CLUSTAL format seed alignment for MF_00376

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

COAE_TREDE      ---------MDSVLNGRQSRQSLDAPSEPILIGLSGPSCSGKNTASTILQD---YGFYCI
COAE_TREPA      ---------MREFCP---------------LIGVIGRSGAGKNVVSRLLAE---RGCYCI
COAE_EHRCJ      ----------------------------MVIFGLTGGIGSGKSLVASYFSTFF--KAKIF
COAE_EHRCR      ----------------------------MVIFGLTGGIGSGKSLVASYFKTLF--KAVVF
COAE_EHRRG      ----------------------------MIILGLTGGIGSGKSLVASYFNRFV--KAVVF
COAE_EHRRW      ----------------------------MIILGLTGGIGSGKSLVASYFNRFV--KAVVF
COAE_ANAMM      ----------------------------MIVFGLSGGAGSGKSTVAAMFAQSC--NAAVF
COAE_WOLTR      -----------------------------MIIGLTGGIGVGKSFIANCFKEF---GAAVF
COAE_WOLPM      -----------------------------MIISLTGGIGVGKSFVANCFQEF---GAVVF
COAE_BRUA2      ----------------------------MIVLGLTGSIGMGKTTAAGMFAEA---GVPVY
COAE_BRUAB      ----------------------------MIVLGLTGSIGMGKTTAAGMFAEA---GVPVY
COAE_BRUME      ----------------------------MIVLGLTGSIGMGKTTAAGMFAEA---GVPVY
COAE_BRUSU      ----------------------------MIVLGLTGSIGMGKTTAAGMFAEA---GVPVY
COAE_RHILO      ----------------------------MIVLGLTGSIGLGKSTTAKMFAEA---GVPVH
COAE_RHOP2      ----------------------------MLVLGLTGSIGMGKSTTAKLFGEA---GVPVY
COAE_RHOPA      ----------------------------MLVLGLTGSIGMGKSTTAKLFAEA---GVPVY
COAE_RHOPB      ----------------------------MRILGLTGSIGMGKSTTARLFAEA---GVPVY
COAE_NITWN      ----------------------------MLVIGLTGSIGMGKSTTARLFSEA---GVPVY
COAE_BRADU      ----------------------------MRILGLTGSIGMGKSTTAKLFAEA---GVPVY
COAE_CAUVC      ----------------------------MLILGLTGSIGMGKSTTSKMFQDE---GVPVY
COAE_RHIEC      ----------------------------MLKIGLTGSIGMGKSTVGKLFAEA---GIPLN
COAE_AGRFC      ---------------------------MMIVIGLTGSIGMGKTTTAKLFAEE---GVPVL
COAE_RHIME      ----------------------------MIIVGLTGSIGMGKSTAAGMFREL---GVPVN
COAE_MAGSA      ----------------------------MKILGLTGSIGMGKSTAAAMLRRL---GVPVH
COAE_RHORT      -----------------------------MIIGLTGSIGMGKSTLARMARRL---GVAVH
COAE_RHOS4      --------------------------MRPFRLGLTGSIGMGKSTTAALFAEE---GVPVW
COAE_RUEPO      ---------------------------MTFRLGLTGSIGMGKSTTAQMFVDE---GCALW
COAE_JANSC      ---------------------------MSFALGLTGSIGMGKSTTAAMFRDL---DVPVW
COAE_NOVAD      -------------------------MTRPFVMGLTGSIGMGKSAVALMLREM---GVPVF
COAE_GLUOX      ----------------------------MKIIGLTGGMAAGKSTVAALFRRE---GVPVF
COAE_BARHE      ----------------------------MKIIGLTGSIAMGKSTVADFFRQA---GISVF
COAE_BARQU      ----------------------------MKIIGLTGSIAMGKSTAADFFKQA---GISVF
COAE_ZYMMO      ----------------------------MIILGLTGSIAMGKSTVSRLFAQM---KRPVF
COAE_GEOMG      ----------------------------MLVIGLTGGIASGKSTVARILER---LGATII
COAE_GEOSL      ----------------------------MNIIGLTGGIASGKSTVSRILER---LGAVVI
COAE_ANADE      ----------------------------MRVIGLTGGIATGKSTFAALLRA---RGAPVV
COAE_PELCD      ----------------------------MLVLGLTGGIGSGKSIVAEMFRT---LGAKVV
COAE_MOOTA      ----------------------------MFIIGLTGGIASGKSTVAGILKD---LGAIII
COAE_LEIXX      ----------------------------MQLIGLTGGIASGKSTIASRLAE---LGAAVV
COAE_SYMTH      ----------------------------MRIIGLTGSIASGKSTVSAMLRE---PGAAVI
COAE_COREF      ----------------------------MLRIGLTGGIGSGKSTVADLLSA---EGFLII
COAE_CORGL      ----------------------------MLRIGLTGGIGSGKSTVADLLSS---EGFLIV
COAE_CORJK      ----------------------------MITIGLTGGIGSGKSTVSSRLAE---LGAFIV
COAE_CORDI      ----------------------------MRIIGLTGGIGSGKSTVARIWQG---CGAIVI
COAE_STRAW      ----------------------------MLKVGLTGGIGAGKSEVSRLLVE---HGAVLI
COAE_STRCO      ----------------------------MLRVGLTGGIGAGKSEVSRLLVE---HGAVLI
COAE_THEFY      ----------------------------MLKVGLTGGIGSGKSSVARRLAA---HGALVI
COAE_FRACC      ----------------------------MFTVGLTGGIGSGKSAVSACLAA---RGALLI
COAE_CUTAK      --MRRTVIGDETTARDVARADWVAGAGGVVRVGLTGGIASGKSTVSQMLGE---RGAVII
COAE_BIFLO      -------------------------MGTMMRIGLTGGIAAGKSTVAARLKQ---LGALHI
COAE_SYNAS      ----------------MPEGVPCGRRGAMLNVGLTGSISCGKSTVARMLEG---KGAFII
COAE_DEHM1      ----------------------------MKIVGITGGIGSGKTTVCRYLKE---LGVNII
COAE_DEHMC      ----------------------------MKIVGITGGIGSGKTTVCRYLKE---LGVNII
COAE_AROAE      ------------------------MNSHHFLVGLTGGIGSGKSAAADRLAE---LGAAVI
COAE_CHRVO      --------------------------MAIPVVGLTGGIGSGKSAAADRFAE---LGVPVI
COAE_THIDA      ----------------------------MFTIGLTGGIGSGKSAAAERFAE---LGVPVI
COAE_NITMU      ----------------------------MLVIGLTGGIGSGKTSAANIFSA---LGAGVV
COAE_NITEU      ---------------------------MALIIGLTGGIGSGKTRAADSFRE---LGIEII
COAE_BORBR      ----------------------------MYKIGLTGGIGSGKSRVADMLAE---WGASVI
COAE_BORPA      ----------------------------MYKIGLTGGIGSGKSRVADMLAE---WGASVI
COAE_BORPE      ----------------------------MYKIGLTGGIGSGKSRVADMLAE---WGASVI
COAE_BORA1      ----------------------------MLRIGLTGGIGSGKTRVADKLGE---WGAAVI
COAE_BURMA      ----------------------------MFSVGLTGGIGSGKTTVADLFGK---LGATIV
COAE_BURP1      ----------------------------MFSVGLTGGIGSGKTTVADLFGK---LGATIV
COAE_BURPS      ----------------------------MFSVGLTGGIGSGKTTVADLFGK---LGATIV
COAE_BURTA      ----------------------------MFSVGLTGGIGSGKTTVSNLFGA---LGATIV
COAE_BURL3      ----------------------------MFAIGLTGGIGSGKTTVADLFGA---RGASLV
COAE_CUPPJ      ----------------------------MLEIGLTGGIGSGKTRVADMFAA---RGAAII
COAE_RALSO      ----------------------------MRVIGLTGGIGSGKSYVAERLAE---RGAAVV
COAE_DECAR      --------------------------MSCFVVGLTGGIGSGKSTVADLFVE---QGAGLV
COAE_METCA      ----------------------------MLVVGLTGGIGAGKSTVARMFAA---RGVEVF
COAE_RHOFT      -------------------------MRGLVRLGLTGGIGSGKSTVAGLLAE---LGAAVV
COAE_NEIMA      ---------------------------MTVWVGLTGGIGSGKSAAAQCFAD---LGVPRI
COAE_NEIMB      ---------------------------MTVWVGLTGGIGSGKSAAAQCFAD---LGVPRI
COAE_NEIG1      ---------------------------MTAWVGLTGGIGSGKSAAAQYFAD---LGVPRI
COAE_BUCAI      ---------------------------MTYIVALTGGISSGKTTISNGFKKI---GINVI
COAE_BUCAP      ---------------------------MIYIVALTGGICSGKTTVSDRFKKI---GINVI
COAE_WIGBR      -----------------------MLINSPYIVAMTGGIGSGKSTIAKIFSEL---KVPII
COAE_BLOPB      ---------------------------MSYIVALTGGICSGKSVVAKKFSNL-SKKVSVI
COAE_LEGPA      ---------------------------MVYSVGLTGNIASGKSTVAEFFSEL---GINVI
COAE_LEGPH      ---------------------------MVYSVGLTGNIASGKSTVAEFFSEL---GINVI
COAE_LEGPL      ---------------------------MVYSVGLTGNIASGKSTVAEFFSEL---GINVI
COAE_YERPS      ---------------------------MTYIVALTGGIGSGKSTVANAFAN---LGVPLV
COAE_YERPE      ---------------------------MTYIVALTGGIGSGKSTVANAFAN---LGVPLV
COAE_PECAS      ---------------------------MTYIVALTGGIGSGKSTVADEFAK---LGTTIV
COAE_SODGM      --------------------------MTQYIVALTGGIGSGKSTVANTFAA---LGVPLV
COAE_PHOLL      ---------------------------MTYIIALTGGIGSGKTTIANAFAA---LGVPLV
COAE_SALTY      ---------------------------MRYTVALTGGIGSGKSTVADAFAD---LGITVI
COAE_SALTI      ---------------------------MRYTVALTGGIGSGKSTVADAFAD---LGITVI
COAE_SALCH      ---------------------------MRYTVALTGGIGSGKSTVSDAFAD---LGITVI
COAE_SALPA      ---------------------------MRYTVALTGGIGSGKSTVADAFAD---LGITVI
COAE_SHIBS      ---------------------------MRYIVALTGGIGSGKSTVANAFAD---LGINVI
COAE_SHIDS      ---------------------------MRYIVALTGGIGSGKSTVANAFAD---LGINVI
COAE_SHISS      ---------------------------MRYIVALTGGIGSGKSTVANAFAD---LGINVI
COAE_ECOLI      ---------------------------MRYIVALTGGIGSGKSTVANAFAD---LGINVI
COAE_ECO57      ---------------------------MRYIVALTGGIGSGKSTVANAFAD---LGINVI
COAE_ECOL6      ---------------------------MRYIVALTGGIGSGKSTVANAFAD---LGINVI
COAE_SHIFL      ---------------------------MGYIVALTGGIGSGKSTVANAFAD---LGINVI
COAE_VIBVU      ---------------------------MALVIGLTGGIASGKTTVANLFQQH--FAIDIV
COAE_VIBVY      ---------------------------MALVIGLTGGIASGKTTVANLFQQH--FAIDIV
COAE_VIBPA      ---------------------------MALVIGLTGGIASGKTTVANLFKQQ--FKIDIV
COAE_VIBCH      ---------------------------MSFVVALTGGIASGKTTVANLFHDQ--FGIDLV
COAE_ALIF1      ---------------------------MSYVVAITGGIGSGKTTVADRFQAL--YNINIV
COAE_PHOPR      ---------------------------MTMVIGLTGGIGSGKTTVANLFGD---YGIDII
COAE_SHEON      --------------------------MSKFVVGLTGGIGSGKTTVANLFAE---EGICLV
COAE_HAEI8      ---------------------------MTYIVGLTGGIGSGKTTIANLFTD---LGVPLV
COAE_HAEIN      ---------------------------MTYIVGLTGGIGSGKTTIANLFTD---LGVPLV
COAE_PASMU      ---------------------------MTYIVGLTGGIGSGKSTIAHLFMA---LGVPVI
COAE_MANSM      ---------------------------MAYIVGLTGGIGSGKSTIADLFME---LGVPVV
COAE_HAEDU      ---------------------------MAFVVGLTGGIASGKTTIANMFAE---LGATII
COAE_IDILO      ---------------------------MTYVVGVTGGIGSGKSAATAEFEK---LGITVI
COAE_COLP3      --------------------------MSKLVIGLTGGIGSGKTTITNYFLA---LGVEII
COAE_PSE14      ---------------------MTHPDQKPWILGLTGGIGSGKSAAAQCFTN---LGIDTV
COAE_PSEU2      ---------------------MTHPDEKPWILGLTGGIGSGKSAAAKCFSD---LGIDTV
COAE_PSESM      ---------------------MTHPDQKPWILGLTGGIGSGKSAAAQCFID---LGIDTV
COAE_PSEF5      ---------------------MTRSVNTPWTLGLTGGIGSGKSAAAQHFID---LGVHVI
COAE_PSEPF      ---------------------MNTPVEKPWILGLTGGIGSGKSAAAQHFID---LGIHVV
COAE_PSEPK      ---------------------MTTAAFTPWILGLTGGIGSGKSAAAERFVE---LGVHLV
COAE_PSEAE      ---------------------MTQ----PWILGLTGGIGSGKSAAAEHFIS---LGVHLV
COAE_HAHCH      --------------------MNQIPQHKSLVIGLTGGIASGKSAAAAKFVE---LDIPCI
COAE_PSEHT      ----------------MSEQAVKVTNINNWVLGLTGGIGCGKTAVSNMLEA---LGICVV
COAE_ACIAD      ----------------------------MFIVGLTGGIGSGKSAASQWFEK---QGIQVV
COAE_PSYA2      -----MSKYAAIPSPYSHQPQAPDHKSKTLVVGLTGGIGSGKSAASNWFAQ---QGIDII
COAE_PSYCK      -----MSKYAAAPSPYSHQPQTPEHKSKTLVVGLTGGIGSGKSAASDWFAQ---QGIDII
COAE_NITOC      -------------MDKVKFSPYETPGKMSYKVGLTGGIGSGKSTVAKIFSE---LGVPVI
COAE_COXBU      ----------------------------MLRIGLTGGIGSGKSTVANYFAE---LGAPVI
COAE_SACD2      ---------------------------MALVIGVTGGIGSGKTTVTNMFEP---LGIEVV
COAE_XANC8      --------------------------MSNFIVGLTGGIASGKSALAAEFEK---LGVPVV
COAE_XANCP      --------------------------MSNFIVGLTGGIASGKSALAAEFEK---LGVPVV
COAE_XANC5      --------------------------MSDFIVGLTGGIASGKSALAAEFEK---LGIPVI
COAE_XANOM      --------------------------MSDFIVGLTGGIASGKSALAAEFEK---LGVPVV
COAE_XANOR      --------------------------MSDFIVGLTGGIASGKSALAAEFEK---LGVPVV
COAE_XANAC      --------------------------MSDFIVGLTGGIASGKSALAAEFEK---LGVPVI
COAE_XYLFA      --------------------------MSVYAVGLTGGIACGKSLLAQLFEA---LNTTVV
COAE_XYLFT      --------------------------MSVYAVGLTGGVACGKSLLAQLFEA---LNTTVV
COAE_HYDCU      ----------------------------MKVYGLTGGIGSGKTTVRQLFED---EGVPTL
COAE_TRIV2      --------------------------MTQRIIGLTGGIATGKTTVANYLAS--AHHLPIF
COAE_NOSS1      --------------------------MTQRIIGLTGGIATGKTTVANYLAS--AHNLPIF
COAE_SYNY3      ---------------------MDTKPPRQRLIGLTGGIATGKSTVTDYLQQ--KYSVPIL
COAE_SYNP6      ------------------MGAPNHVNFVRRRIGLTGGIATGKSTVADYLRD--RYQLPIL
COAE_SYNE7      ------------------MGAPNHVNFVRRRIGLTGGIATGKSTVADYLRD--RYQLPIL
COAE_THEEB      -------------------------MSRLLRLGITGGIACGKSVVAGYLQR--QYGVPIV
COAE_SYNJA      ----------------------------MRIIGLTGGIATGKSTVARILE---RHGIPVA
COAE_SYNJB      ----------------------------MRIIGLTGGVGTGKSTVARILE---QHGIPVA
COAE_GLOVI      ----------------MAGRAQGARWMARRVIGLTGGIATGKSTVGRLLA---GWGIPVI
COAE_PROM9      ------------------MDVLQKLKNNQRRIGLTGGIASGKSTITNYIRK--HKNIPIL
COAE_PROMP      ------------------MSIHPKLNNKQRRIGLTGGIASGKSTIAKYIKE--YIDIPIL
COAE_PROMT      -----------MIDQKQTNNLCLRWKGKQRRIGITGGIASGKTIIGDFLFQ--AKQWPIL
COAE_PROMA      -------------MRVSKANALKRWKGSQRRIGITGGIASGKTSIGKYIES--VKNTPIL
COAE_SYNSC      -------------------MAPGEPFS-QRRIGLTGGIASGKSSVGRWLAQ--Q-GLPVL
COAE_PROMM      -------------------MPQARWHGPQRRIGVTGGIASGKSSVGLYLSE--QHALPLL
COAE_SYNPX      ---------------------------MQRRIGLTGGIASGKSSVGRLLEA--R-GWPVL
COAE_SYNS9      -------------------MTFGDWPP-QRRIGLTGGIASGKSSVAALLEK--R-GCPVL
COAE_BACHK      ---------------------------MTVVIGLTGGIASGKSTVSQMFR---ELSIPVI
COAE_BACAN      ---------------------------MTVVIGLTGGIASGKSTVSQMFR---ELSIPVI
COAE_BACCZ      ---------------------------MTVVIGLTGGIASGKSTVSQMFR---ELSIPVI
COAE_BACCR      ---------------------------MTVVIGLTGGIASGKSTVSQMFR---ELSIPVI
COAE_BACC1      ---------------------------MTVVIGLTGGIASGKSTVSQMFR---ELSIPVI
COAE_GEOKA      ---------------------------MTLTIGLTGGIASGKSTVSAMMR---ELGLPVI
COAE_OCEIH      ---------------------------MTLVIGLTGGIASGKSTVSSMLL---EKNFPVI
COAE_BACLD      ---------------------------MTLVIGLTGGIASGKSTVAQMFQ---QCGITVV
COAE_BACSU      ---------------------------MTLVIGLTGGIASGKSTVANMLI---EKGITVI
COAE_BACSK      -----------------------------MRIGLTGGIASGKSLVATYLE---KQGIPVV
COAE_BACHD      -----------------------------MMIGLTGGIASGKSSVAKMME---ELGLPIV
