSA_PSYA2       CDMEVFNTFFHGML-DRGIYLAPSAYEAGFMSIKHSDEDIDTSIKAADEIFAEMAKA---
GSA_PSYCK       CDMELFNTFFHGML-DRGIYLAPSAYEAGFMSIKHSNEDIEATIKAADEIFAEMAKA---
GSA_RUTMC       CNIELFKKFFHLML-AEGVYMAPSAYEAGFVSSAHSDTDIQNTIDAAGRAFIKLT-----
GSA_VESOH       CNVELFKRFYHLML-EEGVYMTPSIYETDFISSAHSDMDIQNTIDAAGRVFAKLV-----
GSA_HAHCH       CDLERFRKFYHGML-DKGVYLAPSAYEAGFVSAAHSDEDIQATLDAASSLFASM------
GSA_MARHV       CDVERFKAFFQGML-KEGVYLAPSAFEAGFTTAALSDEDIEFTLAAARKVMKTL------
GSA_MARMS       CDLSKFKAFFHYML-EEGVYFAPAAFEAGFISQAHTEEDIDYTIEAAKRSFAKLV-----
GSA_HYDCU       GNMEQFKAFYHGML-DEGIYLAPSAFEAGFVSSAHTDQDIDDTIAAAKKVMATL------
GSA_ALKEH       CDLEAFKVFFHAML-EEGVYMAPSAFEAGFLSTAHDTPAIEYTLAAAERAFARVARR---
GSA_HALHL       CDLDAFNRFFHAML-DEGVYLAPAAFEAGFVSLAHDDNAVQETLDAAERAFARV------
GSA_STRMK       CDIPAFNRFFHAML-EQGVFLAPSAYEAGFLSSAHDDAVIEATLAAARVAFRAAKG----
GSA_STRM5       CDIPAFNRFFHAML-DQGVFLAPSAYEAGFLSSAHDDAVIEATLAAARVAFKAAKG----
GSA_XANCH       CDITSFNRFFHAML-QRGVYLAPSAYEAGFMSSAHDEAVIEATLAAAREAFADVAR----
GSA_XANC5       CDITSFNRFFHAML-QRGVYLAPSAYEAGFMSSAHDQAVIEATLAAAREAFADVAR----
GSA_XANAC       CDITTFNRFFHAML-QQGVYLAPSAYEAGFMSSAHDEAVIDATLAAAREAFAEVAR----
GSA_XANOR       CDITSFNRFFHAML-QRGVYLAPSAYEAGFMSSAHDATVIEATLAAARDAFADVAR----
GSA_XANOM       CDITSFNRFFHAML-QRGVYLAPSAYEAGFMSSAHDATVIEATLAAARDAFADVAR----
GSA_XANCP       CDVTTFNRFFHAML-QQGVYLAPSAYEAGFVSSAHDEAVIEATLAAAREAFADVMR----
GSA_XANC8       CDVTTFNRFFHAML-QQGVYLAPSAYEAGFVSSAHDEAVIEATLAAAREAFADVMR----
GSA_XANCB       CDVTTFNRFFHAML-QQGVYLAPSAYEAGFVSSAHDEAVIEATLAAAREAFADVMR----
GSA_XYLF2       CNTDRFNRFFHAML-QRGVFFAPSAYEAGFISSAHSPNIIETTLEAARTAFQTIANEAAI
GSA_XYLFT       CNTDRFNRFFHAML-QRGVFFAPSAYEAGFISSAHSPNIIETTLEAARTAFQTIANEAAI
GSA_XYLFM       CNTDRFNRFFHAML-QRGVFFAPSAYEAGFISSAHSPNIIEATLEAARTAFQTIANEAAI
GSA_XYLFA       CNTDRFNRFFHAML-QRGVFFAPSAYEAGFISSAHSPDIIEATLEAARAAFQTIANEAAI
GSA_CHRSD       CNADTFRRFFLGML-EHGVYLAPSPFEAGFMSSAHTPDDIQATLDAAEQVLATLENA---
GSA_NITOC       CHLDRFKSFYHGML-EHGIYFAPSAFEAGFVSSAHNDEHIAATLQAAERVLAKLSS----
GSA_THISH       CDLDRFRLFFHEML-ERGVYLAPSAYEAGFVSSAHSEADLAETIEAAARSLREVSGN---
GSA_ACISJ       TDGMRFNTLFHGLL-DGGVYIAPALYEAGFVSAAHTEQDIADTVAVARDVFQKL------
GSA_ACIET       TDGMRFNTLFHGLL-DGGVYIAPALYEAGFVSAAHTEQDIADTVAVARDVFQKL------
GSA_ACIAC       TDGARFNALFHGLL-DRGVYIAPALYEAGFVSSAHSAQDIDETIAAAREVFRLVSAG---
GSA_VEREI       TDSARFNQLFHGLL-ERGIYIAPALYEAGFVSAAHSDEDIAATVAAAREVFKTLAKP---
GSA_RHOFT       SDSARFNQLFHGLL-DRGVYIAPALYEAGFVSAAHTAEDIAATVAAARAVFKIISK----
GSA_LEPCP       TDQARFNSFFHGLL-DRGVYLAPALYEAGFVSAAHSDADIDATVAAARAALQP-------
GSA_AZOSB       SDREAFNRFFHAML-DAGHYFAPSAFEAGFVSAAHGEADIQATVAAARACLR--------
GSA_AROAE       SDRDAFNRFFHAML-DAGHYFAPSAFEAGFVSAAHTAADIDETIAAAREVFARLG-----
GSA_BORBR       CDTEAFKRFFHAML-ERGIHFAPSAFEAGFVSATHDDAVIDATLEAAEQVFATLRA----
GSA_BORPA       CDTEAFKRFFHAML-ERGIHFAPSAFEAGFVSATHDDAVIDATLEAAEQVFATLRA----
GSA_BORPE       CDTEAFKRFFHAML-ERGIHFAPSAFEAGFVSATHDDAVIDATLEAAEQVFATLRA----
GSA_BORPD       GDADAFKRFFHAML-DRGVHFAPSAFEAGFVSATHDNAVIDATLDAAEAVFAAMKG----
GSA_BORA1       SNTEAFKRFFHAML-DRGVHFAPSAFEAGFVSAAHDDATLQATLDHAEAAFALLKA----
GSA_BURCM       SDTERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURA4       SDTERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURL3       SDTERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURCA       SNVERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURCH       SNVERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURCC       SDVERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURCJ       SDIARFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURVG       SDVERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURM1       SDIERFNRFFHLML-DEGVYFAPSAYEAGFVSSTHDDAVIDATLAAARRAFAALAA----
GSA_BURMA       SDIERFNRFFHLML-DAGVYFAPSAYEAGFVSSAHDDATLDATLDAARRAFAALRA----
GSA_BURP1       SDIERFNRFFHLML-DAGVYFAPSAYEAGFVSSAHDDATLDATLDAARRAFAALRA----
GSA_BURPS       SDIERFNRFFHLML-DAGVYFAPSAYEAGFVSSAHDDATLDATLDAARRAFAALRA----
GSA_BURM9       SDIERFNRFFHLML-DAGVYFAPSAYEAGFVSSAHDDATLDATLDAARRAFAALRA----
GSA_BURP0       SDIERFNRFFHLML-DTGVYFAPSAYEAGFVSSAHDDATLDATLDAARRAFAALRA----