COAE_CARHZ      -------------------------MLVLPIIGLTGGIASGKSTVSRILQ---ELGFAII
COAE_STAAS      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAAW      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAA3      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAAC      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAAM      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAAN      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAAR      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAAB      ---------------------------MPKVIGLTGGIASGKSTVSELLS---VFGFKVV
COAE_STAHJ      ---------------------------MPKVIGLTGGIATGKSTVSELLT---AFGFKVV
COAE_STAES      ---------------------------MSKVIGITGGIATGKSTVSELLT---AYGFKIV
COAE_STAEQ      ---------------------------MSKVIGITGGIATGKSTVSELLT---AYGFKIV
COAE_STAS1      ---------------------------MPKVIGLTGGIASGKSTVSELLS---AHGFKIV
COAE_ENTFA      ---------------------------MTKVLGITGGIATGKSTVVALFK---KAGYPIV
COAE_LISMF      ---------------------------MGKTIGLTGSVATGKSTVSNMIQ---QAGIPLV
COAE_LISMO      ---------------------------MGKTIGLTGSVATGKSTVSSMIQ---QAGIPLV
COAE_LISIN      ---------------------------MGKTIGLTGSVATGKSTVSNLIQ---QAGIPLV
COAE_LACSS      ---------------------------MTYFLGLTGGIATGKTTVSQMLA---QQGIPII
COAE_LACPL      ---------------------------MTKLIGLTGGIATGKSTVSKLLA---TK-LPIV
COAE_LACAC      ---------------------------MTYVLALTGGIATGKSTADQFFK---NKNIPVV
COAE_LACJO      ---------------------------MTYFLGLTGGIASGKSTADEFFK---KKKIPII
COAE_STRA1      ---------------------------MTKIIGLTGGIASGKSTVTKIIR---ESGFKVI
COAE_STRA5      ---------------------------MTKIIGLTGGIASGKSTVTKIIR---ESGFKVI
COAE_STRA3      ---------------------------MTKIIGLTGGIASGKSTVTKIIR---ESGFKVI
COAE_STRMU      ---------------------------MTKIIGITGGIASGKSTITNYLR---QKGYQVI
COAE_STRPM      -----------------------------MIIGITGGIASGKSTVVKVIR---KAGYQVI
COAE_STRP1      -----------------------------MIIGITGGIASGKSTVVKVIR---KAGYQVI
COAE_STRP3      -----------------------------MIIGITGGIASGKSTVVKVIR---KAGYQVI
COAE_STRP6      -----------------------------MIIGITGGIASGKSTVVKVIR---KAGYQVI
COAE_STRP8      -----------------------------MIIGITGGIASGKSTVVKVIR---KAGYQVI
COAE_STRT1      -----------------------------MIIGLTGGIASGKSTVVEIIK---DARYKVI
COAE_STRT2      -----------------------------MIIGLTGGIASGKSTVVEIIK---DAGYKVI
COAE_STRPN      ---------------------------MGKIIGITGGIASGKSTVTNFLR---QQGFQVV
COAE_STRR6      ---------------------------MGKIIGITGGIASGKSTVTNFLR---QQGFQAV
COAE_LACLA      -----------------------------MVIGLTGGIASGKSTVVDFLI---SEGYQVI
COAE_CLOAB      ----------------------------MLKIGLTGGIGSGKSTISRIFK---ERQILVV
COAE_CLOPE      ----------------------------MIKVGLTGGICSGKSTISSMIK---EAGIPVI
COAE_CLOTE      MKEKIGMMLSDVDLEWLKKKYCIKNKGKFLKIGLTGGIGSGKSTISKMFK---NMGIDVI
COAE_BDEBA      ----------------------------MKWIGLTGGIACGKSTVSRMLR---THDIPVV
COAE_FUSNN      --------------------------MSIMIIGLTGGIASGKSTVSKYLA---EKGFKVY
COAE_CALS4      ----------------------------MRVVGLTGGIGSGKSTVSGILA---KLGAKII
COAE_AQUAE      ----------------------------MKRIGLTGNIGCGKSTVAQMFR---ELGAYVL
COAE_LEPIC      -------------------MQNSDSGKKTFLIGITGMIGGGKSTATKILE---EMGCFGI
COAE_LEPIN      -------------------MQNSDSGKKTFLIGITGMIGGGKSTATKILE---EMGCFGI
COAE_BACFN      ---------------------------MAIKIGITGGIGSGKSVVSHLLEV---MGVPVY
COAE_BACFR      ---------------------------MAIKIGITGGIGSGKSVVSHLLEV---MGVPVY
COAE_BACTN      ---------------------------MAIKIGITGGIGSGKSVVSRLLEI---MGIPVY
COAE_PORGI      ----------------------------MITIGITGGIGSGKSVVSRILLT---LGIPVY
COAE_CHLCH      -----------------------MESKLPLLVGVTGGLGSGKSMVCRYLAS---MGCALF
COAE_PELLD      -----------------------MTPSHPFLVGVTGGIGSGKSTLCRFLEK---MGCELF
COAE_CHLTE      -----------------------MKARLPLLVGVTGGIGSGKSTVCAMLAE---MGCELF
COAE_SALRD      -----------------------MTT-----LGVTGGIGSGKTTVCGFLEE---KGARVF
COAE_THET2      ---------------------MGHEAKHPIIIGITGNIGSGKSTVAALLRS---WGYPVL
COAE_THET8      ---------------------MGHEAKHPIIIGITGNIGSGKSTVAALLRS---WGYPVL
COAE_DEIRA      ----------------MTRSPAPSSPTHPRRLGLTGSIGAGKSTVARLLRE---RGLTVL
COAE_CAMJR      ---------------------------MKNAFFVTASIACGKSTFIEIANS---LGFKSI
COAE_CAMJE      ---------------------------MKNAFFVTASIACGKSTFIEIANS---LGFKSI
COAE_HELPY      -------------------------MVLKNAIALTGGIGTGKSTTIKILES---QGYKIL
COAE_HELPJ      -------------------------MILKNAIALTGGIGTGKSTTLKILES---QGYKIL
COAE_WOLSU      ------------------------MESLHYAIALSGGIGTGKSTVASLLRL---YGFEVI
COAE_HELHP      -----------------------MDKQLRYAIALTGSIGSGKSTFVSLLSL---YGYQSI
COAE_SULDN      -------------------------MAFKYAIALSGGIATGKSTVASLLSL---NGMRVI
COAE_RICFE      ----------------------------MLAIGITGSYASGKTFILDYLAE---KGYKTF
COAE_RICCN      ----------------------------MLAIGITGSYASGKTFMLDYLTE---KGYKTF
COAE_RICBR      ----------------------------MLAIGITGSYASGKTFILDYLAE---KGYKTF
COAE_RICTY      ----------------------------MLAIGITGSYASGKTFILNYLSE---KGYKTF
COAE_RICPR      ----------------------------MLAIGITGSYASGKTFILNYLSA---KGYKTF
COAE_CHLAB      -------------------------MLELLKVSITGDLSSGKTEACRVFQE---LGAYVI
COAE_CHLCV      -------------------------MLELLKVSITGDLSSGKTEASRVFQD---LGAYVI
COAE_CHLFF      -------------------------MLDLLKVSITGDLSSGKTEACRVFQD---LGAYVI
COAE_CHLPN      -------------------------MLKLLKVSITGDLSSGKTEACQVFQE---LGAYVV
COAE_CHLTA      -------------------------MLDLLKISVTGDPSSGKTEACQVFED---LGAYVI
COAE_CHLTR      -------------------------MLDLLKISVTGDPSSGKTEACQVFED---LGAYVI
COAE_CHLMU      -------------------------MLDLLKISVTGDPSSGKTEACQVFEE---LGAFVI
COAE_PARUW      -------------------------MLKLRKVAITGGLSCGKSSVCRILKE---LGAYAV
COAE_BORBP      ------------------------MGRNPLIIGITGRIASGKDAASKIISNK--YGFYEI
COAE_BORBU      ------------------------MGRNPLIIGVTGRIASGKDTVSKIISNK--YGFYEI
COAE_MYCGE      -----------------------------MLIAIVGKPGVGKTSLLQYLKDN--YHFSVF
COAE_MYCPN      -----------------------------MLIAVVGKAGVGKTTVLQYIADY--FHFPVF
COAE_THEMA      -----------------------------MVIGVTGKIGTGKSTVCEILKNK--YGAHVV
COAE_DESPS      -----------------------------MKIAVTGGYSSGKSSVSAVLTTL--LDCFFI
COAE_RHOBA      -------------MMSAEPRTVSTPAPSTPIIGVIGPPCSGKSTVARHLES---LGGVWL
COAE_FRATT      -----------------------MNFINTYPIGITGGIASGKSTATRILKEK--LNLNVV
                                                 : .    **                  

COAE_TREDE      DADAVSRKVFTEHEKEILNLFQAEAEKRGINLK-NENGIDKKAFALLVFS----DEELLK
COAE_TREPA      DADARTRELLESYGDSIVERFQVAAAARGLSLRRKDGGLHSAHLGVLLFS----EPKLLQ
COAE_EHRCJ      DADKVVHELYKYDSDVIRLVSEYFPDS-VDNGI-----VDRNNLRQHFLT----DNHLWV
COAE_EHRCR      DADQVVCQLYNCDNSVIKLVKTYFPDS-VDHGV-----VNKNSLRQHFFA----YSNLWV
COAE_EHRRG      DADNVVNNLYNFDNNVIELVKSYFPTS-VNNGV-----VDKNDLKHYFLL----YDDLWI
COAE_EHRRW      DADNVVNNLYNFDNNVIELVKSYFPTS-VNNGV-----VDKNDLKHYFLL----YDDLWI
COAE_ANAMM      DADKIVHSMYSGDAIITGLVAKYFPDC-ICNGV-----VSRERLSKHFFS----YGPLWL
COAE_WOLTR      DADFIVHQLYRVDKNIISYAEKNFPGA-IANGE-----IDKTVLSKYFLD----YDENWK
COAE_WOLPM      DADSVVHQLYKVDKSIISYAEKNFPGV-VVNGE-----IDRTVLSKYFLA----YDENWK
COAE_BRUA2      SADDAVHRLYS--GRAAPLIEATFPGT-VENGI-----VNREKLFKAVIG----QPEAIK
COAE_BRUAB      SADDAVHRLYS--GRAAPLIEATFPGT-VENGI-----VNREKLFKAVIG----QPEAIK
COAE_BRUME      SADDAVHRLYS--GRAAPLIEATFPGT-VENGI-----VNREKLFKAVIG----QPEAIK
COAE_BRUSU      SADDAVHRLYS--GRAAPLIEATFPGT-VENGI-----VNREKLFKAVIG----QPEAIK
COAE_RHILO      DSDEAVHRLYS--GVAAPLVEAAFPGT-VVDGV-----VDRAKLGARVLG----DAAALK
COAE_RHOP2      DADATVHQIYE--GEAVPAIEAAFPGT-TVDGK-----VDRALLSEKVVH----DSDAMK
COAE_RHOPA      DADATVHKIYE--NEAVPAIEAAFPGT-TLGGK-----VDRALLSAKVVH----DPAAMK
COAE_RHOPB      DADATVHQIYE--GEAAPAVETAFPGT-TVNGK-----VDRALLSARVLH----DAAAMQ
COAE_NITWN      DADATVHAIYE--GEAAFLVEAAFPGT-TVNGK-----VDREKLSAKVVH----DAAAMK
COAE_BRADU      DADAAVHQLYE--GEAAPAIEAAFPGT-TANGK-----VDRPKLSARVVH----DPAAIK
COAE_CAUVC      DADAAVHALYASGGAAVAPVETAFPGV-VVDGA-----IDRAKLSAQVVG----NSEALA
COAE_RHIEC      DSDAVVHNLYA--GEAAPLVNAAFPGT-MKDGA-----VDRHELGRQLAL----DPEGFK
COAE_AGRFC      DSDEVVHGLYR--AEAVPLIDAAFPGT-TISGM-----VDRQKLGDVLRK----NPANFN
COAE_RHIME      DADEVVHMLYS--GEAVAPVEAAFPGV-AKGGV-----IDRAELSLRLVA----APERLA
COAE_MAGSA      DADATVHALFARGGKAVAAVDAAFPGV-VRDGA-----VDRTALGAQVFG----DGAALK
COAE_RHORT      DADATVHALLGRRGAAVAAVLAAFPGVGTLTEG-----IDRKALGARVFG----RPPALA
COAE_RHOS4      DADAAVHRLYAPGGALVGPVAALCPAA-LKGGA-----VDRGALRDWIAA----DPTALP
COAE_RUEPO      DADAAVHRLYSSGGAAVAPMRAAFPDA-VVDDA-----VSRPVLKHIIAE----DPQALK
COAE_JANSC      DADATVHKLYARGGAAVAPIDALVPGA-MKDGA-----IDRAVLRAAIAD----DASLLK
COAE_NOVAD      DADAAVHQLQGPRGPLLPAIEAAFPGT-TGPEG-----VKRQDLGARVFG----DADALR
COAE_GLUOX      DADACVRALQGERGKALPLIGQAFPGT-VVASR-----LDRAALREAVRG----RPEALQ
COAE_BARHE      SADEAVYKLYKSE-PTLSLIEYKFPGV-FENGK-----VNRQKLSEILIN----DNEKLQ
COAE_BARQU      SADETVHQLYKSK-PILSLIEHTFPGV-VENGK-----VNRLKLSKILIN----DSEKLQ
COAE_ZYMMO      DADKVVHQLQAPNGRLLSAIGQAFPGV-IDEKG-----VNRQKLGAQLLQ----KPEGFR
COAE_GEOMG      DADLLAREAVLPGTPAHRAIVAAFGTEILLPDA----TIDRKALGRIVF----ANPDARR
COAE_GEOSL      DADQLAREAVMPGTSAHRSIVAAFGEGILLPDG----AIDRKALGSIIF----ADSSARK
COAE_ANADE      DADALARAAVEPGTPALAEIARTFGAEVLRPDG----ALDRKALGARVF----ADPGARR
COAE_PELCD      SADDLARMIVQPGSPTLARIARRFGAEVLCEGG----ALNRAWLAKKIF----SDPQARL
COAE_MOOTA      DTDRVAREVVAPGRPAYREIVAAFGPRVLRPDG----QLDRPALARIIF----NDATARE
COAE_LEIXX      DADRIAREVVEPGTPALAEIRRAFGDGVIAPDG----TLDRPELGAIVF----GDPAALR
COAE_SYMTH      DADAIVHHLQLPGTPVFESIVREFGPGVVRPDG----SLDRQALGRIVF----ADPGRRR
COAE_COREF      DADAIARDIVEPGQPALAELVEAFGEDILNPDG----TLNRPGLAAKAF----VSSEQTA
COAE_CORGL      DADQVARDIVEPGQPALAELAEAFGQDILKPDG----TLDRAGLAAKAF----VSEEQTA
COAE_CORJK      DADLVAREIVEPGQPALAELADAF-DGVLNPDG----TLNRGELARQAF----ATPEATE
COAE_CORDI      DADAIARVLMEPGSTVLEEVSQVFGRDLLDAEG----KLRRAELAARAF----ISEEKTA
COAE_STRAW      DADRIAREVVAPGTPGLAAVVEAFGTDVLAPDG----SLDRPKLGSIVF----ADPDKLA
COAE_STRCO      DADRIAREVVAPGTPGLAAVVAAFGEDVLAEDG----SLDRPKLGSIVF----ADPEKLA
COAE_THEFY      DADAIAREVVEPGTPALAEIVAEFGDQVLTPEG----RLDRARLGEIVF----ADETKLA
COAE_FRACC      DADQVARDVVAPGTPGLAAVLAEFGTELANADG----GLDREALGRIVF----ADPAARG
COAE_CUTAK      DYDRLSRDVVAVGTQGLAQVVEAFGREVLVADG----SLNRSALGSIVF----ADLQARR
COAE_BIFLO      DYDALAHQIVEPGGVALPQIVAEFGPDALLADG----TMNRPWIADHVFGAN-AAPGARE
COAE_SYNAS      DFDRLAHDVEEPDKPAWRGIVDTFGPDVLREDR----TIDRARLGTLVF----ADRRKLE
COAE_DEHM1      DADEIGHRVLQ-NKGIRTRITDVFGNEVMNPDG----SINRKILGELVF----GYPERLE
COAE_DEHMC      DADEIGHRVLQ-NKGIRTKITDVFGNEVMNPDG----NINRKILGELVF----GYPERLE
COAE_AROAE      DTDLIAHALTAPGGAAIEPIRAAFGDAVITVDG----ALDRKAMRDLAFS----DPQARR
COAE_CHRVO      DTDSIAHQLTGPGGAAMTEIVRVFGPGVVAGDG----SLDRAAMRARVFA----APEERK
COAE_THIDA      DTDVIAHELTRPGSRALDVIRASFGEAVIAADG----SLDRPVLRRRVFV----DPAARR
COAE_NITMU      DTDEIAHELTQSGGRSLPAIRRAFGEKYITPEG----ALNRKEMRNLVFN----DTDARR
COAE_NITEU      DTDQIAHELTRSAGKAISPIRIAFGDCFILDDG----SLDRSAMRRLVFS----DETARH
COAE_BORBR      DADEISHALTAPGGAAMPAIAREFGPQAVAADG----ALDRAWMRDLVFR----EPAARG
COAE_BORPA      DADEISHALTAPGGAAMPAIAREFGPQAVAADG----ALDRAWMRDLVFR----EPAARG
COAE_BORPE      DADEISHALTAPGGAAMPAIAREFGPQAVAADG----ALDRAWMRDLVFR----EPTARG
COAE_BORA1      DTDAIAHALTQADGLAMPAIIQAFGPEAVRADG----AMDRAWVRNRVFR----EPQARA
COAE_BURMA      DTDLIAHRITAPQGLAMPLIAREFGAEFVAADG----SLDRAKMRALVFS----DESARK
COAE_BURP1      DTDLIAHRITAPQGLAMPLIAREFGAEFVAADG----SLDRAKMRALVFS----DESARK
COAE_BURPS      DTDLIAHRITAPQGLAMPLIAREFGAEFVAADG----SLDRAKMRALVFS----DESARK
COAE_BURTA      DTDLIAHRITAPHGLAMPFIEREFGAQFVAADG----SLDRAKMRALIFS----DESARK
COAE_BURL3      DTDLIAHRITAPGGLAMPAIEQAFGRGFVAADG----SLDRAKMRTLIFS----DDAALR
COAE_CUPPJ      DTDLLAHEITAPGGQAIPALVEAFGPQCLRPDG----AMDRDAMRAVVFA----DPAAKA
COAE_RALSO      DTDAIAHEITAPGGAAIPKLVEAFGPGILRADG----AMDRDAMRALAFS----DATAKA
COAE_DECAR      DTDAIAHELTAAGGAAMPALIAEFGALVATADG----AMDRAVMRRQVFA----DPSARV
COAE_METCA      EADEVAHRLLEPGQPALKAVARAFGSDILGADG----RLDRAALRRRVFA----ESKARK
COAE_RHOFT      DADAIARHLTAPNGPAIASIAATFGPDFITSTG----AMDREKMRALAYA----DITARQ
COAE_NEIMA      DADAAAHSLTASDGIALPEIRRLFGDTVFDTQG----LLRRDILRKEVFA----SPSRKA
COAE_NEIMB      DADAAAHSLTASDGIALPEIRRLFGDTVFDTQG----LLRRDILRKEVFA----SPSRKA
COAE_NEIG1      DADAAAHSLTASDGIALPEIRRLFGDTVFDTQG----LLRRDILRKEIFA----SPSRKA
COAE_BUCAI      DTDIIAKNIIEKNLQVSFSIKRKFGKKILNIDN----SINRLLLRQYVFN----NHHHRL
COAE_BUCAP      DTDVIGRKIIEKNKKISDSIKKKFGKKILNKDN----SINRFLLRNCIFN----EKKSRL
COAE_WIGBR      ESDIISKKIMFSEKSILNSIKNKLGINFSLNNN----KYSKLVLRECIFE----SKSSVL
COAE_BLOPB      DADVISKNITQPGSIALRMITKHFGPHILFSNG----SLNRSMLKKIIFF----NPKDKE
COAE_LEGPA      YADKIAKELTSKNTPCYQDIISHFGSSVVLNNG----ELDRKRIRDIIFS----NSNERL
COAE_LEGPH      YADKIAKELTSKNTPCYQDIISHFGSSVVLNNG----ELDRKRIRDIIFS----NSNERL
COAE_LEGPL      YADKIAKELTSKDTPCYQDIILHFGSSVVLNNG----ELDRKHIRDIIFS----NSNERL
COAE_YERPS      DADIIARQVVEPGTSALAAIASRYGENILQQDG----SLNRAALRQKIFS----EQQEKA
COAE_YERPE      DADIIARQVVEPGTSALAAIASRYGENILQQDG----SLNRAALRQKIFS----EQQEKA
COAE_PECAS      DADIIARQVVEPGKPALDAIRLRFGDAVLNADG----SLNRSALRQRIFS----SPEEKQ
COAE_SODGM      DADVIAREVVQPESAALRAIVQRFGPAMLSADG----SLDRAALRARIFS----DPAEKT
COAE_PHOLL      DADIIAREIVVPGTPALQAITEHFGHDILTPDG----NLNRALLRQKIFT----NNQEKQ
COAE_SALTY      DADIIARQMVEPGQPALNAIAEHFGSELIAADG----TLRRRALRERIFS----HPEEKA
COAE_SALTI      DADIIARQMVEPGQPALNAIAEHFGSELIAADG----TLRRRALRERIFS----HPEEKA
COAE_SALCH      DADIIARQMVEPGQPTLNAIAEHFGSELIAADG----TLRRRALRERIFS----HPEEKA
COAE_SALPA      DADIIARQMVEPGQPALNAIAEHFGSELIAADG----TLRRRALRERIFS----HPEEKA
COAE_SHIBS      DADIIARQVVEPGAPALHAIADHFGANMIAADG----TLQRRALRERIFA----NPEEKN
COAE_SHIDS      DADIIARQVVEPGAPALHAIADHFGANMIAADG----TLQRRALRERIFA----NPEEKN
COAE_SHISS      DADIIARQVVEPGAPALHAIADHFGANMIAADG----TLQRRALRERIFA----NPEEKN
COAE_ECOLI      DADIIARQVVEPGAPALHAIADHFGANMIAADG----TLQRRALRERIFA----NPEEKN
COAE_ECO57      DADIIARQVVEPGAPALHAIADHFGANMIAADG----TLQRRALRERIFA----NPEEKN
COAE_ECOL6      DADIIARQVVEPGAPALHAIADHFGANMIAADG----TLQRRALRERIFA----NPEEKN
COAE_SHIFL      DADIIARQVVEPGAPALHAIADHFGENMIAADG----TLQRRALRERIFA----NPEEKN
COAE_VIBVU      DADIVARQVVAPGSAGLAAIVDHFGADILTCEG----ELDRGQLRQRIFA----HSEEKQ
COAE_VIBVY      DADIVARQVVAPGSAGLAAIVDHFGADILTREG----ELDRGQLRQRIFA----HAEEKQ
COAE_VIBPA      DADIVAREVVEPGTPGLNAIIQHFGQDITHDDN----TLDRAKLREKIFS----NPEEKA
COAE_VIBCH      DADVIARDVVKPETEGLKAIAAHFGQAILHPDG----SLNRAALRERIFA----APNEKA
COAE_ALIF1      DADIIAREVVNPGTEGLIQIEQHFGPQILLDDG----HLNRAKLRECIFS----EPSEKQ
COAE_PHOPR      DADIIAREVVEPNTTGLNAIVDKLGADILLTDG----TLDRSKLRNAIFN----QQQLKD
COAE_SHEON      DADVVAREVVAPGTHGLNAIISHFGTEMLTASG----ELDRAKLRQRVFN----DEQERQ
COAE_HAEI8      DADVVAREVVAKDSPLLSKIVEHFGAQILTEQG----ELNRAALRERVFN----HDEDKL
COAE_HAEIN      DADVVAREVVAKDSPLLSKIVEHFGAQILTEQG----ELNRAALRERVFN----HDEDKL
COAE_PASMU      DADVVARDIVTKGSELLSKIVDYFGEHILCENG----ELNRAKLRERIFR----HPEDKV
COAE_MANSM      DADEVSRRLVEKGSPLLSKIATHFGADILTNGG----ELNRSKLREIIFN----RPEQKN
COAE_HAEDU      DADIVARQVVTKGSPLFLKIVQHFGQQVLTTQG----ELNRAQLRQLIFA----NQVEKN
COAE_IDILO      DADIVSRQVVMPGTPCLRAIAEHFGRDLLTDKG----ELDRKALRQKVFS----DPAEKD
COAE_COLP3      DADIIAREVVAINSPALKAIAKHFGDDYIQADG----QLNRPLLRNRIFS----NKADKL
COAE_PSE14      DADHASRWVVEPGRPALEQIAAHFGKGLLQASG----ELDRGALRKLIFE----NPEQRR
COAE_PSEU2      DADHAARWVVEPGRPALEQIAAHFGKGVLQTSG----ELDRGALRKLIFE----TPEQRR
COAE_PSESM      DADHAARWVVEPGRPALEQIATHFGNGVLQASG----ALDRGALRKLIFE----NPEQRR
COAE_PSEF5      DADHAARWVVEPGRPALEQIARHFGQGVLQADG----QLDRAALRKLIFE----VPEQRR
COAE_PSEPF      DADHAARWVVEPGRPALAKIAEHFGPDVLQADG----TLDRAALRKLIFE----VPEQRR
COAE_PSEPK      DADQAARWVVEPGRPALASIVERFGPGVLQGDG----QLDRAALRQLIFA----DPAQRK
COAE_PSEAE      DADHAARWVVEPGRPALAKIVERFGDGILLPDG----QLDRAALRERIFQ----APEERR
COAE_HAHCH      DADQVARDVVEPGEPALQHIAEHFGSALITPNG----VLDRAALRKLVFN----DPEQKK
COAE_PSEHT      DADIIARQVVEPGSEGLKAIVTHFGADILLADG----NLNRSALRELVFS----NNEHKN
COAE_ACIAD      DADIVAREVVDVGQPALKEIATAFGDWVLQADG----SLNRRALREHIFQ----SPESRH
COAE_PSYA2      DADVIAHEVVVKGSATLRKIQRKFGDWVLNING----DMDRAAVRTHVFT----YPDALI
COAE_PSYCK      DADVIAHEVVVKGSSTLRKIQRKFGDWVLNANG----DMDRAAVRTHVFT----YPDALI
COAE_NITOC      DADIIARELVKPGQPALAEIVTTFGREILNAQG----GLDRSRLRHLVFT----SEALKT
COAE_COXBU      DADQIAHEITKPDQAAFKQIINHFGNAVLTKGK----FLNRTKLRELIFE----NPDDRQ
COAE_SACD2      DTDLIAREVVQPQQPCLEAITQRYGPQILLADG----NLNRKKLRDIVFA----DNSERL
COAE_XANC8      DADVVARQVVAPG-LILDAITNRFGQGILLPDG----TLDRQALRKIVFA----DPTERR
COAE_XANCP      DADVVARQVVAPG-LILDAITNRFGQGILLPDG----TLDRQALRKIVFA----DPTERR
COAE_XANC5      DADVVARQVVEPG-PILDAIAHRFGRAILLPDG----MLDRQALRQIVFA----DPVQRK
COAE_XANOM      DADLVARQVVAPG-PVLDAIVAQFGAEVLLTDG----TLDRQTLRQRVFA----DTAQRR
COAE_XANOR      DADLVARQVVAPG-PVLDAIVAQFGAEVLLTDG----TLDRQTLRQRVFA----DTAQRR
COAE_XANAC      DADVIARQVAEPG-PILDAIAAYFGDSVLLPDG----TLNRQALRYRVFA----DTAQRQ
COAE_XYLFA      DADIIARQVVEPG-PVLNCIVARFGSKILRADG----CLDRRFLRQRVFA----DVAERK
COAE_XYLFT      DADTIARQVVEPG-PVLNCIVARFGSKILRADG----CLDRRFLRQRVFA----DVAERK
COAE_HYDCU      DADQIAREVVAKNQPGLAEIERTFGSDYLT-NG----ELNRAKLRELIFN----DASAKQ
COAE_TRIV2      DADIYARDAVSLGSPILDAIAGRYGKEILLPDG----SLNRPKLGEIIFQ---NQD-ERH
COAE_NOSS1      DADIYARDAVSLGSPILDAIARRYGKEILLPDG----SLNRPKLGEMIFQ---NQD-QRH
COAE_SYNY3      DADLYARQAVEPGSEILVAIARRYGPEILDQQG----QLKRQALGEIVFN---NAE-EKQ
COAE_SYNP6      DADRYAREVVAVGSPVLQVIRDRYGASILLADG----QLDRQKLGSIIFA---DPA-ERQ
COAE_SYNE7      DADRYAREVVAVGSPVLQVIRDRYGASILLADG----QLDRQKLGSIIFA---DPA-ERQ
COAE_THEEB      DADVLARQVVAVGTPIYQAIVDRYGDGICRRDG----TLDRSRLGEIVFA---QPQ-ERQ
COAE_SYNJA      DADQMARQALAVGSPIRERVLQRYGRAIQDPSG----ALDRRQLGRIVFA---DAA-ERA
COAE_SYNJB      DADQMARQALAVGSPIRERVLERYGKVIQTPSG----DLDRRRLGQIVFA---DAA-ERA
COAE_GLOVI      DADLLAREAVAPGSAALAEIVQHYGSTMLTNAG----ALDRSALARIIFS---DPQ-ERR
COAE_PROM9      DADNLSRELIKPNTYGYKKILDYFGNQIIDTKNNSEKAINRKLLRNIIFK---HSE-SKE
COAE_PROMP      DADQYSKDLIKPKSNCYKKVVAYFGPQIVDQHS-SENEINRALLKKIIFE---NSI-HRK
COAE_PROMT      DADLYAHEALSAESEIVKKVWLRYGSKIIKNSSKNDQIINRKALAKIVFQ---NEL-EKK
COAE_PROMA      DADMFSREALTANQTIKDTIINRYGRTIVDKENTNSKTINRAALGEIIFH---DKN-ERI
COAE_SYNSC      DADQFAREALAPGHPATNSVMQRYGSTVRAEAT---EAIDRAALGRIVFH---DPA-ERR
COAE_PROMM      DADIYARDALVAGSAATMAVLQRYGNAVAEAGQLNPISIDRIALASIIFS---DAQ-ERR
COAE_SYNPX      DADQYARDALAPNTAASQAVAHHFGAAVGTAAD-----LDRKALGRIVFS---DPD-QRR
COAE_SYNS9      DADVYAREALATDTSASKAVVARYGKRVQKDGT---SDIDRAELAAIVFN---DPN-ERS
COAE_BACHK      DADIIAREVVEKGKPAYNKIVEVFGTEVLQEDG----ELDRPKLGSVVFY---NEE-KRL
COAE_BACAN      DADIIAREVVEKGKPAYNKIVEVFGTEVLQEDG----ELDRPKLGSVVFY---NEE-KRL
COAE_BACCZ      DADIIAREVVEKGKPAYNKIVEVFGTEVLQEDG----ELDRPKLGSVVFH---NEE-KRL
COAE_BACCR      DADIIAREVVERGKPAYNKIVEVFGTEVLQEDG----ELDRPKLGSVVFY---NEE-KRL
COAE_BACC1      DADIIAREVVERGKPAYNKIVEVFGTEVLQEDG----ELDRPKLGSVVFY---NEE-KRL
COAE_GEOKA      DADEAARAVVRPGEDAYRQIVAAFGPGILQTNG----EIDRAKLGAIVFN---NEE-ERK
COAE_OCEIH      DADLIAREVVEPGEKAYDQILEAFGKEIIQNDQ----KIDRPKLGSIIFT---DED-KRK
COAE_BACLD      DADVIAKEAVEQGMPAYQKIAETFGEGVLLETG----DIDRRKLGEIVFA---NEE-KRL
COAE_BACSU      DADIIAKQAVEKGMPAYRQIIDEFGEDILLSNG----DIDRKKLGALVFT---NEQ-KRL
COAE_BACSK      DADKLARQVVEPGEPALAQIVATFGEHVLQDDG----TLDRKQLGAIIFG---DEQ-KRK
COAE_BACHD      DADQVARDVVEPGMPAYEAIVAHFGTGVVNDDG----TLNRKALGSIVFQ---QEE-ERR
COAE_CARHZ      DADRIARDILTPGHPAYQKVIDTFGKNILTEDG----QIDRAKLGKIVFG---NRE-KLL
COAE_STAAS      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAAW      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAA3      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAAC      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAAM      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAAN      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAAR      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAAB      DADKAAREAVKKGSKGLAQVREVFGDEAIDENG----EMNRRYMGDLVFN---HPE-KRL
COAE_STAHJ      DADIAARKAVAKGTKGLEQVRAAFGDSAITEEG----EMDRKYVGEIVFN---HPE-KRL
COAE_STAES      DADIASREAVKKGSKGLEQVKEIFGEEAIDENG----EMNRQYVGEIVFN---HPD-LRE
COAE_STAEQ      DADIASREAVKKGSKGLEQVKEIFGEEAIDENG----EMNRQYVGEIVFN---HPD-LRE
COAE_STAS1      DADIASRQAVEKGTKGLERVKESFGEQAIDENG----EMNRAYVGEVVFN---QPE-KRL
COAE_ENTFA      DGDIIAREIVAKGQPALAAIVETFGPEIVLTTG----ELDRKKLGQLIFA---SPQ-KRE
COAE_LISMF      DADIAARKVVERGTEGLKEIVAYFGEEILLADG----TLNRAKLGEIIFK---DKE-KRE
COAE_LISMO      DADIAARKVVEPGTEGLKEIVAYFGEEILLADG----TLNRAKLGKIIFK---DKE-KRE
COAE_LISIN      DADIAARKVVEKGTDGLAEIVAYFGKDILLEDG----TLNRAKLGEIIFQ---DKE-KRE
COAE_LACSS      DGDQVAHQVLANNQSVQAQIQATFGKQLVQ-DG----QVDRAALGKLVFG---NQA-ALA
COAE_LACPL      DADKIAWQVEGPGQPTTQKIVAHFGQQAVLADG----RLNRPWLGQLVFN---DAQ-ALQ
COAE_LACAC      DCDQIAHDLMKPKNASWQAIKDNFGTEYLNSDQ----TINRKKLGQLVFS---DPT-ALN
COAE_LACJO      DSDLIAHQIMEIGQNGYKAVVDYFGTDILNDDQ----TINRRKLGGIVFN---DKA-KLK
COAE_STRA1      DADQVVHKLQAKGGKLYQALLEWLGPEILDADG----ELDRPKLSQMIFA---NPD-NMK
COAE_STRA5      DADQVVHKLQAKGGKLYQALLEWLGPEILDADG----ELDRPKLSQMIFA---NPD-NMK
COAE_STRA3      DADQVVHKLQAKGGKLYQALLEWLGPEILDADG----ELDRPKLSQMIFA---NPD-NMK
COAE_STRMU      DADQVVHDLQANGGRLYQALVNWLGTAILNEAG----ELNRPKLSQLIFS---SPD-NLA
COAE_STRPM      DADQVVHDLQEKGGRLYEALREAFGNQILKADG----ELDRTKLSEMLFS---NPD-NMA
COAE_STRP1      DADQVVHDLQEKGGRLYEALREAFGNQILKADG----ELDRTKLSEMLFS---NPD-NMA
COAE_STRP3      DADQVVHDLQEKGGRLYEALREAFGNQILKADG----ELDRTKLSEMLFS---NPD-NMA
COAE_STRP6      DADQVVHDLQEKGGRLYEALREAFGNQILKADG----ELDRTKLSEMLFS---NPD-NMA
COAE_STRP8      DADQVVHDLQEKGGRLYEALREAFGNQILKADG----ELDRTKLSEMLFS---NPD-NMA
COAE_STRT1      DADQLVHDMQVKGGRLYQALLDWLGYGILLPNG----ELNRPKLGQLIFS---SEE-MRY
COAE_STRT2      DADQLVHDMQVKGGRLYQALLDWLGDGILLPNG----ELNRPKLGQLIFS---SEE-MRY
COAE_STRPN      DADAVVHQLQKPGGRLFEALVQHFGQEIILENG----ELNRPLLASLIFS---NPD-ERE
COAE_STRR6      DADAVVHQLQKPGGRLFEALVQHFGQEIILENG----ELNRPLLASLIFS---NPE-EQK
COAE_LACLA      DADKVVRQLQEPGGKLYKAIVETYGLDFIADNG----QLNREKLGALVFS---DSK-ERE
COAE_CLOAB      DADEVSKEVLKEHPEILTAVRNKFGDNFFDENG----EFTRREFGNFIFN---SEP-HRK
COAE_CLOPE      DADIIAREVLEKYPDILLRVRATFGGHFFDWRG----DFRRREFGNHIFR---FPK-ERI
COAE_CLOTE      DADKIAREVLEKYPPILEYIEENFGEQYIDEFG----NLNRREFGNHIFS---ISKKERE
COAE_BDEBA      DADEIAKEVVKPGSAGLKSVIQEFGPEFLTADG----ALDRRKLGQKVFG---HPE-LLH
COAE_FUSNN      DADKIAKDISEK-KSVQEEIISTFGNKILDKNG----NIDRKKLKEIVFE---NKE-KLE
COAE_CALS4      DADLVSREIMEKGKEAYNEIVDCFGKEILDKEG----NIDRKKLGSIVFS---DKE-KLK
COAE_AQUAE      DADKLIHSFYRKGHPVYEEVVKTFGKGILDEEG----NIDRKKLADIVFK---DEE-KLR
COAE_LEPIC      NADRLAKRYTEPDSPILIELVELLGSEILDEQG----KPDRKKISEIVFN---NPK-KLS
COAE_LEPIN      NADRLAKRYTEPDSPILIELVELLGSEILDEQG----KPDRKKISEIVFN---NPE-KLS
COAE_BACFN      ISDEESKKVVATDPVIRKELCDLVGEEVFF-----GGKLNKTLLATYLFA----SSTHAS
COAE_BACFR      ISDEESKKVVATDPVIRKELCDLVGEEVFS-----GGKLNKTLLATYLFA----SSTHAS
COAE_BACTN      ISDIEAKRITHTNDVIRRELCALVGQDVFL-----NGELNRPLLASYIFG----SPEHAK
COAE_PORGI      DSDSRAKWLNDHSPVVRQALTGLIGSDLYE-----NGILRRDRLAAAIFS----SGDLLE
COAE_CHLCH      EADVVAKELQVRDSKVIEGITALFGKEVYSYNPKGELQLNRKDIAQVVFS----NQEKLG
COAE_PELLD      EADKVARQLQVSDPEIMEGIKSLFGKDVYSKTRSGKLSLDRKRIAREVFS----HPATLG
COAE_CHLTE      EADRIAKELQVEDPEVIRGIEKLFGPDVYSRDASGKLLIDRKAIAAIVFS----EPEKLA
COAE_SALRD      YADLEAKRLMQENADVRAAIVEAFGAAAYHEDDT----LNREYLAEQVFG----EAGRVE
COAE_THET2      DLDALAARARE-NKE--EELKRLFPEAVVG------GRLDRRALARLVFS----DPERLK
COAE_THET8      DLDALAARARE-NKE--EELKRLFPEAVVG------GRLDRRALARLVFS----DPERLK
COAE_DEIRA      DADAEARWVTE-QPEVLTELNEAFPGVVTG------GTLDRAGLAARVFS----DPAQVA
COAE_CAMJR      SADKIAHKILD---ENALELEKIFSPFNLKNLLTKEKKIDRKILGEIVFN----NKEAKK
COAE_CAMJE      SADKIAHKILD---ENALELEKIFSPFSLKNLLKKEKKIDRKILGEIVFN----NKEAKK
COAE_HELPY      DADKIAHQLLQ---EHRFKIAQHFGSDILEKD-----ILNRKKLGAIVFQ----DAHELK
COAE_HELPJ      DADKIAHQLLQ---EHRLEIAQRFGSDILEKD-----ILNRKKLGAIVFQ----NANELK
COAE_WOLSU      DADSIAHRLLK---EKQKEVVDLFGEGILKEG-----EIDRKSLGARVFG----DPKERA
COAE_HELHP      CADSIAHKVLE---EHSAEVIAYFGNEILQSDN----TINRKVLGNIIFA----SSSKRE
COAE_SULDN      DADAISHDILD---ASSLWVRENFGDEFVDGV-----SVNRSKLGTLIFS----DNIAKK
COAE_RICFE      CADRCIKELYQ---DLSVQTQILKLLPELESF-------NIGKISNLIYN----NDLARE
COAE_RICCN      CADRCIKELYQ---DVVLQTQILKLLPELESF-------NIRKISNLIYN----NDLARE
COAE_RICBR      CADRCIKELYQ---DLKIQTGILKLLPELETF-------NIGKISNLIYN----NDLARE
COAE_RICTY      CADNCIKELYK---DIVLQTQILKLLPELKYF-------NIRKISNLIYN----DDIARE
COAE_RICPR      CADRCIKELYK---DIVLQTQILKILPELEYF-------NIRKISNLIYN----NDIARE
COAE_CHLAB      SADKVSHSFLVPHSHIGRRVIDLLGPEVVIDNT-----FDRKVIAEKVFG----NLDLLQ
COAE_CHLCV      SADKVSHSFLVPHSHIGRRVIDLLGPEVVVDNA-----FDRKVIAEKVFD----NLVLLQ
COAE_CHLFF      SADKVSHSFLVPHSHIGHRVIDLLGSDVVVDNA-----FDRKVIAEKVFD----NLVLLQ
COAE_CHLPN      SADEISHSFLIPHTRIGRRVIDLLGSDVVVDGA-----FDAQAIAAKVFY----NSVLLQ
COAE_CHLTA      SADKVSHSFLVPYTSVGQRIIDLLGPEIIIENT-----LSRKAIAEKVFG----NRDLLL
COAE_CHLTR      SADKVSHSFLVPYTSVGQRIIDLLGPEIIIENT-----LSRKAIAEKVFG----NRDLLL
COAE_CHLMU      SADKVSHSFLVPYTSEGQRVVDLLGPEIIVENT-----LNRKAIAKKVFG----NRDLLL
COAE_PARUW      SADEIVHHLLSSDVNVSQKVVDLLGKSILKNNQ-----IHRSLLAERVFQ----NYRLLT
COAE_BORBP      SADKLGHLVLHEKKE--ELVKIFGQKILNTRNE-----IDRLLIRNLVFN----DNKELK
COAE_BORBU      NADKLGHSVLHEKKE--EIVKIFGQKILNTKNE-----IDKLLLRNLVFN----DNKELK
COAE_MYCGE      YADSFIHEQYQKNNPGYQLIMDHFGKEFVNQTE-----VDRKKLANYVFS----DDKLIE
COAE_MYCPN      FADRFIHQQYANGQAGYAIVKQQFGAQFVNHEA-----VDRKQLAQYVFN----QPDELK
COAE_THEMA      NVDRIGHEVLE---EVKEKLVELFGGSVLEDGK-----VNRKKLAGIVFE----SRENLK
COAE_DESPS      SADIACKNELQVGATGWQQLKELWGPDYFSEDG----EVDREAVREKIFL----DPASKK
COAE_RHOBA      NADEIAKSQLS-DSAVIGELKSLFGDSIQMADC----SLSRSRLADLVFGDDEASHARLR
COAE_FRATT      CADTISREITKK-PSVIKKIAEKFGDEIVMNKQ-----INRAMLRAIITE----SKEAKK
                  *                                        .                