GSA_BURTA       SDIERFNRFFHLML-DAGVYFAPSAYEAGFVSSAHDDATLDATLDAARRAFAALRA----
GSA_PARPJ       SDVPRFNAFFHKML-DAGVYFAPSAYEAGFVSIVHDDAIVDATIDAARGAFASLAA----
GSA_PARXL       SDVPRFNAFFHKML-DAGVYFAPSAYEAGFVSIVHDDAIIDATIDAARGAFASLAA----
GSA_PARP8       CDVPRFNAFFHKML-DAGVYFAPSAYEAGFVSSAHDDATVEATIEAARGAFKSLA-----
GSA_CUPTR       SDTSRFNRFFHAML-DHGVYLAPSAFEAGFVSAQHDDAILDATFDAARKAFAAA------
GSA_CUPNH       SDTARFNRFFHAML-DHGVYLAPSAFEAGFVSAQHDDAILAATLEAARKAFAAG------
GSA_CUPPJ       SDTARFNRFFHAML-DNGVYLAPSAFEAGFVSACHDDAILQATLDAARKAFAA-------
GSA_CUPMC       ADVGRFNRFFHAML-AEGVYLAPSAFEAGFVSAKHDDAIIEATVAAAAKAFKAG------
GSA_RALPJ       SDVGRFNAFFHAML-DQGVYLAPSAFEAGFVSSTHDDAILDATFEAARKAFKAV------
GSA_RALSO       SDVGRFNAFFHAML-AEGVYLAPSAFEAGFVSSMHDDAVLEATFEAARRAFKAV------
GSA_HERAR       CDVAHFNTFFHAML-DAGVYLAPSAFEAGFVSAQHDDAIIEASIQAARQAFAQLGQ----
GSA_JANMA       CDKTRFNAFFHAML-DAGVYLAPSAFEAGFVSAQHDDAVIDSSIKAARAAFAQLADDCDD
GSA_CHRVO       CDIERFKRFFHAML-DEGVYFAPSAYEAGFVSAAHSEQMIESTLAAAGRAFARL------
GSA_LARHH       SDRERFNAFFHAML-EAGVYLAPSAYEAGFVSAAHTDADIDATVDAARQAFARI------
GSA_NEIG1       SNIDAFKRFFHGML-DRGIAFGPSAYEAGFVSAAHTPELIDETVAVAVEVFKAMAA----
GSA_NEIG2       SNIDAFKRFFHGML-DRGIAFGPSAYEAGFVSAAHTPELIDETVAVAVEVFKAMAA----
GSA_NEIM0       SNIDAFKRFFHGML-DRGIAFGPSAYEAGFVSAAHTPELIDETVAVAVEVFKAMAA----
GSA_NEIMF       SNIDAFKRFFHGML-DRGIAFGPSAYEAGFVSAAHTPELIDETVAVAVEVFKAMAA----
GSA_NEIMA       SNIEGFKQFFHGML-DRGIAFGPSAYEAGFVSAAHTPELIDETVAVAVEVFKAMAA----
GSA_NEIMB       SNIEGFKQFFHGML-DRNVAFGPSAYEAGFVSAAHTPELIDETVAVAVEVFKAMAE----
GSA_NITEU       SDREAFNHFFHAML-KEGVYFAPSAFEAGFVSAAHSNEEIDKTLAVADRIFGQGMRRTEK
GSA_NITEC       SDRDAFNRFFHTML-KEGIYFAPSAFEAGFVSAAHGDVEIDKTLEAADRVFSQKA-----
GSA_NITMU       CDREAFNGFFHAML-EEGIYFAPSAFEAGFVSAAHGDAEISKTLATAEKIFARE------
GSA_DECAR       CDKEAFNRFFHAML-DAGHYFAPSAFEAGFVSAAHSDADIAGTIAAADAYFASLK-----
GSA_METFK       SDKQAFNRFFHGML-EAGVYLAPSAFEAGFVSIAHSEADISQTIVSAQGVFSRINDQ---
GSA_THIDA       CDKEKFNRFFHAML-DHGVYLAPSAFEAGFVSAAHSDADIDATVAAAREVFRTL------
GSA_SACD2       CDIPRFNKFFHGLL-EEGVYIAPASYEAGFLSAAHTDADIDFTLQAAKNVFARI------
GSA_COXBU       GNVEHFRSFFHKML-DNGVYLAPSAFESGFISAAHTNKEVDNTLDIIENIFSVSETYLRI
GSA_COXBR       GNVEHFRSFFHKML-DNGVYLAPSAFESGFISAAHTNKEVDNTLDIIENIFSVSETYLRI
GSA_COXB2       GNVEHFRSFFHKML-DNGVYLAPSAFESGFISAAHTNKEVDKTLDIIENIFSVSETYLRI
GSA_COXB1       GNVEHFRSFFHKML-DNGVYLAPSAFESGFISAAHTNKEVDKTLDIIENIFSVSETYLRI
GSA_COXBN       GNVEHFRSFFHKML-DNGVYLAPSAFESGFISAAHTNKEVDKTLDIIENIFSVSETYLRI
GSA_FRATF       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTICLAKKFFQEN------
GSA_FRATO       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTICLAKKFFQEN------
GSA_FRATH       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTICLAKKFFQEN------
GSA_FRATM       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTICLAKKFFQEN------
GSA_FRATW       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTICLAKKFFQEN------
GSA_FRATT       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTIYLAKKFFQEN------
GSA_FRAT1       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTIYLAKKFFQEN------
GSA_FRATN       TNLKMFNQFFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTICLAKNFFSRELD----
GSA_FRAP2       TNLKMFNKYFAYML-DNGVYLAPSAYEAGFISIAHSDEDIEKTICLTKKFFQDNQS----
GSA_LEGPC       SDEVLFKKFFHAML-AQGVYFAPSMYEAGFVSSMHGDLEIQKTYDAAELVLNQLKSA---
GSA_LEGPH       SDEVLFKKFFHAML-AQGVYFAPSMYEAGFVSSMHGDLEIQKTYDAAELVLNQLKSA---
GSA_LEGPL       SDEVLFKKFFHAML-AQGVYFAPSMYEAGFVSSMHGDLEIQKTYDAAELVLNQLKSA---
GSA_LEGPA       SDEVLFKKFFHAML-AQGVYFAPSMYEAGFVSSMHGDLEIQKTYDAAELVLNQLSA----
GSA_CAMC1       DT-KLFAKFHQAML-KRGIYLAPSQFETGFICDAMSEADIDLAVNAAKEAFLEIKA----
GSA_CAMC5       DT-RLFAKFHAAML-KRGVYLAPSQFETGFVCEPMSEADIDFAVNAAREAFKEIKRNG--
GSA_CAMFF       DT-KMFAKFHAQMI-KRGIYLAPSQFETGFVCDKLSQK----SLEKTANAIEESFKAL--
GSA_CAMHC       DT-KMFAKFHSGMI-KEGIFLAPSQFETGFICDAMSEKEINFALKKANKVFDEISKDSAK
GSA_CAMJE       DL-ALFSKFHKNML-ENGIYLAPSQFETGFICSKMDDKIIDTTLEAVRESFKRI------
GSA_CAMJ8       DL-ALFSKFHKNML-ENGIYLAPSQFETGFICSKMDDKIIDTTLEAVRESFKRI------
GSA_CAMJJ       DL-ALFSKFHKNML-ENGIYLAPSQFETGFICSKMDDKIIDTTLEAVRESFKRI------
GSA_CAMJR       DL-ALFSKFHKNML-ENGIYLAPSQFETGFICSKMDDKIIDTTLEAVRESFKRI------
GSA_CAMJD       NL-ALFSKFHKNML-ENGIYLAPSQFETGFICSKMDDKVIDITLEAVRESFKRI------
GSA_HELPH       DT-EMFAKFHQKML-FKGVYLACSSFETGFICEPMTEEMIDLVVAKADESFDEIIKGV--
GSA_HELP2       DT-EMFAKFHQKML-FKGVYLACSSFETGFICEPMTEEMIDLVVAKADESFDEIIKGV--
GSA_HELPG       DT-EMFAKFHQKML-FKGVYLACSSFETGFICEPMTEEMIDLAVAKADESFDEIIKGV--
GSA_HELPS       DT-EMFAKFHQKML-FKGVYLACSSFETGFICEPMTEEMIDLAVAKADESFDEIIKGV--
GSA_HELPJ       DT-EMFAKFHQKML-FKGVYLACSSFETGFICEPMTEEMIDLAISKADESFDEIINGV--
GSA_HELPY       DT-EMFAKFHQKML-FKGVYLACSSFETGFICEPMTEEMIDLTIAKADESFDEIIKGV--
GSA_HELAH       NT-EMFAKFHQKML-FKGVYLACSSFETGFICEPMTEEMIDLVIVKANESFDEIIKGV--
GSA_HELHP       DT-AMFARFHQKML-DKGVYFACSQFETGFICSAMNEMIIDEVIMKAKAVFGEITHEIES
GSA_WOLSU       DT-ALFAKFHQAML-ERGVYLACSQFETGFICASMDESLVDEVIAKIDEALEEIGRG---
GSA_SULDN       DE-KLFALFHSKML-KEGFYFACSLYETGFISTAITDEMIEDTIKASAKVFKEITNV---
GSA_SULNB       DQ-KLFAKFHKGML-DRGIYLACSSFETGFISTAITDEMIDETVKAAYETLKEIKG----
GSA_STRSV       DH-AQFARLHGLLL-EEGIYLAPSQYETNFMSSAHTRADLDQTLAAFEQAFQEMKEEANG
GSA_CHLP8       DT-AKYGKYFHSML-DQGIYLAPSQFEAMFTSFVHTDEDLEKTVKANYNALVAATK----
GSA_CHLTE       DT-AKYGKYFHSML-DQGIYLAPSQFEAMFTSFAHTDEDLEKTVKANYNALVAATK----
GSA_CHLL2       DV-AKYGKYFHSML-DQGIYLAPSQFEAMFTSYVHSDEDLEKTVKANYNALVAAHQ----
GSA_CHLCH       DT-KKHAKYFHSLL-DQGIYTAPSQFEAMFISSVMTDEDLDKTIKANYNALVASQQ----
GSA_PELPB       DT-KRHGKYFHSML-DQGIYLAPSQFEAMFISFMHTDEDLEKTIKANYNALVASGQ----
GSA_CHLPD       DI-RKYGKYFHSML-EQGIYLAPSQFEAMFTSSMHTDEDLDKTIKANFNALQIACS----
GSA_CHLPB       DL-KKYGKYYHSML-DQGIYLAPSQFEAMFTSAVMTDEDLEKTVKANYVALQAAEA----
GSA_PROA2       DL-KKYGTYYHAML-DQGIYLAPSQFEAMFTSAVMTDEDLEKTVKANYVALQATQK----
GSA_PELLD       DT-EKFGKYFSSML-EQGIYLAPSQFEAMFTSTMHTDADLEKTVKANYVALQAATK----
GSA_CHLPM       DT-EMFGRYFTSML-DQGIYLAPSQFEAMFTSAVHSNADLEKTVKANYIALQAAAK----
GSA_CHLT3       DT-AKFATYFNSML-ESGIYLACSQFEAMFISTMHTEEDLQKTIEANYNALKLAYGK---
GSA_CYTH3       DL-SKFAAYFQAML-SRGIYLAPSQFESLFISSAITKQLADQIIQAHAESMKEIHN----
GSA_SALRD       DT-EAYAAYFHAML-EEGIYLPPSQFEAVFYGTCHGEDELETTLETQRRALKRVHS----
GSA_HUNT2       DT-GLFGRYFNHLL-NNGIYIAPSQFEAMFVSNAHTDKDIDETLEKVSLFFARKSPPA--
GSA_FLAJ1       DN-ETFKKFFHGLL-QEGVYIAPSAYETWFITDALTYEDLDFTINAIDKVSKTF------
GSA_FLAPJ       DN-DTFKKFFHGLL-AEGVYIAPSAYETWFISDALTYEDLDFTIRAVDKVSKNL------
GSA_GRAFK       ANLGVFNKFFHGML-ENGIYIAPSAYETWFISDALSYEDLDTTIAAVDKVAKTL------
GSA_WIGBR       CNYKKFILFFNEIK-KLGILFSPSLFESNFITLMHKKKDLEKTIDSANKVFKILKNKV--
GSA_CHLTR       SDIEAFQKFYQSAF-SKGVYLSPSPFEASFLSAAHSMESLDYAQTALIESLEQVFSLV--
GSA_CHLTA       SDIEAFQKFYQSAF-SKGVYLSPSPFEASFLSAAHSMESLDYAQTALIESLEQVFSLV--
GSA_CHLT2       SDIEAFQKFYQSAF-SKGVYLSPSPFEASFLSAAHSMESLDYAQTALIESLEQVFSLV--
GSA_CHLTB       SDIEAFQKFYQSAF-SKGVYLSPSPFEASFLSAAHSMESLDYAQTALIESLEQVFSLV--
GSA_CHLMU       CNTDIFRTFYQQAF-LKGIYLSPSPFEASFLSTAHSMENLNYAQQVLIESLEQACSLV--
GSA_CHLFF       CDQERFGLFYRQAF-SLGVYLSPASTEASFISSVHSRENLAYTQNVLIDSLVKSFDNV--
GSA_CHLCV       CDQKTFGIFYRHAF-SRGVYLSPASMEASFISSVHSRENLAYTQNVLIDSLVKTFEGI--
GSA_CHLAB       CDHQMFGVFYRHVF-AQGVYLSPAPMEASFLSSVHSKENLAYTQNVLIDSLMKTFGSL--
GSA_CHLPN       SDVEKFQTFYSEVF-DNGVYLSPSPLEANFISSAHTEENLTYAQNIIIDSLIKIFDSSAQ
GSA_PARUW       ANTTIFANFFRKLF-DQGIYIPPSQHEAWFISQAHEESNLIKTQSAILTFLEENF-----
GSA_LEPIN       GHKESFAKVFHTFL-KNGIYLAPSGYEVGFLSWAHDDEIIAKTLEIADKALKTF------
GSA_LEPIC       GHKESFAKVFHTFL-KNGIYLAPSGYEVGFLSWAHDDEIIAKTLEIADKALKTF------
GSA_LEPBL       GHKEGFAEVFHVLL-KNGIYLAPSGYEVGFLSWAHNDSVIAKVLEIADKAFKEL------
GSA_LEPBP       THKSNFATLFHKLL-KQGVYLAPSGYEVGFLSTAHTNDIINLTLEKTKKALKD-------
GSA_BDEBA       NQGGNFKNLFLKAL-DKGVYLAPNAYEVGFVSLAHSDELLEQAAQIIVDAAE--------
GSA_FUSNN       SNTENFSIYFNTML-ENGIVIPPSQFEAHFLSMAHTKKELNRTLEVIEMAFKKIGEKSGK
GSA_METI4       VDKKRFSCFFTSLL-HSGIFLPPSPFETAFLSTAHSETDIDELVKFVYDILKKMP-----
GSA_AERPE       ADKKFYVKLHEEML-RRGVFIAPSNLEAVFTGLPHQGEALEIAVEGLRSSLKTVLGS---
GSA_HYPBU       SDKKLYLKLHEELL-KLGVFIAPSQMEAIFTSAAHTSDVVSETIEKLRKAFKRLR-----
GSA_SULAC       ANKEMYQKFHNLLL-QRGVFIPPSQFETIFTSYAHKDVVVNTTLEILRKVVQEL------