COAE_TREDE      KHEAFILPIIEEKIWEEIKRAFTEKPE--------------------------RPILLNA
COAE_TREPA      QHEEFLLPKVTRLLCEDIARAQAARP---------------------------KAIVLNA
COAE_EHRCJ      EFQSVIHAIVLKKKKDFIMLHNRRS---------------------------VRYVVLDI
COAE_EHRCR      EFQSTLHSIILEKQKNFIMFHNRQS---------------------------TKYVVLDV
COAE_EHRRG      KFQSELHSIVWKIQKDFILSNSRRI---------------------------TKYVVLDV
COAE_EHRRW      KFQSELHSIVWKIQKDFILSNSRRV---------------------------TKYVVLDV
COAE_ANAMM      EFQSILHSIVLRQQRKFILEQGKIG---------------------------RDYAVLDV
COAE_WOLTR      QFQSLVHSAVQNELEIFIAQDKEIN---------------------------RKLLVLDV
COAE_WOLPM      QFQSLVHSAVLRELEFFIAKEKKID---------------------------RKLLVLDV
COAE_BRUA2      KLEAVVHPLVREEEDAFRREAEKSG---------------------------AAIALVDI
COAE_BRUAB      KLEAVVHPLVREEEDAFRREAEKSG---------------------------AAIALVDI
COAE_BRUME      KLEAVVHPLVREEEDAFRREAEKSG---------------------------AAIALVDI
COAE_BRUSU      KLEAVVHPLVREEEDAFRREAEKSG---------------------------AAIALVDI
COAE_RHILO      RLEAIIHPLVRADADAFLARHRTAG---------------------------ESIAVLDI
COAE_RHOP2      RLEQIVHPMLRSHHQNFLDDAEASG---------------------------APVAVVDV
COAE_RHOPA      RLEGIVHPMLRAHHQQFLDDAESSG---------------------------APVAVVDV
COAE_RHOPB      RLEAIVHPMLRAHHQQFLADAEKSG---------------------------APVAVVDV
COAE_NITWN      RLEQIVHPLLYDYRQAFLQQAERSG---------------------------AAVAVIDV
COAE_BRADU      QLEQIVHPMLGASRQKFFADAEAAN---------------------------APVVVLDI
COAE_CAUVC      KLEAIVHPLVGAHRIGFFEQAKAEG---------------------------HEIVVLDI
COAE_RHIEC      RLEAIVHPLVRKREMEFLAKQQADG---------------------------AEMVLLDI
COAE_AGRFC      RLEEIVHPLVRNRQEAFLAKARIDD---------------------------RAFALLDI
COAE_RHIME      ELERIVHPLVRAKEQEFVARHRADG---------------------------APFVLLDI
COAE_MAGSA      RLEAIVHPLVRAAERDFLARHRRAR---------------------------TRLVVLDI
COAE_RHORT      RLEAILHPLVRRREAAFLRCCGLGR---------------------------RKVVILDV
COAE_RHOS4      RLEALVHPAVAADRAAFLA---HAR---------------------------TDIVLLDI
COAE_RUEPO      RIEAIVHPLVAEDRARFRD---SAT---------------------------ADILVFDI
COAE_JANSC      QIEAIVHPLVAKDRAMFRDI--HST---------------------------APLIILDI
COAE_NOVAD      RLEAIVHPAVARMREAFMIE--HMG---------------------------EPLVVFDI
COAE_GLUOX      RLEAIMHPLVRVERERFLKQCRARH---------------------------EPFCVLDI
COAE_BARHE      TLEKIIHPLVQEKEKKFIDTARQQG---------------------------EKLVVLDI
COAE_BARQU      TLEEIIHPLVQEKEKEFIDTARQQG---------------------------KKIVVLDI
COAE_ZYMMO      RLEAIIHPAVVEELHLFLRKNRS-----------------------------HPLVIVDI
COAE_GEOMG      RLEAITHPAIARLSQARLAEARRS---------------------------DAPAVFYVA
COAE_GEOSL      RLEAITHPAIRDLAELRLAELRRS---------------------------GVPVAVYMA
COAE_ANADE      RLEAITHPAVRLAMREETARLAAQ---------------------------GHPLAFYDT
COAE_PELCD      DLDRITHPAIAELARRRFAALAQA---------------------------SATLVVYDA
COAE_MOOTA      LLNAITHPRIRELVQKRLEDLRRAN--------------------------PEAIVVIEA
COAE_LEIXX      ILNGITHPAVLRESTARFEAAAVAD--------------------------PDAIVVYDV
COAE_SYMTH      ALEAIVHPAVRAEIWRQVEQYRREG--------------------------RPA-VVLDV
COAE_COREF      LLNSITHPRIAEETARRFAEAEAA---------------------------GTKAAVYDM
COAE_CORGL      LLNAITHPRIAEESARRFNEAEDQ---------------------------GAKVAVYDM
COAE_CORJK      KLNAITHPRIRARTEELFKQGRES---------------------------GAQVLVYDM
COAE_CORDI      QLNSITHPAIRRQIRRGIECARAE---------------------------GVQVLVLDH
COAE_STRAW      VLNAIVHPLVGARSRELETAAAADA-----------------------------VVIHDV
COAE_STRCO      VLNGIVHPLVRERSTALEEAAAEDA-----------------------------VVVHDV
COAE_THEFY      RLNAIVHPRVGERTQELMAQAKEGT-----------------------------IVVYDV
COAE_FRACC      RLEAIVHPLIREETARRMGEVSPSG-----------------------------IAVHDI
COAE_CUTAK      RLEAIIHPLVEEAAHRVDEEARAAD--------------------------GLVVVVHDI
COAE_BIFLO      RLDAIEHPLIYAEAARLEHEHPEAA-----------------------------IIIHDI
COAE_SYNAS      KLNEIVHPAVFEAWRRSVEEIRGVR--------------------------PDAIVVSDF
COAE_DEHM1      HLNKITHPLIEQAIASLLEEYRQK---------------------------GIKAVAIEA
COAE_DEHMC      RLNKITHPLIEQAISSLLEEYRQK---------------------------GIKSVAIEA
COAE_AROAE      QLEAIIHPAIRAESDRQIREARG------------------------------PYAVLVV
COAE_CHRVO      RLEAILHPAIHAESVRRLQAAVG------------------------------DYAVLVV
COAE_THIDA      QLEAILHPLILHEVKARLASLSG------------------------------PYAVAVI
COAE_NITMU      KLEAILHPLIRDEVSRRVGLAQG------------------------------PYLIIVV
COAE_NITEU      RLESILHPLIYQETLQRLPLIQS------------------------------EYGIVVV
COAE_BORBR      RLEALLHPLIGLHTEQAAAQARG------------------------------LYLVFVV
COAE_BORPA      RLEALLHPLIGLHTEQAAAQARG------------------------------LYLVFVV
COAE_BORPE      RLEALLHPLIGLHTEQAAAQARG------------------------------LYLVFVV
COAE_BORA1      CLEAILHPLIGQETQAAAERAVG------------------------------SYLVFVV
COAE_BURMA      RLEAITHPLIREETEREARTAQG------------------------------AYVVFVV
COAE_BURP1      RLEAITHPLIREETEREARTAQG------------------------------AYVVFVV
COAE_BURPS      RLEAITHPLIREETEREARTAQG------------------------------AYVVFVV
COAE_BURTA      RLEAITHPLIREETEREAGAAHG------------------------------AYVVFVV
COAE_BURL3      RLEAITHPLIRAETDREAREAPG------------------------------PYVMFVV
COAE_CUPPJ      RLEGITHPLIRELTTSRAAEIAHAG--------------------------EHPYLIYVV
COAE_RALSO      RLERITHPLIREISLSRGAAAQASD--------------------------ACPYLVYVV
COAE_DECAR      RLEGILHPLIRQLSAERCRAAAS------------------------------PYVILAV
COAE_METCA      RLEGIVHPLVYAELARLVLGAAG------------------------------SYCVLSV
COAE_RHOFT      RLEAIIHPLVRQETQRQTLLAANQG---------------------------HPCIVFDV
COAE_NEIMA      LLESVMLPLIFSEIKKQQETFTDA-----------------------------AYGIVEI
COAE_NEIMB      LLESVMLPLIFSEIKKQQETFTDA-----------------------------AYGIVEI
COAE_NEIG1      LLESVMLPLIFSEIKKQQETFTDA-----------------------------VYGIVEI
COAE_BUCAI      WLENLLHPKIYQESKHQIKMT------------------------------QSNWCLWVV
COAE_BUCAP      WLENILHPEILKKSKKKIKLI------------------------------QSTWCLWVV
COAE_WIGBR      FINKILHPVVKKKIKKIISNV------------------------------NFPYIIWVT
COAE_BLOPB      WLEQLLHPLIRKETQKTINILSN----------------------------RSSYILWVV
COAE_LEGPA      WLESLLHPVIREKIEEQLIAC------------------------------TSPYCLIEI
COAE_LEGPH      WLESLLHPVIRKKIEEQLIVC------------------------------TSPYCLIEI
COAE_LEGPL      WLESLLHPVIRKKIEEQLIVC------------------------------TSPYCLIEI
COAE_YERPS      WLNSLLHPLIQQETQRQLAGI------------------------------DQPYALWVV
COAE_YERPE      WLNSLLHPLIQQETQRQLAGI------------------------------DQPYALWVV
COAE_PECAS      WLNNLLHPLIHQETQAQFRAI------------------------------STPYILWVV
COAE_SODGM      WLNGLLHPLIQRQTEQQLRSA------------------------------RAPYVLWVV
COAE_PHOLL      WVNQLLHPLIHQETRRQLEQI------------------------------IAPYVIWVI
COAE_SALTY      WLNALLHPLIQQETQRQFQQA------------------------------TSPYVLWVV
COAE_SALTI      WLNALLHPLIQQETQRQFQQA------------------------------TSPYVLWVV
COAE_SALCH      WLNALLHPLIQQETQRQFQQA------------------------------TSPYVLWVV
COAE_SALPA      WLNALLHPLIQQETQQQFQQA------------------------------TSPYVLWVV
COAE_SHIBS      WLNALLHPLIQQETQHQIQQA------------------------------TSPYVLWVV
COAE_SHIDS      WLNALLHPLIQQETQHQIQQA------------------------------TSPYVLWVV
COAE_SHISS      WLNALLHPLIQQETQHQIQQA------------------------------TSPYVLWVV
COAE_ECOLI      WLNALLHPLIQQETQHQIQQA------------------------------TSPYVLWVV
COAE_ECO57      WLNALLHPLIQQETQHQIQQA------------------------------TSPYVLWVV
COAE_ECOL6      WLNALLHPLIQQETQHQIQRA------------------------------TSPYVLWVV
COAE_SHIFL      WLNDLLHPLIQQETQHQIQQA------------------------------TSPYVLWVV
COAE_VIBVU      WLNALLHPMIRRKMIEDLAQV------------------------------SSPYALLVV
COAE_VIBVY      WLNALLHPMIRRKMIEDLAQV------------------------------SSPYALLVV
COAE_VIBPA      WLNALLHPIIREKMIEDLQQV------------------------------TSDYALLVV
COAE_VIBCH      WLNQLLHPMIRQGMRNALTQT------------------------------TSPYALLIV
COAE_ALIF1      WLNDLLHPLIRSEMQRQIALS------------------------------TSEYTLLVV
COAE_PHOPR      WLNGLLHPLIREKMLSNISKA------------------------------TSPYCLLVV
COAE_SHEON      WLNQLLHPMIRQEMLLQVEKA------------------------------TSDYVIMVV
COAE_HAEI8      WLNNLLHPAIRERMKQKLAEQ------------------------------TAPYTLFVV
COAE_HAEIN      WLNNLLHPAIRERMKQKLAEQ------------------------------TAPYTLFVV
COAE_PASMU      WLNQLLHPAIREEMLRQLQIQ------------------------------TYPYVLWVV
COAE_MANSM      WLNALLHPAINEEMQRQLQAQ------------------------------QAPYVLFVV
COAE_HAEDU      WLNNLLHPAIRREMLIQLRQA------------------------------RGPYVLFVV
COAE_IDILO      WLNSLLHPAIREEILTQLEQA------------------------------SSPYVILSA
COAE_COLP3      WLNKLLHPLIRVNIVTQTKEA------------------------------KSPYCILVA
COAE_PSE14      WLEALLHPLINQEIVSHLAKA------------------------------KSPYAILVS
COAE_PSEU2      WLEALLHPLINQEIVSHLAKA------------------------------KSPYAILVS
COAE_PSESM      WLEALLHPLINQEIVSHLAKA------------------------------KSPYAILVS
COAE_PSEF5      WLEALLHPLIAEEIVSHLARA------------------------------ESPYAILVS
COAE_PSEPF      WLEALLHPLIAEEIAHHLALA------------------------------KSPYAILVS
COAE_PSEPK      WLEQLLHPLIGQEIFSYLAKA------------------------------QSPYAVYVS
COAE_PSEAE      WLEQLLHPLIGAEIVQYLARA------------------------------ESPYAILVS
COAE_HAHCH      WLESLLHPLINQRIRDWLGAC------------------------------KTPYCILAS
COAE_PSEHT      WLNTLLHPLIRQQIIIDLNNA------------------------------TSPYVVLVA
COAE_ACIAD      TLEAITHPIIRKSIIEQLNAA------------------------------TSPYVILVS
COAE_PSYA2      ELEAITHPAIREAAKLQLAES------------------------------TSPYVVLSA
COAE_PSYCK      ELEAITHPAIREAAKKQLAES------------------------------TSPYVVLSA
COAE_NITOC      RLEAILHPRILQEMKRRATRL------------------------------SAPYCVLVI
COAE_COXBU      WLENLLHPLIIAKMKTQLKKI------------------------------KAPYCILAI
COAE_SACD2      WLESVTHPAIRQLTVQRLRAA------------------------------KSPYVILSS
COAE_XANC8      ALEAITHPAIRTELQRAAKAA------------------------------NHPYAIVAI
COAE_XANCP      ALEAITHPAIRTELQRAAKAA------------------------------NHPYAIVAI
COAE_XANC5      ALEAITHPAIRAELRRAALAA------------------------------RGPYAIVAI
COAE_XANOM      VLEAITHPAIRSELQRAALAA------------------------------LAPYAIVAI
COAE_XANOR      VLEAITHPAIRSELQRAALAA------------------------------LAPYAIVAI
COAE_XANAC      ALEAITHPAIRRELQRAALAA------------------------------QGPYAIVAI
COAE_XYLFA      ALEAIVHPVIRSGLKQAAAAA------------------------------AGPYVLVVI
COAE_XYLFT      ALEAIVHPVIRARLKQAAAAA------------------------------AGPYVLVVI
COAE_HYDCU      ALEAILHPLIRQRTEQLIQQLKKQ---------------------------HPPAIVVEI
COAE_TRIV2      WLESLIHPYVRDRFLKAIAESTS------------------------------PILVLVI
COAE_NOSS1      WVESLIHPYVRDRFLKAIAESTS------------------------------PILVLVI
COAE_SYNY3      WLESQIHPFVGRCFRSALAQLKQE-----------------------------QTVLLSI
COAE_SYNP6      WLEQQTHPAIRACFERDLAQLESD-----------------------------PIVVLVI
COAE_SYNE7      WLEQQTHPAIRACFERDLAQLESD-----------------------------PIVVLVI
COAE_THEEB      WLEAQIHPAVVAEMEQAMATCD-Q-----------------------------PLMALVI
COAE_SYNJA      WLEAQIHPFVKARLREFLEA--------HGASAPPEEATEARPSCQCPHGEGHPTVCLMI
COAE_SYNJB      WLEAQIHPFVRAQLQDFLSALAEQSSKVHGVPLEEEPASQKRSGVGFSSGQGSQTVCLMI
COAE_GLOVI      WVESRIHPSVRAAMQAAVER---------------EPG----------------TICLMI
COAE_PROM9      WIDNLLHPLVKEKMIEECIQYKNN-----------------------------QTIVLVI
COAE_PROMP      WIQNLLHPLIKEKMIEKCNQFDKN-----------------------------KILLLVI
COAE_PROMT      WLEGIIHPFVNKRIEEELEKSKSN-----------------------------SIVILII
COAE_PROMA      WLENLLHPIIEKRFEEELEKHKLS-----------------------------STIVLII