GSA_SULTO       ANKDLYVKIHEKLL-KLGVFIPPSQFETIFTSSSHSDEIVNLTIEAIHKVVSEI------
GSA_SACS2       ADKEYYIKFHERLL-KEGVFIPPSQYETIFTSAAHKDDVIADTIDKLMKVIGELN-----
GSA_PYRAE       SNEKMYLKLHEIAL-KHGVYLTPSQYEVNFTSAAHGREVVEETLAALEKSFQELQREIG-
GSA_PYRCJ       SNEKLYLKLHELAI-GHGVYLAPSQFEVNFTSAAHTAEVVEEALGALEKVFRELRREVGG
GSA_THEAC       ADRDLYFRIFKRLM-NHGVYVPPSQFETNFVSFAHSDDDISKTIEAFDLSVGEAAK----
GSA_THEVO       ARKEVYFKLFKALS-KNGVYLPPSQYETNFVSFAHSDSDIDATLAAFEKAVAEMD-----
GSA_PICTO       SDKDRFFKFFKKML-DHNVYLPPSQFETNFVSFAHGRDDLNKTIEAAKEAVSCI------
GSA_ARCFU       LNKERFMEFFWRML-ENGVFLPPSQYETCFVSFAHTEEDVEKTVEAVSESL---------
GSA_METAR       CDKLKFNEFWKHML-QNGVFFPPSQFETNFLSLAHSQADMEQIVTACKKSLAAVK-----
GSA_METAC       CDKEGYLSFFHRML-ANGVFLPPSQFETNFISAAHSEEDIEKTLEAYVENL---------
GSA_METMA       CDKEGYLAFFHRML-ASGVFLPPSQFETNFISAVHSDEDIEKTLEAYSENL---------
GSA_METBF       CDKEGYLAFFHRML-ASGIFLPPSQFETNFVSAAHSEEDIEKTLKAYTENL---------
GSA_METJA       SDTEKFMKYFWRLL-EKGVFVPPSQFECCFTSIKHDDEVVDKTIKAMEDVFEGLE-----
GSA_METMP       SDTEKFMKYFYTLL-ENGVFVAPSQFECCFTSIKHNDEVLEKTMNAIDIAMKKL------
GSA_METST       SDTENFLKYFHLLL-ENGVFIAPSQYECGFISTSHSRDDLDKTLNAIEIALTKLYK----
GSA_METTH       SDTVLFMEYFHGLL-ERGVFIPPSQFECCFISAAHESEHIEATLEAAEEVLSGLKN----
GSA_METKA       ADHDAFKRFHRELL-EHGVWIAASNYEAWFLSIAHTETDLERTEEAFEEALDRLTG----
GSA_HALMA       AETERWERLFWPAMKDQGVFLTANQFESQFICDAHTGEDIENALEAYKEAI---------
GSA_HALLT       AATDRWERVFWQEMKEQGVFLTANQFECQFTSYAHTEEDVEETLAAYREAI---------
GSA_HALSA       AAVQRWNRVFRPQLLDAGVLLSQNQFESQFVSYGHTEADVDETIEAYRSAL---------
GSA_HALS3       AAVQRWNRVFRPQLLDAGVLLSQNQFESQFVSYGHTEADVDETIEAYRSAL---------
GSA_NATPD       AETDRYARLFRPKMIEEGVLVSQNQFESNFVSYRHTAEDVEETLEAYKEAL---------
                                          *  :                              

GSA1_BACAN      ---------------------
GSA1_BACHK      ---------------------
GSA1_BACCR      ---------------------
GSA1_BACCZ      ---------------------
GSA1_BACC1      ---------------------
GSA1_BACLD      ---------------------
GSAB_BACSU      ---------------------
GSA1_GEOKA      ---------------------
GSA1_OCEIH      ---------------------
GSA2_LISMO      ---------------------
GSA2_LISMF      ---------------------
GSA2_LISIN      ---------------------
GSA1_BACSK      ---------------------
GSA1_BACHD      LKR------------------
GSA2_STAAC      ---------------------
GSA2_STAA3      ---------------------
GSA2_STAAR      ---------------------
GSA2_STAAB      ---------------------
GSA2_STAAS      ---------------------
GSA2_STAAW      ---------------------
GSA2_STAAM      ---------------------
GSA2_STAAN      ---------------------
GSA2_STAES      ---------------------
GSA2_STAEQ      ---------------------
GSA1_STAS1      ---------------------
GSA_SYMTH       ---------------------
GSA_ACAM1       ---------------------
GSA_CYAP4       ---------------------
GSA_NOSS1       ---------------------
GSA_TRIV2       ---------------------
GSA_NOSP7       ---------------------
GSA_TRIEI       ---------------------
GSA_SYNE7       ---------------------
GSA_SYNP6       ---------------------
GSA_SYNP2       ---------------------
GSA_RIPO1       ---------------------
GSA_MICAN       ---------------------
GSA_GLOC7       ---------------------
GSA_SYNY3       ---------------------
GSA_SYNJB       ---------------------
GSA_SYNJA       ---------------------
GSA_THEEB       ---------------------
GSA_PROMA       ---------------------
GSA_PROM4       ---------------------
GSA_PROM1       ---------------------
GSA_PROMT       ---------------------
GSA_PROM3       ---------------------
GSA_PROMM       ---------------------
GSA_SYNS9       ---------------------
GSA_SYNPX       ---------------------
GSA_SYNSC       ---------------------
GSA_SYNPW       ---------------------
GSA_PROMS       ---------------------
GSA_PROM0       ---------------------
GSA_PROM2       ---------------------
GSA_PROM9       ---------------------
GSA_PROMP       ---------------------
GSA_GLOVI       ---------------------
GSA_CHLSY       ---------------------
GSA_CHLAA       ---------------------
GSA_CHLAD       ---------------------
GSA_ROSCS       G--------------------
GSA_ROSS1       ---------------------
GSA_HERA2       ---------------------
GSA_FRACC       VTVSASPEGRA----------
GSA_FRASN       VAVGGGAV-------------
GSA_THEFY       ---------------------
GSA_STRAW       ---------------------
GSA_STRCO       ---------------------
GSA_STRGG       ---------------------
GSA_MYCA1       NS-------------------
GSA_MYCPA       NS-------------------
GSA_MYCMM       SRP------------------
GSA_MYCUA       SRP------------------
GSA_MYCBO       ---------------------
GSA_MYCTA       ---------------------
GSA_MYCBT       ---------------------
GSA_MYCBP       ---------------------
GSA_MYCTU       ---------------------
GSA_MYCLE       ES-------------------
GSA_MYCLB       ES-------------------
GSA_RHOOB       ---------------------
GSA_RHOJR       ---------------------
GSA_NOCFA       GSRA-----------------
GSA_ACIC1       G--------------------
GSA_CORGL       ---------------------
GSA_CORGB       ---------------------
GSA_COREF       ---------------------
GSA_CORDI       ---------------------
GSA_CORA7       Q--------------------
GSA_CORJK       A--------------------
GSA_CLAM3       A--------------------
GSA_CLAMS       A--------------------
GSA_LEIXX       RPLLFVRR-------------
GSA_KOCRD       QP-------------------
GSA_CUTAK       ---------------------
GSA_PROFF       LEDVRR---------------
GSA_TROW8       PKGFEPPTF------------
GSA_TROWT       PKGFEPPTF------------
GSA_ANAD2       ---------------------
GSA_ANASK       ---------------------
GSA_ANADE       ---------------------
GSA_ANADF       ---------------------
GSA_MYXXD       ---------------------
GSA_CARHZ       ---------------------
GSA_PELTS       ---------------------
GSA_MOOTA       ---------------------
GSA_THERP       ---------------------
GSA_THET2       ---------------------
GSA_THET8       ---------------------
GSA_DEIRA       ---------------------
GSA_RHOBA       ---------------------
GSA_SORC5       ---------------------
GSA_CALBD       ---------------------
GSA_CALS8       ---------------------
GSA_CLOAB       ---------------------
GSA_CLOTE       ---------------------
GSA_CLOBA       ---------------------
GSA_CLOBB       ---------------------
GSA_CLOB8       ---------------------
GSA_CLOP1       ---------------------
GSA_CLOPS       ---------------------
GSA_CLOPE       ---------------------
GSA_CLOK5       ---------------------
GSA_AQUAE       ---------------------
GSA_HYDS0       ---------------------
GSA_PERMH       ---------------------
GSA_SULSY       ---------------------
GSA_DESVH       ---------------------
GSA_DESVV       ---------------------
GSA_DESVM       ---------------------
GSA_DESAG       ---------------------
GSA_LAWIP       ---------------------
GSA_SYNWW       ---------------------
GSA2_BACAN      ---------------------
GSA2_BACHK      ---------------------
GSA2_BACCZ      ---------------------
GSA2_BACCR      ---------------------
GSA2_BACC1      ---------------------
GSA2_BACLD      ---------------------
GSA_BACSU       ---------------------
GSA2_GEOKA      ---------------------
GSA2_BACSK      ---------------------
GSA2_BACHD      ---------------------
GSA1_STAAU      ---------------------
GSA1_STAAC      ---------------------
GSA1_STAA8      ---------------------
GSA1_STAA3      ---------------------
GSA1_STAAM      ---------------------
GSA1_STAAN      ---------------------
GSA1_STAAR      ---------------------
GSA1_STAAS      ---------------------
GSA1_STAAW      ---------------------
GSA1_STAAB      ---------------------
GSA1_STAES      ---------------------
GSA1_STAEQ      ---------------------
GSA2_STAS1      ---------------------
GSA2_STAHJ      ---------------------
GSA2_OCEIH      ---------------------
GSA1_LISMO      ---------------------
GSA1_LISMF      ---------------------
GSA1_LISIN      ---------------------
GSA_NATTJ       ---------------------
GSA_THEYD       ---------------------
GSA_DESPS       ---------------------
GSA_SYNAS       ---------------------
GSA_DESOH       ---------------------
GSA_SYNFM       ---------------------