COAE_SYNSC      WLEHLIHPIVRERFDQALSLHADT-----------------------------PAVVLMI
COAE_PROMM      WLEQLIHPIVAKRFDVALADLSAE-----------------------------PVVVLMI
COAE_SYNPX      WLEALIHPVVRERFQHELAELRDE-----------------------------PVVVLMI
COAE_SYNS9      WLEQLVHPIVQRRFDDALRSLPDA-----------------------------PIVILMI
COAE_BACHK      QLNKIVHPAVREEMNRRKEMYIKEGM---------------------------QAVVLDI
COAE_BACAN      QLNKIVHPAVREEMNRQKEMYIKEGM---------------------------QAVVLDI
COAE_BACCZ      QLNKIVHPAVHEEMNRQKEMYIKEGM---------------------------QAVVLDI
COAE_BACCR      QLNKIVHPAVREEMNRQKEMYIKEGM---------------------------QAVVLDI
COAE_BACC1      QLNKIVHPAVREEMNRQKEMYIKEGM---------------------------QAVVLDI
COAE_GEOKA      KLNAIVHPAVRQKMLAEKEALVRSGT---------------------------KTVVLDI
COAE_OCEIH      QLNAIVHPAVRNRMLTKRDDYINNDV---------------------------PCVILDI
COAE_BACLD      QLNAIVHPEVRKMMIKQRDEAIRAGE---------------------------RFVVLDI
COAE_BACSU      ALNAIVHPAVRQEMLNRRDEAVANRE---------------------------AFVVLDI
COAE_BACSK      QLNEIVHPAVRQSMKKQADLYEQRGY---------------------------TRVVLDI
COAE_BACHD      VLNEIVHPAVRRQMQQQKEQLIRSGE---------------------------KTIVFDI
COAE_CARHZ      VLNSITHPEVLKEIRKKIKELTSSGI---------------------------DWIVLDI
COAE_STAAS      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAAW      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAA3      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAAC      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAAM      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAAN      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAAR      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAAB      ELNAIIHPIVRDIMEEEKQEYLKQGY---------------------------N-VIMDI
COAE_STAHJ      ELNDIVHPIVREIMEEEKQSYLNQGY---------------------------D-VIMDI
COAE_STAES      ALNEIVHPIVREIMEQEKNNYLEHGY---------------------------H-VIMDI
COAE_STAEQ      ALNEIVHPIVREIMEQEKNNYLEHGY---------------------------H-VIMDI
COAE_STAS1      ELNEIVHPIVREIMEKEKAQYLSEGY---------------------------H-VIMDI
COAE_ENTFA      LLNETLKPFLRKEILRQIEEAKKKAA---------------------------L-VIVDI
COAE_LISMF      KLNEITHPRVKDYMLEARERFFEAGE---------------------------ELVFFDI
COAE_LISMO      KLNEITHPRVKEYMLEARERFFRAGE---------------------------ELVFFDI
COAE_LISIN      KLNEITHPRVKDYMLNERERFFEAGE---------------------------KVVFFDI
COAE_LACSS      QLNAITAPVIRETIMTEMVQAKAHQV---------------------------PLVVLDL
COAE_LACPL      ALTAITRLPIQYAMFEAIVAANQQQP---------------------------DAIILDV
COAE_LACAC      KLNQLTHPLIFDKTIQKIKMYQDKD-----------------------------IVILDA
COAE_LACJO      KLNELTHPLVHQEIKQQMARYRANQE---------------------------KLVVIDV
COAE_STRA1      TSARLQNSIIRQELACQRDQLKQT----------------------------EEIFFMDI
COAE_STRA5      TSARLQNSIIRQELACQRDQLKQT----------------------------EEIFFMDI
COAE_STRA3      TSARLQNSIIRQELACQRDQLKQT----------------------------EEIFFVDI
COAE_STRMU      KSSQLQNAIIRQELETRRDQLAKT----------------------------EAIFFMDI
COAE_STRPM      TSSAIQNQIIKEELAAKRDHLAQS----------------------------QAIFFMDI
COAE_STRP1      TSSAIQNQIIKEELAAKRDHLAQS----------------------------QAIFFMDI
COAE_STRP3      TSSAIQNQIIKEELAAKRDHLAQS----------------------------QAIFFMDI
COAE_STRP6      TSSAIQNQIIKEELAAKRDHLAQS----------------------------QAIFFMDI
COAE_STRP8      TSSAIQNQIIKEELAAKRDHLAQS----------------------------QAIFFMDI
COAE_STRT1      QSAEIQGKIIREELAAKRDCLAKE----------------------------DDVFFMDI
COAE_STRT2      QSAEIQGKIIREELAAKRDCLAKE----------------------------EDVFFMDI
COAE_STRPN      WSKQIQGEIIREELATLREQLAQT----------------------------EEIFFMDI
COAE_STRR6      WSNQIQGEIIREELATLREQLAQT----------------------------EEIFFMDI
COAE_LACLA      KLSNLQDEIIRTELYDRRDDLLKKMTD-------KSVSKNFDSKSQGKNLSVNKPIFMDI
COAE_CLOAB      EYENIIMPYIKKDIVRTMKLYESLNE---------------------------NVCVLDA
COAE_CLOPE      KYEEIIMPYIKEEIEIKLKEYEKINT---------------------------KLVVVDG
COAE_CLOTE      KYENIIIPYIKLEIENQFKLYEKIGK---------------------------KVCLLDA
COAE_BDEBA      KLEAITHPLIREETRRRRRLYEDMGH---------------------------KLAIYDI
COAE_FUSNN      KLNGIIHPKVINFYKELKE--KKTDK----------------------------VIIFDV
COAE_CALS4      RLNEITHPKIIDKIKKMIEEEKDKDK----------------------------VIVIDA
COAE_AQUAE      KLEEITHRALYKEIEKITKN-LSEDT----------------------------LFILEA
COAE_LEPIC      RLNQLIHPLVRKDFQKILET-TAKGK----------------------------MVIWEV
COAE_LEPIN      RLNQLIHPLVRKDFQKILET-TAKGK----------------------------MVIWEV
COAE_BACFN      QVNGIIHPRVKEHFRQWSSHKDC-----------------------------LDIIGMES
COAE_BACFR      QVNGIIHPRVKEHFRQWSSHKEC-----------------------------LDIIGMES
COAE_BACTN      KVNAVIHPQVKEDFRRWVKGKGD-----------------------------IAMVGMES
COAE_PORGI      QVNGIIHPEVKKDFCQWRSECE------------------------------SDLCAIES
COAE_CHLCH      ALNRLIHPRVAVAFQQACDNAARSN---------------------------VAILVKEA
COAE_PELLD      ALNNLIHPKVYNAFRQRALEAFGRG---------------------------TAILVMEA
COAE_CHLTE      ALNRLIHPKVREAFVNEVKRCAREG---------------------------KRILCKEA
COAE_SALRD      RLNGIVHPHVFDAFEAAKERAADEG---------------------------VSLLVHEA
COAE_THET2      ALEAVVHPEVR---RLLMEELSRLE---------------------------APLVFLEI
COAE_THET8      ALEAVVHPEVR---RLLMEELSRLE---------------------------APLVFLEI
COAE_DEIRA      RLNAITHPRVRARMEALEAAATARG---------------------------EHWVVQDI
COAE_CAMJR      TLENFTHPKIRAKILEQMQILDKENK----------------------------AFFVEI
COAE_CAMJE      ILENFTHPKIRAKILEQMQILDKENK----------------------------AFFVEI
COAE_HELPY      WLEDFLHPLIREHMLKKAYELEKNHQ----------------------------AYFLDI
COAE_HELPJ      WLEDFLHPLIRECMLKKACELEKNHQ----------------------------AYFLDI
COAE_WOLSU      RLEALLHPPIRQEILQKAQKLEAKAF----------------------------PYFIDI
COAE_HELHP      ELQAILHPHIQKAILTQAQQLEEKKV----------------------------WYFIDI
COAE_SULDN      KLESFLHPKIRAEIEQRSIKQDSFMF----------------------------PYLIDI
COAE_RICFE      KLQNFIYPLLIDKLILFKKE-NANSK----------------------------FGFAEI
COAE_RICCN      KLQNFIYPLLIDKLILFKKE-NANSK----------------------------FGFAEI
COAE_RICBR      KLQNFIYPLLIEKLIQFKQE-NVNSK----------------------------FGFAEI
COAE_RICTY      KLQNFIYPLLIDKLILFKKE-NTNYK----------------------------FVFSEI
COAE_RICPR      KLQNFIYPLLIDKLILFKKE-NTNYK----------------------------LAFSEI
COAE_CHLAB      ALEAILHPEVCRIIEEQYCQVAKERK--------------------------YPLFIAEV
COAE_CHLCV      ALEAILHPEVRRIIEEQYYQVAKERK--------------------------HPLFIAEV
COAE_CHLFF      ALEAILHPEVCRIIEEQYCLVAKENK--------------------------YPLFIAEV
COAE_CHLPN      GLEAILHPEVCRIIEEQYHQSIQDGN--------------------------YPLFVAEV
COAE_CHLTA      SLEEILHPEVCRFVEEKYAHVVQEQK--------------------------YPLFIAEF
COAE_CHLTR      SLEEILHPEVCRFVEEKYAHVVQEQK--------------------------YPLFIAEF
COAE_CHLMU      SLEKILHPGVCRFVEENYTQVVQAQK--------------------------YSLFVVEV
COAE_PARUW      GLEKILHPAVYGEIEQQYQKQQDSKNQ-------------------------FPFFIAEV
COAE_BORBP      KLESISHPIIFNKIKKILIQNQS------------------------------TKIIINA
COAE_BORBU      KLESVSHPVILSKIKKILIQNQS------------------------------TKIIINA
COAE_MYCGE      KLSLVTKPLLIAWIKSLKTQFQK------------------------------KLALIEI
COAE_MYCPN      RLSNLTKPLVQEWLNQLKAQFQD------------------------------KIALVEI
COAE_THEMA      KLELLVHPLMKKRVQEIINKTSG-------------------------------LIVIEA
COAE_DESPS      ELEAILHPLAHRQIVDAGLRADVCD----------------------------KHLVAEI
COAE_RHOBA      QLEGILHPRTRKILQSEIAKAKSERR---------------------------PFVILDV
COAE_FRATT      WLEDYLHPVINKEIKKQVKESD------------------------------TVMTIVDI
                                                                            

COAE_TREDE      PTLHKTS-----FIKKCLFILYIDAPFILRLIRAKKR----DRLPLKNIWLRFSKQKKFF
COAE_TREPA      PTLHKTE-----LLQACSFVLYIWAPSILRMWRCKKR----ERVSFTHLLRRFSAQKGFY
COAE_EHRCJ      PLLIESN-----FYSCCDFIIHVTTSRLLQMQRVLRR-----GLSIKEFESIRCKQ--LS
COAE_EHRCR      PLLIESN-----FYSCCNFIIHVTTNRLLQMQRVLYR-----GLSIREFESIIAIQ--LS
COAE_EHRRG      PLLIEAN-----YHNCCDFVIHVKANSILQRQRLLKR-----GMSRHEFELISRLQ--LS
COAE_EHRRW      PLLIEAN-----YHNCCDFVIHVKANSILQRQRLLKR-----GMSRHEFELISRLQ--LS
COAE_ANAMM      PLLLEAG-----FWRCCDFVINVDVHKSLQWHRLRQR-----GLSEREIEFLLSLQ--MP
COAE_WOLTR      PLLLETR-----FHLYCDFIIFIYADSAAQAQRLSER-----NIDKEKLDLISSIQ--LP
COAE_WOLPM      PLLLETK-----FYLYCDLIVFVHADSVVQAQRLNER-----NIDKEKLNLISDVQ--LS
COAE_BRUA2      PLLFETG-----AEKRVDKVVVVSAPADIQHTRVLAR----PGMTQEKLKAILLRQ--IP
COAE_BRUAB      PLLFETG-----AEKRVDKVVVVSAPADIQHTRVLAR----PGMTQEKLKAILLRQ--IP
COAE_BRUME      PLLFETG-----AEKRVDKVVVVSAPADIQHTRVLAR----PGMTQEKLKAILVRQ--IP
COAE_BRUSU      PLLFETG-----AEKRVDKVVVVSAPADIQHTRVLAR----PGMTQEKLKAILVRQ--IP
COAE_RHILO      PLLFETG-----GRGRVDKVVVVTAPAEVQRQRVLAR----PGMTEEKLAAILAKQ--VP
COAE_RHOP2      PLLFETG-----GEKRVDAVVVVTTSPEVQRERILAR----ENMTPEKLDAILARQ--MP
COAE_RHOPA      PLLFETG-----GEKRVDAVVVVTTSPEVQRERILAR----DNMTPEKLDAILARQ--MP
COAE_RHOPB      PLLYETG-----GDARVDAVVVVTTSHQVQRARILAR----QGMTDEKLDALLARQ--LP
COAE_NITWN      PLLFETG-----GERSVDAVVVVTTTPEIQRERILAR----GNMTSEKLKAIQARQ--LP
COAE_BRADU      PLLFETG-----GEKRVDAVVVVSTSPELQRERVLAR----GTMDEAKLNAIIAKQ--TP
COAE_CAUVC      PLLFETG-----GEKRVDKVVVVSAPAEVQRERVLAR----PEMTPEKFEAILARQ--TP
COAE_RHIEC      PLLFETG-----AWERVDVIVVVSTDSQIQRQRVLAR----EDMTEEKFDMILSRQ--TP
COAE_AGRFC      PLLFETG-----AEGRVDKVVVVSCAPEIQRERVLSR----PGMTEEKFEMILARQ--MP
COAE_RHIME      PLLFETK-----AEARLDRIVVVTCDPEMQRERVMKR----PGMTAEKFAMILKRQ--VP
COAE_MAGSA      PLLFETH-----GESRCDLVAVVSAPAFLQAARVLAR----PGMTRQRLDAVLAKQ--MP
COAE_RHORT      PLLFETG-----GEHRCDRVMVVSAPAFLQSQRVLRR----PGMTAALLADIRARQ--TP
COAE_RHOS4      PLLYEKG-----SEAEMDAVLLVTAPPVLQRARVLGR----GTMTEAQFEAILARQ--MP
COAE_RUEPO      PLLFETG-----GEAAMDAVACVSIPPEEQKARVMAR----GTMTEAQFEQIRAKQ--MP
COAE_JANSC      PLLFETG-----GDAACDATLVVTTSPEEQRRRVLAR----GT-SEDTLHDLLSRQ--MP
COAE_NOVAD      PLLFEKG-----HGKDLDAVMVVSAPAEVQRQRVLAR----PGMTVEKFAHILSLQ--VP
COAE_GLUOX      PLLMEIG-----EDRRCDVVMVAEAPMGTRLARIRQRGRSGGRMSLADAKGLLARQ--MS
COAE_BARHE      PLLLETK-----GEKRVDSVVVVSAPLAIQKERAMIR----QNMSEKKFAFINGRQ--MS
COAE_BARQU      PLLFEKK-----GEKRVDSIIVVSAPLAIQKERTMTR----PDMNEKKFSFINAKQ--MP
COAE_ZYMMO      PLLFEAG-----FTRSVDYIAVVSAPYWIQKRRAVSR----PNMTESRFRGLLARQ--WP
COAE_GEOMG      PLLIEA-----GAADRVDDIWVVYADRETQLARLTER----DGIGRGEAEQRLAAQ--MP
COAE_GEOSL      ALLIEA-----GATDRVDEVWVVYVDRETQVRRVMAR----DGLSRSEAEQRLAAQ--MP
COAE_ANADE      PLLYEV-----GLEALLDAVVVVWAPRDVQRERLMRR----DGLGGAEADARLAAQ--LP
COAE_PELCD      PLLFEA-----GADTQVDAVVVVSVAEEVQLQRLMLR----DGLDEQAARSRMDSQ--MP
COAE_MOOTA      PLLFEA-----GMEGMVDAVWAVTAPAPVRLKRLMAR----DKLSLAEAESRLRAQ--GE
COAE_LEIXX      PLLVES-----ANRYPFDLVVVAHADAATRARRLFEL----RGMDPVAAERRIGSQ--VS
COAE_SYMTH      PLLYES-----GWDRQVDEVWVVWVDAETQKARLIAR----SGLSPEEAEARIAAQ--MS
COAE_COREF      PLLVDK-----GLDRTMDLVVVVDVEEDERVRRLVAK----RGLEEDDVRRRIASQ--VP
COAE_CORGL      PLLVEK-----GLDRKMDLVVVVDVDVEERVRRLVEK----RGLTEDDVRRRIASQ--VP
COAE_CORJK      PLLIEN-----GEVDKVDHVLVVDAPDELRIDRLVQH----RGLDENDARRRIAAQ--ID
COAE_CORDI      PLLFES-----GMSDLVDDVVVVDVPAELRVRRLVDL----RGLKEEDARHRIMRQ--MS
COAE_STRAW      PLLAEN-----GLAPLYDLVVVVDASPETQLDRLVRL----RGMTEQDARARMAAQ--AT
COAE_STRCO      PLLTEN-----GLAPLYDLVVVVDAAPATQLDRLMRL----RGMTEQDARARMAAQ--AT
COAE_THEFY      PLLVEN-----NLADQYDVVIVVDVPVHTQVERVTAN----RGMPEEQVRARINAQ--AS
COAE_FRACC      PLLVEV-----HAEGTYDVVLVVEAPRELRLHRLEG-----RGLPRDQALARMANQ--AT
COAE_CUTAK      PLLVET-----GRADEFDVVMVTDVDPAEQVRRVVER----DGCSQADAWARIHAQ--AS
COAE_BIFLO      PLLAEVID---DIPFAFDHIVTVEAPVCMRLDRMVEE----RGMSLEQAEARIRHQ--SS
COAE_SYNAS      PLLIEL-----GKQNDYDVILLVYIPPQEQIRRLILR----NGYSPEEAIQRVNSQ--MS
COAE_DEHM1      PLLVEA-----GWLKLVNEVWLITAPKESIFKRLRNR----MGLSREQVMARIQSQ--AT
COAE_DEHMC      PLLVEA-----GWLKLVNEVWLITAPKESIFKRLHSR----MGLSREQAIARIQSQ--AT
COAE_AROAE      PLLIES----NAYRDRYDRICVVDCPVDVQIARVMTR----SHLPEDQVRAIIAVQ--SS
COAE_CHRVO      PLLFES----DRYAPLLARALVVDCSEEVQVERVMRR----SKLSADAVRAIMAAQ--LP
COAE_THIDA      PLLVET----GAYDAPVDRIAVVDCPEELQIARTIAR----SGLTPDEVGAILAAQ--AA
COAE_NITMU      PLLLET----GHYRGIVQRVLVVDCSEGAQISRATAR----SGMNEQAVRAIMVAQ--VS
COAE_NITEU      PLLLEI----DGYLKLVDRVLVIDCPEPLQISRTMLR----SKLSEQEVRDVMAVQ--CS
COAE_BORBR      PLLVES----GRWRGRVDRICVVDCDPATQIARVQKR----SGLTEPAIRRIMAAQ--AA
COAE_BORPA      PLLVES----GRWRGRVDRICVVDCDPATQIARVQKR----SGLTEPAIRRIMAAQ--AA
COAE_BORPE      PLLVES----GRWRGRVDRICVVDCDPATQIARVQKR----SGLTEPAIRRIMAAQ--AA
COAE_BORA1      PLLVES----GRWRGQLDRICVVDCDPETQIKRVQNR----SGLTESDIRRIMDAQ--AA
COAE_BURMA      PLLVES----GTWKTRVDRVLVVDCDVETQIARVTAR----NGFTRAQVEAIVARQ--AS
COAE_BURP1      PLLVES----GTWKTRVDRVLVVDCDVETQIARVTAR----NGFTRAQVEAIVARQ--AS
COAE_BURPS      PLLVES----GTWKTRVDRVLVVDCDVETQIARVTAR----NGFTRAQVEAIVARQ--AS
COAE_BURTA      PLLVES----GTWEARVDRVLVVDCDVETQIARVMSR----NGFAREQVEAIVARQ--AS
COAE_BURL3      PLLVES----GNWKARSDRVLVVDCPVETQIARVMRR----NGFTREQVEAIIAKQ--AT
COAE_CUPPJ      PLLVES----GAWLNRVGRVLVVDCSEDTQIARVMSR----NGFSREQVLAIMAKQ--AT
COAE_RALSO      PLLVESLSGHHSWRALVDRILVIDCPVETQIARVIAR----NGLPRALVESIVARQ--AT
COAE_DECAR      PLLVES----GTYRERCDRIVVVDCPESLQIERVMAR----NGMSADEVKAIMAAQ--AT
COAE_METCA      PLLLET-----GRRRFVDRLLVVDCPESLQIERVVRR----SGLRPEEVRAIMAAQ--VS
COAE_RHOFT      PLLVES----TTWREKLDWVLVVDCTPATQISRVMAR----NALTRDEVEKIIASQ--AS
COAE_NEIMA      PLLTEK----RQFISLIRRVLTISAPLEKRIGRVMAR----SGLTRGEVAAVISHQ--AS
COAE_NEIMB      PLLTEK----RQFISLIRRVLTISAPVEKRIGRVMAR----SGLTRGEVAAVISHQ--AS
COAE_NEIG1      PLLTEK----RQFISLIRRVLTISAPLEKRIGRVMAR----SGLTRGEVADIISHQ--AS
COAE_BUCAI      PLLVEK-----KLEKKAHRILLIDTPVKEQIKRTVRR----DKISFLEAKKIIALQ--SS
COAE_BUCAP      PLLFEK-----KIQKKANRILLIDTPIRIQIRRMIKR----DKININEAKKIISYQ--VR
COAE_WIGBR      SLLIEE-----NLYKYVNRILVIDVDPEIQIKRSILR----DNVSKNQILNIINFQ--IS
COAE_BLOPB      PLLIEN-----NLQKYADHILMIDVHVDIQLNRIISR----DKIHKQYAENILLSQ--VS
COAE_LEGPA      PLLFNK-----HHYPYLQKVLLVIAPLESQLDRIVKR----DHCTKKQALAILATQ--PN
COAE_LEGPH      PLLFNK-----HHYPYLQKVLLVIAPLESQLDRIVKR----DHCTKKQALAILATQ--PN
COAE_LEGPL      PLLFNK-----HHYPYLQKVLLVIAPLESQLDRIVKR----DHCTKKQALAILATQ--PN
COAE_YERPS      PLLVEN-----GLHHRADRVLVVDVTPDIQLARTMAR----DGITRQQAENILASQ--VS
COAE_YERPE      PLLVEN-----GLHHRADRVLVVDVTPDIQLARTMAR----DGITRQQAENILASQ--VS
COAE_PECAS      PLLVEN-----GLQQRAQRILVVDVDRKTQLERTLAR----DGISLQQAENILAVQ--AT
COAE_SODGM      PMLIEN-----NLQQRANRVLVVDVDRERQIARTISR----DGVSREQVENILAAQ--VS
COAE_PHOLL      PLLVEN-----NLRHLADRILVVDVSPEIQISRIATR----DGINYQQIENILAAQ--AS
COAE_SALTY      PLLVEN-----RLYQKANRVLVVDVTPETQLIRTMQR----DDVTREHVEHILAAQ--AT
COAE_SALTI      PLLVEN-----RLYQKANRVLVVDVTPETQLIRTMQR----DDVTREHVEHILAAQ--AT
COAE_SALCH      PLLVEN-----RLYQKANRVLVVDVTPETQLIRTMQR----DDVTREHVEHILAAQ--AT
COAE_SALPA      PLLVEN-----RLYQKANRVLVVDVMPETQLIRTMQR----DDVTREHVEHILAAQ--AT
COAE_SHIBS      PLLVEN-----SLYKKANRVLVVDVSPETQLKRTMQR----DDVTREHVEQILAAQ--AT
COAE_SHIDS      PLLVEN-----SLYKKANRVLVVDVSPETQLKRTMQR----DDVTREHVEQILAAQ--AT
COAE_SHISS      PLLVEN-----SLYKKANRVLVVDVSPETQLKRTMQR----DDVTREHVEQILAAQ--AT
COAE_ECOLI      PLLVEN-----SLYKKANRVLVVDVSPETQLKRTMQR----DDVTREHVEQILAAQ--AT
COAE_ECO57      PLLVEN-----SLYKKANRVLVVDVSPETQLKRTMQR----DDVTREHVEQILAAQ--AT
COAE_ECOL6      PLLVEN-----SLYKKANRVLVVDVSPETQLKRTMQR----DDVTREHVEQILAAQ--AT
COAE_SHIFL      PLLVEN-----SLYKKANRVLVVDVSPETQLKRTMQR----DDVTREHVEQILAAQ--AT
COAE_VIBVU      PLLVEN-----QLQTLCDRVLVVDVEEKTQLQRTMDR----DSVDEQQVRAILKAQ--AS
COAE_VIBVY      PLLVEN-----QLQTLCDRVLVVDVEEKTQLQRTMDR----DGVDEQQVRAILKAQ--AS
COAE_VIBPA      PLLVEN-----NLDSLCDRVLVVDVEPETQISRTVKR----DNVSEEQAHAILASQ--AS
COAE_VIBCH      PLLVEN-----QLQTMADRVLVVDVDEKIQIERTMAR----DKVSREQAEAILAAQ--AS
COAE_ALIF1      PLLVEN-----KLQYLANRVLVVDVLEQTQINRTVNR----DKVNHQQVKAILASQ--AS
COAE_PHOPR      PLMVEN-----NLQTMTHRLLVVDVDESVQIDRTQAR----DNVAPEHVKKILMAQ--AS
COAE_SHEON      PLLFEN-----GLDRLVHRTLVVDISPELQISRTVQR----DNVDATQVNNIINSQ--CS
COAE_HAEI8      PLLIEN-----KLTALCDRILVVDVSPQTQLARSSQR----DNNNFEQIQRIMNSQ--VS
COAE_HAEIN      PLLIEN-----KLTALCDRILVVDVSPQTQLARSAQR----DNNNFEQIQRIMNSQ--VS
COAE_PASMU      PLLIEN-----NLTAFCQRVLVVDVEPETQIQRAMQR----DNNSIELIQHIMASQ--VD
COAE_MANSM      PLLIEN-----NLMSLCDRILIIDVSPQTQLERATKR----DKNQRELIQQIMNSQ--VS
COAE_HAEDU      PLLIEN-----KLIEFCQRVLVIDVYPEVQLARALTR----DRSNIATIRGIMASQ--VN
COAE_IDILO      PLLLEN-----NLDKYCQRVLVVDVPEELQLQRTIQR----DESPKEEVEAIMKAQ--LS
COAE_COLP3      PLLIEN-----NLLELVDRVLIVDVNESTQITRTLVR----DSSSEQEIKAIIASQ--TS
COAE_PSE14      PLLIES-----GQYRMVQRLLVIDTPAHLQIERTMLR----DSSSQEQVEAILKVQ--IQ
COAE_PSEU2      PLLVES-----GQYRMVQRLLVIDAPAHLQIERTMLR----DSSSQEQVEAILKVQ--IQ
COAE_PSESM      PLLIES-----GQSRMVQRLLVIDVPQQVQIERTMLR----DSSSQEQVEAILKVQ--IQ
COAE_PSEF5      PLLIES-----GQSRMTQRILVIDVPQQLQIERTLQR----DQISEQQVQAILQAQ--AS
COAE_PSEPF      PLLIES-----GQYAMTQRILVIDAPQQLQIERTLQR----DQTSEQQVQAILKAQ--SS
COAE_PSEPK      PLLIES-----GQHHKTQRVLVIDAPQDLQIARTLAR----DNTSAEHVQAILQAQ--LA
COAE_PSEAE      PLLVES-----GQRQMTHRVLVVDTPEHLQLQRTMLR----DKVSEEQVRSILQAQ--AR
COAE_HAHCH      PLLLET-----RQRELVDRILVIDVPESVQIARAMAR----DQNSEDLVRRIIATQ--SG
COAE_PSEHT      PLLFEN-----GLDKYCNRTLLIDVPKNVQIERTVKR----DNISLEQVNSIIAAQ--MS
COAE_ACIAD      PLLFET-----NQHELTDRNLLIDASEEIQIARASQR----DGQSIQQIQKIIAAQ--MP
COAE_PSYA2      PLLIEAAE--AGLANLCQRILVMDATEDTQLARASQR----DALSVQKIKAIMVNQ--LS
COAE_PSYCK      PLLIEAAE--AGLANLCQRILVMDATENTQLARASQR----DALSVQKIEAIMVNQ--LS
COAE_NITOC      PLLVEI----AQK-DIVDRTLVIDIPDAIQRQRVKAR----DQLSDTEIEAILRAQ--SP
COAE_COXBU      PLLAEA----SQSVDFIDRILVVDAPETLQIQRTKSR----DQLSDQQIQLILQSQ--SP
COAE_SACD2      PLLLET-----DQYTLTDKIVAVDVDEAQQVERASAR----DGQSVEQIQAIMQKQ--IT
COAE_XANC8      PLLAEAGA--RATYPWLDRILVVDVPVALQHARLMQR----DGSTSALAGQMIAAQ--AS
COAE_XANCP      PLLAEAGA--RATYPWLDRILVVDVPVALQHARLMQR----DGSTSALAGQMIAAQ--AS
COAE_XANC5      PLLAEAGG--RATYPWLDRILVVDIPAALQHARLMRR----DGATPELANRMIAAQ--AT
COAE_XANOM      PLLTEAGG--RAGYPWLDRILVVDVPVALQHQRLMQR----DAATAELADRMIAAQ--AT
COAE_XANOR      PLLTEAGG--RAGYPWLDRILVVDVPVALQHQRLMQR----DAATAELADRMIAAQ--AT
COAE_XANAC      PLLAEAGG--RATYPWLDRILVVDVPVALQHERLMQR----DGATAELADRMITAQ--AT
COAE_XYLFA      PLLAEAGG--RIGYPWLQRILVVDAIPEVQHARLMQR----DSIDAEQASLMIAAQ--IG
COAE_XYLFT      PLLAEAGG--RIGYPWLQRILVVDAIPEVQHARLMQR----DSIDAEQASLMIAAQ--IG
COAE_HYDCU      PLLTETG-----KPNYVDEVIVLDLAPETQLKRAITR----DQLPAEDIQKIIQQQ--AT
COAE_TRIV2      PLLIEVQ---MTNL--VTEIWVVICSESQQLQRLMER----NHLTLEQAQARINSQ--LS
COAE_NOSS1      PLLIEVQ---MTNL--VTEIWVVICSESQQLQRLMER----NHLTLEQAQARINSQ--LS
COAE_SYNY3      PLLFEAQ---LTDW--VTEIWVVTCGPQQQVERLIKR----NGLTEAEALARITSQ--MP
COAE_SYNP6      PLLFEAG---LQDW--VEQIWVVACPLEQQRDRLIHR----DRLTPAAAEQRLAAQ--WP
COAE_SYNE7      PLLFEAG---LQDW--VEQIWVVACPLEQQRDRLIHR----DRLTPAAAEQRLAAQ--WP
COAE_THEEB      PLLFEAH---LEGL--VDHIWVVATPPEQQLARLQQR----DRLSAHAAGQRLASQ--LP
COAE_SYNJA      PLLFEAH---MENW--ASEIWVVTCTPEQQRQRLAQR----DLLTAAEIEARLASQ--WP
COAE_SYNJB      PLLFEAH---MENW--ASEIWVVTCTPEQQRQRLARR----DPLTPEEIEARIASQ--WP
COAE_GLOVI      PLLFEAG---MTDL--VTEIWVVSCKPERQHARLKER----DGLDDQAIAARIASQ--WP
COAE_PROM9      PLLFEAK---FEDI--CTEIWLVKCPRELQKKRLITR----DKISEKEAYETINLQ--LS
COAE_PROMP      PLLFEAK---FGDI--CTEIWLVKCPKEVQKKRLMKR----NIISENEAQKIINLQ--LN
COAE_PROMT      PLLFEKN---YTGL--CSEICYIDCPRSMQLKRLQSR----DNLSIKEANQRIDAQ--WA
COAE_PROMA      PLLFEAN---FTYL--CSEVWLIYCSLDEQYERLMKR----DGLNKEQAKYRIEAQ--LP
COAE_SYNSC      PLLFEAG---LESL--CSEIWLVDCDESQQLERLIAR----DGLSPKAAQARIAAQ--WP
COAE_PROMM      PLLFEAK---LSGL--CSDVWLVDCSPAQQCQRLIAR----DGLTLKQAEQRISTQ--WP
COAE_SYNPX      PLLFEAG---LDVL--CSEIWLVDCTPKQQLERMIQR----DGLTKNEAQNRLQAQ--WP
COAE_SYNS9      PLLFEAG---LEKW--CSEIWVVRCTALQQRERLMAR----NNCTEAEATQRIAAQ--WP
COAE_BACHK      PLLFESK---LTS--LVDRVLVVAVKPHTQLERLMKR----NNFSEEEATARIQSQ--MP
COAE_BACAN      PLLFESK---LTS--LVDRVLVVAVKPHTQLERLMKR----NNFSEEEATARIQSQ--MP
COAE_BACCZ      PLLFESK---LTS--LVDRVLVVAVKPHTQLERLMKR----NNFSEEEATARIQSQ--MS
COAE_BACCR      PLLFESK---LTS--LVDRILVVAVKPHTQLERLMKR----NNFLEEEATARIQSQ--MP
COAE_BACC1      PLLFESK---LTS--LVDRVLVVAVKPRTQLERLMKR----NDFSEEEATARIQSQ--MP
COAE_GEOKA      PLLFESG---LTS--WVDKVLVVYVDDDIQLRRLMER----NGFTEEEARARICAQ--WP
COAE_OCEIH      PLLFESN---LGY--LVDKTLVVYVDEDIQLTRLMKR----NEYSEKEALDRIKAQ--MS
COAE_BACLD      PLLYESG---LEH--LTDKVIVVWVPMELQLERLMKR----NRLNKDEALNRIHAQ--QS
COAE_BACSU      PLLFESK---LES--LVDKIIVVSVTKELQLERLMKR----NQLTEEEAVSRIRSQ--MP
COAE_BACSK      PLLYESN---LFH--MVNQVWLVYVDEATQLRRLIER----DGLTETEAKQRIAAQ--MP
COAE_BACHD      PLLYESN---LFY--LVEKVLLVYVDEHTQLQRLMNR----DQAGKDDAIHRIRSQ--RP
COAE_CARHZ      PLLFEAK---MTS--LVDEIWVVYVPEEEQLKRLMAR----NGFSRDEALARIRAQ--MP
COAE_STAAS      PLLFENE---LEN--TVDEVWVVYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAAW      PLLFENE---LEN--TVDEVWVVYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAA3      PLLFENE---LEN--TVDEVWVVYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAAC      PLLFENE---LEN--TVDEVWVVYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAAM      PLLFENE---LEN--TVDEVWVVYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAAN      PLLFENE---LEN--TVDEVWVVYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAAR      PLLFENE---LEN--TVDEVWVVYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAAB      PLLFENE---LEN--TVDEVWVIYTSESIQMDRLMQR----NNLSLEDAKARVYSQ--IS
COAE_STAHJ      PLLFENE---LQN--TVDEVWLVYTSESIQIERLMER----NQLSLEDAKARVYSQ--IS
COAE_STAES      PLLYENE---LQD--TVDEVWVVYTSESIQIDRLMER----NNLSLEDAKARVYSQ--IS
COAE_STAEQ      PLLYENE---LQD--TVDEVWVVYTSESIQIDRLMER----NNLSLEDAKARVYSQ--IS
COAE_STAS1      PLLFENN---LQD--TVDEVWLVYTSESIQIDRLMER----NNISMEEAKARVYSQ--IS
COAE_ENTFA      PLLYEAH---YEA--IMDQVAVVYVPEKIQKERLMAR----NQLTEEEAQQRIASQ--WP
COAE_LISMF      PLLFESH---LES--LVDKIVVVWTTPETELKRLMER----NNLTKEDALRRIESQ--MG
COAE_LISMO      PLLFESH---LES--LVDQIIVVWTTPETELKRLMER----NNLTKEEALARINSQ--IG
COAE_LISIN      PLLFESH---LES--LVDQIIVVWTTPETELKRLMER----NNLTKEEALARINSQ--MG
COAE_LACSS      PLLYEQH---YET--VCDGVLVVYLPVEKQLARLMAR----NQLSREDALKRINSQ--AS
COAE_LACPL      PLLFESG---WQH--VCDQVLVVTASPAVVLQRLMAR----NHLSQQAAQARIDSQ--MP
COAE_LACAC      PVYFESN---LDKKKIANGVLVITLPEATQINRLKQR----NNLTDEEAKMRIKSQ--MP
COAE_LACJO      PLLFESG---FES--LCNGVLAISITPELQIERLMKR----NAFTKKEAVARISNQ--MP
COAE_STRA1      PLLIEEK---YIKW--FDEIWLVFVDKEKQLQRLMAR----NNYSREEAELRLSHQ--MP
COAE_STRA5      PLLIEEK---YIKW--FDEIWLVFVDKEKQLQRLMAR----NNYSREEAELRLSHQ--MP
COAE_STRA3      PLLIEEK---YIKW--FDEIWLVFVDKEKQLQRLMAR----NNYSREEAELRLSHQ--MP
COAE_STRMU      PLLIEQN---YRDW--FDEIWLIAVSPETQIKRLKQR----NGYSQEEAQQRLASQ--MP
COAE_STRPM      PILMELG---YQDW--FDAIWLVYVDAQTQLQRLMAR----NRLDKGKARQRIASQ--LP
COAE_STRP1      PLLMELG---YQDW--FDAIWLVYVDAQTQLQRLMAR----NRLDKGKARQRIASQ--LP
COAE_STRP3      PLLMELG---YQDW--FDAIWLVYVDAQTQLQRLMAR----NRLDKGKARQRIASQ--LP
COAE_STRP6      PLLMELG---YQDW--FDAIWLVYVDAQTQLQRLMAR----NRLDKGKARQRIASQ--LP
COAE_STRP8      PLLMELG---YQDW--FDAIWLVYVDAQTQLQRLMAR----NRLDKGKARQRIASQ--LP
COAE_STRT1      PLLFEND---YQDW--FDQIWLVAVSPQVQCQRLMKR----NHLSAEEAGMRIASQ--MP
COAE_STRT2      PLLFEND---YQDW--FDQIWLVAVSPQVQGQRLMKR----NHLSAEEAGMRIASQ--MP
COAE_STRPN      PLLFEQD---YSDW--FAETWLVYVDRDAQVERLMKR----DQLSKDEAESRLAAQ--WP
COAE_STRR6      PLLFEQD---YSDW--FAETWLVYVDRDAQVERLMKR----DQLSKDEAESRLAAQ--WP
COAE_LACLA      PLLIEYN---YTG---FDEIWLVSLPEKIQLERLMAR----NKFTEEEAKKRISSQ--MP
COAE_CLOAB      PTLIEND---IYKD--MDINILVWVDKATQIKRVQKR----DGMSEDEVIMRINSQ--MS