GSA_GEODF       ---------------------
GSA_GEOUR       ---------------------
GSA_GEOBB       ---------------------
GSA_PELPD       ---------------------
GSA_GEOLS       ---------------------
GSA_GEOMG       ---------------------
GSA_GEOSL       ---------------------
GSA_PELCD       ---------------------
GSA_ECOL6       ---------------------
GSA_ECOL5       ---------------------
GSA_ECO45       ---------------------
GSA_ECOK1       ---------------------
GSA_ECO27       ---------------------
GSA_ECOUT       ---------------------
GSA_ECO81       ---------------------
GSA_ECO24       ---------------------
GSA_ECO8A       ---------------------
GSA_ECO55       ---------------------
GSA_ECOLC       ---------------------
GSA_ECOSE       ---------------------
GSA_ECOHS       ---------------------
GSA_ECOLU       ---------------------
GSA_ECO57       ---------------------
GSA_ECO5E       ---------------------
GSA_SHISS       ---------------------
GSA_ECO7I       ---------------------
GSA_ECODH       ---------------------
GSA_ECOLI       ---------------------
GSA_ECOSM       ---------------------
GSA_SHIB3       ---------------------
GSA_SHIBS       ---------------------
GSA_SHIDS       ---------------------
GSA_SHIFL       ---------------------
GSA_SHIF8       ---------------------
GSA_ESCF3       ---------------------
GSA_SALDC       ---------------------
GSA_SALSV       ---------------------
GSA_SALA4       ---------------------
GSA_SALTI       ---------------------
GSA_SALG2       ---------------------
GSA_SALNS       ---------------------
GSA_SALEP       ---------------------
GSA_SALPB       ---------------------
GSA_SALCH       ---------------------
GSA_SALPC       ---------------------
GSA_SALPA       ---------------------
GSA_SALPK       ---------------------
GSA_SALHS       ---------------------
GSA_SALTY       ---------------------
GSA_SALAR       ---------------------
GSA_CROS8       ---------------------
GSA_ENT38       ---------------------
GSA_KLEP3       ---------------------
GSA_KLEP7       ---------------------
GSA_YERPE       ---------------------
GSA_YERPP       ---------------------
GSA_YERPN       ---------------------
GSA_YERPG       ---------------------
GSA_YERPA       ---------------------
GSA_YERPS       ---------------------
GSA_YERPB       ---------------------
GSA_YERP3       ---------------------
GSA_YERPY       ---------------------
GSA_YERE8       ---------------------
GSA_ERWT9       ---------------------
GSA_PECAS       ---------------------
GSA_PHOLL       ---------------------
GSA_PROMH       ---------------------
GSA_SODGM       ---------------------
GSA_ACTPJ       ---------------------
GSA_ACTP2       ---------------------
GSA_ACTP7       ---------------------
GSA_HAEPS       ---------------------
GSA_ACTSZ       ---------------------
GSA_HAES1       ---------------------
GSA_HISS2       ---------------------
GSA_PASMU       ---------------------
GSA_MANSM       ---------------------
GSA_AERHH       ---------------------
GSA_AERS4       ---------------------
GSA_SHEB8       ---------------------
GSA_SHEB2       ---------------------
GSA_SHEB5       ---------------------
GSA_SHEB9       ---------------------
GSA_SHEPC       ---------------------
GSA_SHESW       ---------------------
GSA_SHESM       ---------------------
GSA_SHESR       ---------------------
GSA_SHESA       ---------------------
GSA_SHEON       ---------------------
GSA_SHEHH       ---------------------
GSA_SHEPA       ---------------------
GSA_SHESH       ---------------------
GSA_SHEWM       ---------------------
GSA_SHEPW       ---------------------
GSA_SHELP       ---------------------
GSA_SHEAM       ---------------------
GSA_SHEDO       ---------------------
GSA_SHEFN       ---------------------
GSA_ALIF1       ---------------------
GSA_ALIFM       ---------------------
GSA_ALISL       ---------------------
GSA_VIBCH       ---------------------
GSA_VIBC3       ---------------------
GSA_VIBCM       ---------------------
GSA_VIBVU       ---------------------
GSA_VIBVY       ---------------------