COAE_CLOPE      ATLIEND---MHKD--MDMVVLVWVDKSSQIERMGFR----DKLSKGEAINRINSQ--LS
COAE_CLOTE      PLLIEQD---MQKD--LDFTVLSWVNKETQIKRVGIR----DNLSEDEILNRIEAQ--IS
COAE_BDEBA      PLLFETR---AKDQ--FDGVIVVACTKEQQKERLR-R----QNWSEDEIEMRIASQ--IP
COAE_FUSNN      PLLFESG---IDKF--CDKILVVISDYEVQLNRIIER----DKINRELAEKIIKSQ--LS
COAE_CALS4      ALLIETG---LYKL--VDEVWLVVVDIDTQIKRVMER----DGFSCEEALKRIKSQ--MP
COAE_AQUAE      SLLVEKG---TYKN--YDKLIVVYAPYEVCKERAIKR-----GMSEEDFERRWKKQ--MP
COAE_LEPIC      PLLFETD---AYTL--CDATVTVDSDPEESILRTISR----DKVKKEDVLARIKNQ--LP
COAE_LEPIN      PLLFETD---AYTL--CDATVTVDSDPEESILRTISR----DKVKKEDVLARIKNQ--LP
COAE_BACFN      AILIESG-----FADEVDCIVMVYAPLELRVERAVRR----DNASCEQIMQRIRSQ--MS
COAE_BACFR      AILIESG-----FADEVDCIVMVYAPLELRVERAVRR----DNASCEQIMQRIRSQ--MS
COAE_BACTN      AILLEAG-----FKQEVDFVVMVYAPLEVRVERAIRR----DYSSRELIMKRIEAQ--MS
COAE_PORGI      AILFSSG-----FNSLCDTVIRVDAPEKIRQERAMAR----DGSSAETMRQRMLSQ--ER
COAE_CHLCH      AILFESG-----AHAGLDVVVVVQAATELRVERAVQK----GLGTREEILRRLAVQ--WA
COAE_PELLD      AILFETG-----RAADLDFVVVVAADTETRIKRAVTR----GLGTPEDIRKRIALQ--WP
COAE_CHLTE      AILFEAG-----ADRDLDRIIVVAANDGLRLARAVAR----GLAC-EEARKRMQAQ--WP
COAE_SALRD      ALLFEAG-----GDEHVDITAAVVAPEADRIAWVTAR----DDVSSGQVRARMQHQ--LS
COAE_THET2      PLLFEKG-----WEGRLHGTLLVAAPLEERVRRVMAR----SGLSREEVLARERAQ--MP
COAE_THET8      PLLFEKG-----WEGRLHGTLLVAAPLEERVRRVMAR----SGLSREEVLARERAQ--MP
COAE_DEIRA      PLLFEGG-----LERGMDAVLVVDAPLELRLERALAR----GGLTREDILARDARQ--LS
COAE_CAMJR      PLFFESG-----AYENLGKVIVIYTPKELSLKRIMQR----DKLSLEAAKVRLDSQ--ID
COAE_CAMJE      PLFFESG-----AYENLGKVIVIYTPKELSLKRIMQR----DKLSLEAAKARLDSQ--ID
COAE_HELPY      PLFFEVGG--KKCYP-VSKVVLVYASRALQIERLLER----DKLKEAEILQRLACQ--MD
COAE_HELPJ      PLFFEVGG--KKRYP-VSRVVLIYAPRALQIERLLER----DKLKEAEILQRLACQ--MD
COAE_WOLSU      PLFFEK----RDDYPMVNQTLLIYAPRKLQVERIKKR----DSLSMEEIEARLGAQ--MD
COAE_HELHP      PLFFEVGG--KEAYP-VARSLVIYTPKAKAIERIMKR----NNFTFEEAKARIDAQ--MP
COAE_SULDN      PLFFESG-----AYD-IKESVVVYVPKELQLERFIKR----NGFSREESLRRIESQ--MD
COAE_RICFE      PLLYEAKF--DKYFD---FVVTIYCSEEIRMQRAITR----TSFDIEIYNKIKEIQ--LS
COAE_RICCN      PLLYEAKF--EKYFD---FVVTIYCSEAIRMQRAITR----SSFDIEIYNKIKEIQ--LS
COAE_RICBR      PLLYEAKF--DKYFD---FVVTVHCSEEIRMQRATTR----SSFDVEIYNKIKEIQ--LS
COAE_RICTY      PLLYEAKF--DQYFD---FVVTIYCSEEIRMQRAITR----ASFDINIYNKIKEIQ--LS
COAE_RICPR      PLLYEAKF--EQYFD---FVVTIYCSEEIRMQRAITR----AEFDINIYNKIKEIQ--LS
COAE_CHLAB      PLLYEIH-----YARWFDRVILITADENIRRERFTKK----TNCSDLNFYQRCARF--SS
COAE_CHLCV      PLLYEIH-----YAKWFDRVILITADENIRRERFTKK----TNCSDLNFYQRCARF--SS
COAE_CHLFF      PLLYEIQ-----YANKFDRVILITADENTRRERFTRK----TNCSDLNFYQRCARF--SS
COAE_CHLPN      PLLYEIH-----YAKWFDSVILVMANEDIRRERFMKK----TGRSSEDFDQRCSRF--LN
COAE_CHLTA      PLLYEIQ-----YADWFDQVILISADTGIRKERFLKK----TGGSDTSFDLRCARF--SS
COAE_CHLTR      PLLYEIQ-----YADWFDQVILISADTGIRKERFLKK----TGGSDTSFDLRCARF--SS
COAE_CHLMU      PLLYEIQ-----YADWFDRVILISADTEIRKERFLKK----TGGSDTSFDLRCARF--SS
COAE_PARUW      PLLYESD-----GAKFFDTIISVVADPEISLQRFKTH----THKSEKEFQSRMARQ--IS
COAE_BORBP      ALLFKIN-----LEKLCDYIIVVKAKAPIIKNRLSYS---MPSIDSNIINKILEIQ----
COAE_BORBU      ALLFKMN-----LEKLCDYIIVLKAKNSIIKNRLSYS---IPNIDSNMINKILKIQ----
COAE_MYCGE      AVMLNYW-----NEYRSLFDYVIKLERDDQLVNLALQ---QRN-SHKKVKDLIK------
COAE_MYCPN      AVMLNYW-----NDYRPFFDEVIQIERDAKIVKQALK---ARGVDVEQVQKLIA------
COAE_THEMA      ALLKRMG---------LDQLCDHVITVVASRETILKR--------NREADRRLKFQ----
COAE_DESPS      PLLFESD-----QSYDFDMVIVVSVAEDIAISRAMRR----DDVRASLATSIIASQ--LP
COAE_RHOBA      PLLLESG-----YRDTCDEVWCLQVNPDRHQQLLASR-----GWNTEELERRSARQ--WS
COAE_FRATT      PLLGPYN---FRHYDYLKKVIVIKADLETRIRRLMER----DGKNRQQAVAFINLQ--IS
                .                                                           

COAE_TREDE      SQYFFLNADTIVVKNFWSSASLKRKLLQEVKKRGF-------------------------
COAE_TREPA      AQSIAQNADTYTVANCGRVASLARKVDCILTRRGVLGE----------------------
COAE_EHRCJ      ES-SRKKFANFTIRTGLSKKDILFQIKKIMLNVNNKCNMD--------------------
COAE_EHRCR      EN-DRKKFANFTIRTGLSKGDVLFQIQKIMFDISHRSKYLSC------------------
COAE_EHRRG      DN-DRKRLSDFTIRTGLSKNFVVSQVKDIVFQIDSRVGCKI-------------------
COAE_EHRRW      DN-DRKRLSDFTIRTGLSKNFVVSQVKDIVFQIDSRVGCKI-------------------
COAE_ANAMM      RG-SRRNFADFYVNCGGRKGEVLKSVLQIVGSLNAGRHRFRVARKKLAMRSALDRRASTM
COAE_WOLTR      VK-EKRQMSDFTIDTSTSKEHVLSQVKDIVDSLSLSS-----------------------
COAE_WOLPM      IE-EKRKMSDFIIDTSVSKEYVFSQVKDIVDSLNLNT-----------------------
COAE_BRUA2      DA-EKRSRADFVLDTSGSFDDLRRQIAEIITGLSGKPAAATR------------------
COAE_BRUAB      DA-EKRSRADFVLDTSGSFDDLRRQIAEIITGLSGKPAAATR------------------
COAE_BRUME      DA-EKRSRADFVLDTSGSFDDLRRQIAEIITGLSGKPAAATR------------------
COAE_BRUSU      DA-EKRSRADFVLDTSGSFDDLRRQIAEIITGLSGKPAAATR------------------
COAE_RHILO      DE-EKRRLADFIIDTGQGLEAARAEVDAIIDELRGQRGS---------------------
COAE_RHOP2      DA-EKRRRADFVVDTSHGLDPVRAQIREILDAAARMPRRRP-------------------
COAE_RHOPA      DA-EKRKRADFVVDTSNGLDPVRLQIREILEAAAKMPRRRD-------------------
COAE_RHOPB      DA-EKRQRADFVVDTSNGLEPVRAQIREILAATAKMPQRRA-------------------
COAE_NITWN      DA-EKRKRADFVVDTSHGVDAVRTQIREILAAAAKMPRRRS-------------------
COAE_BRADU      DA-EKRKRADFVVDTSHGLEPVRAQIAHILAEVVKMPQRRA-------------------
COAE_CAUVC      DA-DKRARADFVIDTGQGLDHARRQVRDLLTLLRTARSA---------------------
COAE_RHIEC      DA-EKRRRADYLVDTSHSIAETRAQVLEIIAELKMRIAKGDFRNA---------------
COAE_AGRFC      DA-EKRQRADFVVDSGNGVEAARDQVKEILQKLGA-------------------------
COAE_RHIME      DS-EKRARADYIVDTSDSFDVTRQQIRAIVDDLRAG------------------------
COAE_MAGSA      DG-QKRRRADVVIPTGLGKGPALKRLKAVVAMMRGSRPAAPVGGDASKPPFY--------
COAE_RHORT      EV-VKRLNAEAVVPTGLGPRPALRALRANLTMARSGVRRWRRGKRTYRPHA---------
COAE_RHOS4      DR-EKRARATHILET-LGLEAARAYVRALIAHIRETADA---------------------
COAE_RUEPO      NE-EKCARSDFVIVT-DTLDHARAQVQDIVRQIRAGNIHA--------------------
COAE_JANSC      DA-EKRARATYVIET-DTLDGTRQDVAHLVSKLTEGT-----------------------
COAE_NOVAD      DA-EKRARADYVIDTGLTLAETEGQVAELVRAIREKNPRG--------------------
COAE_GLUOX      DH-ERRRRADIVIRTGLSRGQAVRQVHALLHRLREAS-----------------------
COAE_BARHE      DE-KKRARADFIIDTGKDLENTREQVLFVIKSLLKN------------------------
COAE_BARQU      DE-KKRERADFIINTGKDLENTHQQVFSIIENLLKN------------------------
COAE_ZYMMO      DR-KKRQQADFIIENGRNIIALAAQVRQITGCLVGQGSR---------------------
COAE_GEOMG      MD-EKASYGSAVIDNRG----TSEETERQVVALWKE-------RIEKNPR----------
COAE_GEOSL      ME-EKAARGQVVIDNNG----TPEELERRIEEIWAK-------RFP--------------
COAE_ANADE      VD-EKAARADFVVENAG----APEALAGKADRLLADLRGGRGRRLPNAPPVRY-------
COAE_PELCD      LD-EKLARADYVIDNNG----SLEQTRDQVVALMARLVPGMKGPDPHASGSAG-------
COAE_MOOTA      ET-ARLRRATRVIPTGG----DLEATRASVRAAWQELQRHLADDPEPGGAPWV-------
COAE_LEIXX      DA-ERLSAADLVIDTGG----TLEETYRQVDALWAGLRG---------------------
COAE_SYMTH      LD-EKARRADRIIDNRG----SLDRTRAQVEAAWRAACGGEGGEPAAGSSAHHGAGSVDP
COAE_COREF      DE-IRLKAADIVIDNNG----PVENLRAQADRLIAEILTRIK------------------
COAE_CORGL      DD-VRLKAADIVVDNNG----TLEDLHAEASKLIAEILSRVN------------------
COAE_CORJK      RA-TRLNAADTVLDNSG----TVEQLLEQVDGFWGGL-----------------------
COAE_CORDI      DE-DRRMRADYVIDNSG----SRDVLERLARELWQRFATQVE------------------
COAE_STRAW      RE-KRLAIADIVMDNDV----PLEELERRVGDVWADLVHRAHQPGESQE-----------
COAE_STRCO      RE-QRREIADVVVDNDV----PLEELRRRVEEVWDELVRGAHTE----------------
COAE_THEFY      RE-QRRAVADIIIDNSG----TEEELDARVAEVWEELQRRLHSR----------------
COAE_FRACC      DS-QRRAAADIVVDNGG----SLDDLDARIEEVWQDLLARRDAKATAKATAKAETVASGT
COAE_CUTAK      RE-EHLAVADVIIDTSV----PLEDLPEQIDRVWSRIAGALRFDRR--------------
COAE_BIFLO      EE-ERRAIADIVIDSTH----PLPEMLAQVGEIYAGWCAGR-------------------
COAE_SYNAS      IE-DKIDFADIIVNNAG----PREQTQAQIDKIWTQLLKKERLQRKSAASSFQTGTIHKE
COAE_DEHM1      DN-ERLKYASIVINNNC----RFEDLKSCVQLLAKERLELA-------------------
COAE_DEHMC      DN-ERLKYASVVVNNNC----RFEDLKACVQLLAKERLELA-------------------
COAE_AROAE      RE-EKLAAADDVIDNS----GDLASLYAQVDRLHARYLAAARATG---------------
COAE_CHRVO      RS-ERLRRADDVIDNS----GGLAELRLQVDAKHSYYLANLVKAML--------------
COAE_THIDA      RP-ARLAVADDVIVNT----GSLAALRDQVDALHQRYLTLAANRLP--------------
COAE_NITMU      RD-ERLGQADDVIVNN----ADLPNLERQVRALHKKYMTLAQGS----------------
COAE_NITEU      RD-KRLAQADDVIVND----SGEQHLQRQVEELHRKYLMLARKHGL--------------
COAE_BORBR      RA-TRLEAADDVIVNDG--ATSPDTLRARARTLHDRWLALAGAASQPGGKAAGTPE----
COAE_BORPA      RA-TRLEAADDVIVNDG--ATSPDTLRARARTLHDRWLALAGAASQPGGKAAGTPE----
COAE_BORPE      RA-TRLEAADDVIVNDG--ATSPDTLRARARTLHDRWLALAGAASQPGGKAAGTPE----
COAE_BORA1      RA-TRLKAADDVIVNDG--STTAEVLLARARSLHQSYLALADKHDRHGSTEAGPP-----
COAE_BURMA      RD-ARLAAADDVIAND---NASVAELAAEVAALHQRYLECAAAARN--------------
COAE_BURP1      RD-ARLAAADDVIAND---NASVAELAAEVAALHQRYLECAAAARN--------------
COAE_BURPS      RD-ARLAAADDVIAND---NASVAELAAEVAALHQRYLECAAAARN--------------
COAE_BURTA      RD-ARLAAADDVIVND---NASLDELAAEVAALHQRYLGYAAAAPN--------------
COAE_BURL3      RE-ARLAAADDVIVND---ATTPDALAAQVDALHQRYLGFAAAAR---------------
COAE_CUPPJ      RA-QRLAVAHDVIDND----GPVEALTAQVDQLDRTYRALSAAGVTQA------------
COAE_RALSO      RE-ARLAVADDVIDNG----GALADLLPQIDRLDLAYRAH--------------------
COAE_DECAR      RQ-QRLAAANDVVVND----ADQAKLYAQVSALHLQYLKLSAEKVKASC-----------
COAE_METCA      RS-ERLAAADDVIVNA----ADTAGLEAEVDALHRRYSLLAAA-----------------
COAE_RHOFT      RR-HRLNAADAVIFND---SLSLGALALEVDEVARHFGLSCQPLSPNQK-----------
COAE_NEIMA      ES-ERLLLADDVLLND----GSLKSLREKTMRLHAFYSGIFASKPTQGKHNG--------
COAE_NEIMB      ES-ERLLLADDVLLND----GSLKSLREKTMRLHAFYSGIFASKPTQGKHND--------
COAE_NEIG1      ES-ERLLLADDVLLND----GSLKSLREKTMLLHAFYSGIFASKPTQGKHNG--------
COAE_BUCAI      RK-TRISLSDDIIFNK----KNFKKINLYIYYFNLLYSHLSRIYNKNKTINIKKNFLTKF
COAE_BUCAP      RK-KRISLSDDIILNKN---KNIEKLSLYIHYLNNFYIYLSKQNNPK---NMKKII----
COAE_WIGBR      RE-KRLTFAHDIINNY-----DYSCIRRKVFELHKYYLFKSKKYFKYDM-----------
COAE_BLOPB      RQ-HRLNYADNVIENN----KSIDGMTQHIHNLHRDYLKAEKTTTKKTIFSK--------
COAE_LEGPA      LE-QRLEAADDVLINE----SGLSELKAKVNKLHQKYLREAKIKQ---------------
COAE_LEGPH      LE-QRLEAADDVLINE----SGLSELKAKVNKLHQKYLREAKIKQ---------------
COAE_LEGPL      LE-QRLEAADDVLINE----SGLSELKAKVNKLHQKYLREAKIKQ---------------
COAE_YERPS      RQ-QRLACADDIIDNSG----DPLMIAQHVASLHHRYLKLATAAQQDLHQ----------
COAE_YERPE      RQ-QRLACADDIIDNSG----DPLMIAQHVASLHHRYLKLATAAQQDLHQ----------
COAE_PECAS      RE-QRLACADDIIDNSR----CPNALAQQVAELHRHYLELAASAADRMAKNE--------
COAE_SODGM      RQ-RRLACADDIIDNSG----RPEEITDRVATLHQRYLALAASATRQDKSS---------
COAE_PHOLL      RS-ERLAYADDIISNHD----NVQAITPRVAELHQQYLRLAESARQDNHDE---------
COAE_SALTY      RE-ARLAVADDVIDNNG----APDAIASDVARLHASYLKLASQFVSQEKP----------
COAE_SALTI      RE-ARLAVADDVIDNNG----APDAIASDVARLHASYLKLASQFVSQEKP----------
COAE_SALCH      RE-ARLAVADDVIDNNG----APDAIASDVARLHASYLKLASQFVSQEKP----------
COAE_SALPA      RE-ARLAVADDVIDNNG----APDAIASDVARLHASYLKLASQFVSQEKP----------
COAE_SHIBS      RE-ARLAVADDVIDNNG----APDAIASDVARLHAHYLQLASQFVSQEKP----------
COAE_SHIDS      RE-ARLAVADDVIDNNG----APDAIASDVARLHAHYLQLASQFVSQEKP----------
COAE_SHISS      RE-ARLAVADDVIDNNG----APDAIASDVARLHAHYLQLASQFVSQEKP----------
COAE_ECOLI      RE-ARLAVADDVIDNNG----APDAIASDVARLHAHYLQLASQFVSQEKP----------
COAE_ECO57      RE-ARLAVADDVIDNNG----APDAIASDVARLHAHYLQLASQFVSQEKP----------
COAE_ECOL6      RE-ARLAVADDVIDNNG----APDAIASDVARLHAYYLQLASQFVSQEKP----------
COAE_SHIFL      RE-ARLAVADDVIDNNG----APDAIASDVARLHAHYLQLASQFVSQEKP----------
COAE_VIBVU      RH-ERLALADDVIKNES----KDQDLLQQITDLHQKYLAMSKQNR---------------
COAE_VIBVY      RH-ERLALADDVIKNES----KDQDLLQQITDLHQKYLAMSKQNR---------------
COAE_VIBPA      RQ-QRLDIADDVVKNNP----NDPDLLLQITDLHEKYLAMCKKNLRK-------------