GSA_VIBPA       ---------------------
GSA_VIBTL       ---------------------
GSA_PHOPR       ---------------------
GSA_COLP3       ---------------------
GSA_PSEHT       ---------------------
GSA_IDILO       ---------------------
GSA_PSYIN       ---------------------
GSA_PSEA6       ---------------------
GSA_ACIF2       ---------------------
GSA_ACIF5       ---------------------
GSA_METCA       ---------------------
GSA_PSEAE       ---------------------
GSA_PSEA8       ---------------------
GSA_PSEAB       ---------------------
GSA_PSEA7       ---------------------
GSA_PSEE4       ---------------------
GSA_PSEPW       ---------------------
GSA_PSEP1       ---------------------
GSA_PSEPK       ---------------------
GSA_PSEPG       ---------------------
GSA_PSEF5       ---------------------
GSA_PSEPF       ---------------------
GSA_PSEMY       ---------------------
GSA_PSE14       ---------------------
GSA_PSEU2       ---------------------
GSA_PSESM       ---------------------
GSA_PSEU5       ---------------------
GSA_ACIB5       ---------------------
GSA_ACIB3       ---------------------
GSA_ACIBT       ---------------------
GSA_ACIBY       ---------------------
GSA_ACIBC       ---------------------
GSA_ACIBS       ---------------------
GSA_ACIAD       ---------------------
GSA_PSYA2       ---------------------
GSA_PSYCK       ---------------------
GSA_RUTMC       ---------------------
GSA_VESOH       ---------------------
GSA_HAHCH       ---------------------
GSA_MARHV       ---------------------
GSA_MARMS       ---------------------
GSA_HYDCU       ---------------------
GSA_ALKEH       ---------------------
GSA_HALHL       ---------------------
GSA_STRMK       ---------------------
GSA_STRM5       ---------------------
GSA_XANCH       ---------------------
GSA_XANC5       ---------------------
GSA_XANAC       ---------------------
GSA_XANOR       ---------------------
GSA_XANOM       ---------------------
GSA_XANCP       ---------------------
GSA_XANC8       ---------------------
GSA_XANCB       ---------------------
GSA_XYLF2       LSKSETPIKMR----------
GSA_XYLFT       LSKSETPIKMR----------
GSA_XYLFM       LSKSETPIKMR----------
GSA_XYLFA       LSESEAPLKMP----------
GSA_CHRSD       ---------------------
GSA_NITOC       ---------------------
GSA_THISH       ---------------------
GSA_ACISJ       ---------------------
GSA_ACIET       ---------------------
GSA_ACIAC       ---------------------
GSA_VEREI       ---------------------
GSA_RHOFT       ---------------------
GSA_LEPCP       ---------------------
GSA_AZOSB       ---------------------
GSA_AROAE       ---------------------
GSA_BORBR       ---------------------
GSA_BORPA       ---------------------
GSA_BORPE       ---------------------
GSA_BORPD       ---------------------
GSA_BORA1       ---------------------
GSA_BURCM       ---------------------
GSA_BURA4       ---------------------
GSA_BURL3       ---------------------
GSA_BURCA       ---------------------
GSA_BURCH       ---------------------
GSA_BURCC       ---------------------
GSA_BURCJ       ---------------------
GSA_BURVG       ---------------------
GSA_BURM1       ---------------------
GSA_BURMA       ---------------------
GSA_BURP1       ---------------------
GSA_BURPS       ---------------------
GSA_BURM9       ---------------------
GSA_BURP0       ---------------------
GSA_BURTA       ---------------------
GSA_PARPJ       ---------------------
GSA_PARXL       ---------------------
GSA_PARP8       ---------------------
GSA_CUPTR       ---------------------
GSA_CUPNH       ---------------------
GSA_CUPPJ       ---------------------
GSA_CUPMC       ---------------------
GSA_RALPJ       ---------------------
GSA_RALSO       ---------------------
GSA_HERAR       ---------------------
GSA_JANMA       ---------------------
GSA_CHRVO       ---------------------
GSA_LARHH       ---------------------
GSA_NEIG1       ---------------------
GSA_NEIG2       ---------------------
GSA_NEIM0       ---------------------
GSA_NEIMF       ---------------------
GSA_NEIMA       ---------------------
GSA_NEIMB       ---------------------
GSA_NITEU       ATL------------------
GSA_NITEC       ---------------------
GSA_NITMU       ---------------------
GSA_DECAR       ---------------------
GSA_METFK       ---------------------
GSA_THIDA       ---------------------
GSA_SACD2       ---------------------
GSA_COXBU       SV-------------------
GSA_COXBR       SV-------------------
GSA_COXB2       SV-------------------
GSA_COXB1       SV-------------------
GSA_COXBN       SV-------------------
GSA_FRATF       ---------------------
GSA_FRATO       ---------------------
GSA_FRATH       ---------------------
GSA_FRATM       ---------------------
GSA_FRATW       ---------------------
GSA_FRATT       ---------------------
GSA_FRAT1       ---------------------
GSA_FRATN       ---------------------
GSA_FRAP2       ---------------------
GSA_LEGPC       ---------------------
GSA_LEGPH       ---------------------
GSA_LEGPL       ---------------------
GSA_LEGPA       ---------------------
GSA_CAMC1       ---------------------
GSA_CAMC5       ---------------------
GSA_CAMFF       ---------------------
GSA_CAMHC       KANKTKICSKKTVKKSVKNKK
GSA_CAMJE       ---------------------
GSA_CAMJ8       ---------------------
GSA_CAMJJ       ---------------------
GSA_CAMJR       ---------------------
GSA_CAMJD       ---------------------
GSA_HELPH       ---------------------
GSA_HELP2       ---------------------
GSA_HELPG       ---------------------
GSA_HELPS       ---------------------
GSA_HELPJ       ---------------------
GSA_HELPY       ---------------------
GSA_HELAH       ---------------------
GSA_HELHP       RI-------------------
GSA_WOLSU       ---------------------
GSA_SULDN       ---------------------
GSA_SULNB       ---------------------
GSA_STRSV       ---------------------
GSA_CHLP8       ---------------------
GSA_CHLTE       ---------------------
GSA_CHLL2       ---------------------
GSA_CHLCH       ---------------------
GSA_PELPB       ---------------------
GSA_CHLPD       ---------------------
GSA_CHLPB       ---------------------
GSA_PROA2       ---------------------
GSA_PELLD       ---------------------
GSA_CHLPM       ---------------------
GSA_CHLT3       ---------------------
GSA_CYTH3       ---------------------
GSA_SALRD       ---------------------
GSA_HUNT2       ---------------------
GSA_FLAJ1       ---------------------
GSA_FLAPJ       ---------------------
GSA_GRAFK       ---------------------
GSA_WIGBR       ---------------------
GSA_CHLTR       ---------------------
GSA_CHLTA       ---------------------
GSA_CHLT2       ---------------------
GSA_CHLTB       ---------------------
GSA_CHLMU       ---------------------
GSA_CHLFF       ---------------------
GSA_CHLCV       ---------------------
GSA_CHLAB       ---------------------
GSA_CHLPN       RFF------------------
GSA_PARUW       ---------------------
GSA_LEPIN       ---------------------
GSA_LEPIC       ---------------------
GSA_LEPBL       ---------------------
GSA_LEPBP       ---------------------
GSA_BDEBA       ---------------------
GSA_FUSNN       ---------------------
GSA_METI4       ---------------------
GSA_AERPE       ---------------------
GSA_HYPBU       ---------------------
GSA_SULAC       ---------------------
GSA_SULTO       ---------------------
GSA_SACS2       ---------------------
GSA_PYRAE       ---------------------
GSA_PYRCJ       NS-------------------
GSA_THEAC       ---------------------
GSA_THEVO       ---------------------
GSA_PICTO       ---------------------
GSA_ARCFU       ---------------------
GSA_METAR       ---------------------
GSA_METAC       ---------------------
GSA_METMA       ---------------------
GSA_METBF       ---------------------
GSA_METJA       ---------------------
GSA_METMP       ---------------------
GSA_METST       ---------------------
GSA_METTH       ---------------------
GSA_METKA       ---------------------
GSA_HALMA       ---------------------
GSA_HALLT       ---------------------
GSA_HALSA       ---------------------
GSA_HALS3       ---------------------
GSA_NATPD       ---------------------