COAE_VIBCH      RA-QRLAIADDVLKNDA----ENQKLLPQITLLHQKYLAMSRQNL---------------
COAE_ALIF1      RE-ERLAAADDIINNDH----KIMT-----------------------------------
COAE_PHOPR      RQ-NRNAAADDIISNNG----NSAELKNKVAELHQKYIKMSHLY----------------
COAE_SHEON      RS-EKLARADDIIDNHG----EISRLKREVHALHQRYLQLSGNHNAHD------------
COAE_HAEI8      QQ-ERLKWADDVINNDSELAQNLPHLQQKVLELHQFYLQQAENKNA--------------
COAE_HAEIN      QQ-ERLKWADDVINNDAELAQNLPHLQQKVLELHQFYLQQAENKNA--------------
COAE_PASMU      RQ-TRLQFADDVIQNDADLKGNLPVLKQKVLELHHQYLQLANAQNA--------------
COAE_MANSM      RE-KRLTFADDIINNDEDFAQNGDRIKQKVLELHQRYLQLAQQKSSTYDNKNDR------
COAE_HAEDU      RL-TRLSYANDIIENNLPLAESLERLQMQVQQLHQYYLTLATQQE---------------
COAE_IDILO      RK-ARLRKADDILNNES----SIDQLRRQVNQLHQRYLAATVAQEE--------------
COAE_COLP3      RA-ARVNVADDIINNDD---SPLSEIKEAVLSLDKKYLTLTKMV----------------
COAE_PSE14      RE-DRLRHADDVLVNDR----DHAWLNSEVERLHHFYLTLRGGQS---------------
COAE_PSEU2      RE-DRLRHANDVLVNDR----DHAWLSSEVERLHHFYLTLRGGQS---------------
COAE_PSESM      RE-DRLRHADDVLVNDR----DHAWLNSEVERLHHFYLTLRGGQS---------------
COAE_PSEF5      RE-ERLRHADDVLVNDR----DHAWLRSEVERLHHFYLTLRGGQS---------------
COAE_PSEPF      RE-DRISRADDVVVNDR----DLAWLHSEVERLHHFYLTLSGGQS---------------
COAE_PSEPK      RE-DRLRHADDVVVNDG----GLAALHEQIDRLHHFYLTLKGGQP---------------
COAE_PSEAE      RD-ERLKHADDVLVNDG----DLSHLQREVERLHAFYLTLRGGRA---------------
COAE_HAHCH      RE-YKRQHADDIILNDK----DLAHLYHEVAKLHEYYLELAQHDR---------------
COAE_PSEHT      RE-QKQQQADDILNNDR----SLTLVKHDLIALHKGYLKLALK-----------------
COAE_ACIAD      RA-EKQQRADDIVLNDG----HLKHLYQQLIALHENYLNH--------------------
COAE_PSYA2      RE-ERNLHADDVVLNEN----DLAALYAQLEPLHQDYLKLAQQLKFAAD-----------
COAE_PSYCK      RE-ERNRHADDVVLNES----DLAALYVQLEPLHQDYLKLAQQLKFAAD-----------
COAE_NITOC      RA-VRLAAADDIIVNDT----DLATLQRQVEHYHQKYLFLASQQRN--------------
COAE_COXBU      RE-KRLAIADDVIVNDQ----TIPILRKAVFQLHCKYLQIAQT-----------------
COAE_SACD2      RQ-ARLAKADYVIDNSH----TLEHTHSQVQALHQTFTMLATAIEQK-------------
COAE_XANC8      RA-QRLAIADDVVSNEG----NTDQLAQQAQRLDATYRAALQTHRIEN------------
COAE_XANCP      RA-QRLAIADDVVSNEG----NTDQLAQQAQRLDATYRAALQTHRIEN------------
COAE_XANC5      RD-QREAIADDIVSNDR----TPEQLEQEARRLDVVYRVAASEH----------------
COAE_XANOM      RE-QRLAIADDVVCNDG----VLEQLTQATHRLDADYRARSDR-----------------
COAE_XANOR      RE-QRLAIADDVVCNDG----VLEQLTQATHRLDADYRARSDR-----------------
COAE_XANAC      RE-KRLAIADEVVCNHG----VLKQLSQAARRLDADYRARANP-----------------
COAE_XYLFA      RK-ERLAIADDIVFNDG----DPVHLGGQVCNLDARYRALASVFSDVD------------
COAE_XYLFT      RK-ERLAIADDIVFNDG----DPAHLGGQVCNLDARYRALASVFSDVD------------
COAE_HYDCU      RA-ERLAVADIILNTEQ----PLETLRKDIQSLLHTHQNT--------------------
COAE_TRIV2      LK-EKAAIADVVLDNSSSLESLLKQVDIALNFEL--------------------------
COAE_NOSS1      LK-EKAAIADVVLDNSSSLDALLKQVDIALNFEL--------------------------
COAE_SYNY3      LA-EKVALADVVLDNSGQIADLEPQIIKAWHHR---------------------------
COAE_SYNP6      IA-QKCEHADIVIDNSRDRTFTFQQVDQAIEKVVVAEN----------------------
COAE_SYNE7      IA-QKCEHADIVIDNSRDRTFTFQQVDQAIEKVVVAEN----------------------
COAE_THEEB      LE-EKIRRADTVLWNTGSLEELYRQVDQAFSLLGRGGKGG--------------------
COAE_SYNJA      LE-EKARRAHVVLDNSGSLAQLEAQVRQALGAHPREGGAICPTPPSRIE-----------
COAE_SYNJB      LA-EKVRRADVVLDNSGSLAELEAQVKQALASAGQRPFASPPRAGYSDG-----------
COAE_GLOVI      LT-EKVRHADVVLDNDGDFAHLKIQVERALDQASI-------------------------
COAE_PROM9      FE-EKSKFSDIILDNSDDQNKWINTIREIL------------------------------
COAE_PROMP      FE-DKSKFADVILDNSDNKQLWKNTIKKLV------------------------------
COAE_PROMT      NS-LKKQFADHIINNSNDDETWKLQLKKLYKF----------------------------
COAE_PROMA      LE-SKKILSDHIIDNTNKLDLSYPQVEVLL------------------------------
COAE_SYNSC      LN-QKRGLADHVVANQGHPGAWQPQARELLKMSPTAEL----------------------
COAE_PROMM      LE-QKRPLADLVIDNSGAPRAWRDQISSIC------------------------------
COAE_SYNPX      IA-RKRDRADCVIDNSGGVNDLLAAVSRCGLRADGTTW----------------------
COAE_SYNS9      ID-IKVQRADSVINNSGRIDDLHDQLDALL------------------------------
COAE_BACHK      LE-EKVKNADEVINNDGTIMGTKTQLQAILKKWNIID-----------------------
COAE_BACAN      LE-EKVKNADEVINNDGTIMGTKTQLQAILKKWNIID-----------------------
COAE_BACCZ      LE-EKVKNADEVINNDGTIMGTKTQLQAILKKWNIID-----------------------
COAE_BACCR      LE-EKVKNADEVINNDGTIMGTKTQLQVILKKWNIID-----------------------
COAE_BACC1      LE-EKVKRADEVINNDGTIMETKTQLEVILKNWNIID-----------------------
COAE_GEOKA      LA-EKMKRADAVINNNGTREETRRQLLAILKQWDALEK----------------------
COAE_OCEIH      LK-EKADLADIVIDNNQSVEETKLQLDNVLQKWNIS------------------------
COAE_BACLD      LD-EKKKRADAVIDNSGSLKDTEAQLHQLLDTWSNIEK----------------------
COAE_BACSU      LE-EKTARADQVIDNSGTLEETKRQLDEIMNSWA--------------------------
COAE_BACSK      LT-AKKAQADVLIDNNGTKENTYRQVYDALAKTAHE------------------------
COAE_BACHD      LE-SKRDRADAIIDNSGTLDATKRQLIDILKRWKVIPEDQ--------------------
COAE_CARHZ      LE-EKVKLADVVIDNSGSIESTREQILTILQKWKWKDWSKK-------------------
COAE_STAAS      ID-KKSRMADHVIDNLGDKLELKQNLERLLEEEGYIEKPNYGEED---------------
COAE_STAAW      ID-KKSRMADHVIDNLGDKLELKQNLERLLEEEGYIEKPNYGEED---------------
COAE_STAA3      ID-KKSRMADHVIDNLGDKLELKQNLERLLEEEGYIEKPNYGEED---------------
COAE_STAAC      ID-KKSRMADHVIDNLGDKLELKQNLERLLEEEGYIEKPNYGEED---------------
COAE_STAAM      ID-KKSRMADHVIDNLGDKLELKQNLERLLEEEGYIEKPNYGEED---------------
COAE_STAAN      ID-KKSRMADHVIDNLGDKLELKQNLERLLEEEGYIEKPNYGEED---------------
COAE_STAAR      ID-KKSRMADHVIDNLGDKLELKQNLERLLEEEGYIEKPNYGEGD---------------
COAE_STAAB      ID-KKSRMADHVIDNLGDKLELKQNLERLLKEEGYIEKPNYGEED---------------
COAE_STAHJ      ID-KKSRMADHVIDNLGDKLELKQNLEQLLTDKGFINKER--------------------
COAE_STAES      ID-KKSRMANHVIDNLGDKLELKQNLQKLLEEEGYIQSESE-------------------
COAE_STAEQ      ID-KKSRMADHVIDNLGDKLELKQNLQKLLEEEGYIQSESE-------------------
COAE_STAS1      ID-KKRRMADHEIDNRDTKLELKQNLENLLLEEGYIESHSEDVL----------------
COAE_ENTFA      IE-MKKERADIVFDNQGTREETEQQVKKWLEEQ--IGKK---------------------
COAE_LISMF      ID-EKARKADFVIDN-NESLEKTQKQVLTFIKRFVKNK----------------------
COAE_LISMO      ID-EKAKKADFVINN-NESLEKTQKQVYTFIERFVKNK----------------------
COAE_LISIN      ID-EKAKKADFVIDN-NESLEKTQKQVLTFIERFVNNK----------------------
COAE_LACSS      LA-EKRDRADFVIDNQGSLDQLKAQLKTVLEGVCHKSGMS--------------------
COAE_LACPL      LA-QKVARADVVIDNGANIDKTKAAVLKWLKTITK-------------------------
COAE_LACAC      LN-KKAQMADFVIANTGTIEELENKLEQLLIKIKEEG-----------------------
COAE_LACJO      LS-EKEKRATYVVANTGTIGDLEKKLSDLLQEIGR-------------------------
COAE_STRA1      LT-DKKSFASLIIDNNGDLITLKEQILDALQRL---------------------------
COAE_STRA5      LT-DKKSFASLIIDNNGDLITLKEQILDALQRL---------------------------
COAE_STRA3      LT-DKKSFASLIINNNGDLITLKEQILDALQRL---------------------------
COAE_STRMU      LQ-AKKVYADQIIDNNKTVENTKMQVDSQLRRLQNE------------------------
COAE_STRPM      IE-EKKPYASLVIDNSGDIAALIKQVQSALLSLANPR-----------------------
COAE_STRP1      IE-EKKPYASLVIDNSGDIAALIKQVQSALLLLANPR-----------------------
COAE_STRP3      IE-EKKPYASLVIDNNGDMETLIKQVQSALLSLANPR-----------------------
COAE_STRP6      IE-EKKPYASLVIDNNGDMETLIKQVQSALLSLANPR-----------------------
COAE_STRP8      IE-EKKPYASLVIDNNGDMETLIKQVQSALLSLANPR-----------------------
COAE_STRT1      LA-EKLPYASLVIDNNGNIDDLKKKVKGAIKDLANLV-----------------------
COAE_STRT2      LA-EKLPYASLVIDNNGNIDDLKKKVKGAIKDLANLV-----------------------
COAE_STRPN      LE-KKKDLASQVLDNNGNQNQLLNQVHILLEGGRQDDRD---------------------
COAE_STRR6      LE-KKKDLASQVLDNNGNQNQLLNQVHILLEGGRQDDRD---------------------
COAE_LACLA      LS-EKQKVADVILDNFGTIEALKKQIQRELARIEEQK-----------------------
COAE_CLOAB      LE-EKKKYVDFIIDNSGEFENTIKQIDRIMQSVSIMKGK---------------------
COAE_CLOPE      LE-RKKDYANIIIDNSGNLIKTKEQIDDLLEFFTLYQ-----------------------
COAE_CLOTE      LD-KKRELVDFIIDNSNTIEETRVQVEKLFQFINCL------------------------
COAE_BDEBA      IQ-FKEQQADFVLHNNRDEQHLLREVDRVLKWLEELKNQN--------------------
COAE_FUSNN      NE-ERIKKADVVIENNSNLEDLFKKVERFCETI---------------------------
COAE_CALS4      LE-EKIKYADFIINNSKDLRKTEEQVRLLWQRFDRRSYFD--------------------
COAE_AQUAE      IE-EKVKYADYVIDNSGSIEETYKQVKKVYEELTRDP-----------------------
COAE_LEPIC      LT-EKLKRADYILRNRGNIDSLREECKSLYSTLLGKML----------------------
COAE_LEPIN      LT-EKLKRADYILRNRGNIDSLREECKSLYSTLLGKML----------------------
COAE_BACFN      DE-EKCERASFVIIND-GEKPLIPQILELIAFLYQKIHYLCSAKNN--------------
COAE_BACFR      DE-EKCERASFVIIND-GEKPLIPQILELIAFLYQKIHYLCSAKNN--------------
COAE_BACTN      DE-VKRNHADFVIVND-DETPLIPQVLKFISLLSKNNHYLCSAKK---------------
COAE_PORGI      EQSLAKAGADHTVLNA-PPHLLVPQVVRIIETVRTKRPNPPDRL----------------
COAE_CHLCH      PE-KLAALADVVIDNNGTPEALYEKTKQLYEQLLQQAM-------LRR------------
COAE_PELLD      QE-MLVARADYVVNNDIGKTKLKEEAGRLYSVLVEAAASGPDCQSKRR------------
COAE_CHLTE      QE-KLVERAHYVIFNDGTLDELRSQVEQVYQSLLTVVE----------------------
COAE_SALRD      QE-ELRERADHVLENDGTLNDLRRKSAELYWAVTGGQ-----------------------
COAE_THET2      EE-EKRKRATWVLENTGSLEDLERALKAVLAELTGGAKGGRG------------------
COAE_THET8      EE-EKRKRATWVLENTGSLEDLERALKAVLAELTGGAKGGRG------------------
COAE_DEIRA      SE-EKRRRATIVLDNSGPLEALEGQLDAALRQLEIT------------------------
COAE_CAMJR      IE-EKLKKADFIIKNTNSYVDFRQECVKVIQEISKGKM----------------------
COAE_CAMJE      IE-EKLKKADFIIKNTNSYADFRQECVKVIQEISKGNM----------------------
COAE_HELPY      IE-QKRAMSDYIIDNSSSLKDLNKQVERFLKTLL--------------------------
COAE_HELPJ      IE-QKRAMSDYIIDNSSSLKDLNKQVERFLKTLL--------------------------
COAE_WOLSU      IK-EKVPMAHYILSNEGNLNDLTQEVERLIETIKKDFHV---------------------
COAE_HELHP      IE-NKCRLADDIINNEGDLRTLQHNAETYIQSLPCVDCVQSS------------------
COAE_SULDN      IE-EKKKRATWVIDNSGDLKHLQRECEEFVEKIKAKYLEKK-------------------
COAE_RICFE      QE-SKIAKADFAINSGVDMLDLEKQIEKLILVIARKL-----------------------
COAE_RICCN      QE-SKIAKADFAINSGVDMLDLEKQIAKLIKDLECRV-----------------------
COAE_RICBR      QE-SKIAKADFAINSGVDMLDLEKQINNLIANLECRV-----------------------
COAE_RICTY      QD-SKIAKADFAINSGVDMLDLEKQITKLIKNLECQV-----------------------
COAE_RICPR      QE-SKIAKADFSINSGVDMLDLEKQITKLIKDLECRV-----------------------
COAE_CHLAB      HE-EKMMHADIVIENNGTKEELRHKVEEYFYALKGAL-----------------------
COAE_CHLCV      NE-EKKMHADIVIENNGTKEELRHKVEEYFYALKGAL-----------------------
COAE_CHLFF      NE-EKMMHADIIIENNGTKEELRHKVEEYFYALKGAL-----------------------
COAE_CHLPN      VE-EKLAQADVVVENNGTKKELHQKIEEYFYALKGAL-----------------------
COAE_CHLTA      LE-EKILRADVVIENNGTKEEFRCKVKQCFKALKGTI-----------------------
COAE_CHLTR      LE-EKILRADVVIENNGTKEEFRRKVKQCFKALKGTI-----------------------
COAE_CHLMU      LE-EKILRADVVIENNGTKEEFRHKVKQCFKALKGTI-----------------------
COAE_PARUW      PL-EKAIRADYVVLNNGTLSELQQSLRELYQELKIYI-----------------------
COAE_BORBP      ---KDIFFKKNIINLKIINIINNKNYAYLEKEIEKKMQEIINYERFE-------------
COAE_BORBU      ---KDIFFEKNIINLKIINIINNKNYAYLEKEIEKKMQGIINYERFE-------------
COAE_MYCGE      ---EPNCKIDTIFNNDSIATAALKLIKLLETFLERNKCRCDCCHIQ--------------
COAE_MYCPN      ---DPTYPILTVINNSTVAECALHVTQFLESIAKSDKCHHGHYQTPK-------------
COAE_THEMA      ---EDIVPQGIVVANNSTLEDLEKKVEEVMKLVWEKRE----------------------
COAE_DESPS      LA-IKEARADFIINNDGLFAATYSQILFFVADRIEKKK----------------------
COAE_RHOBA      WK-RKQSASTRVISNNGTEEELRRLVESELASVLQSK-----------------------
COAE_FRATT      DK-EREKIADFVIDNTELTNQELESKLITTINEITNLTN---------------------
                            .                                               

COAE_TREDE      ---------------------
COAE_TREPA      ---------------------
COAE_EHRCJ      ---------------------
COAE_EHRCR      ---------------------
COAE_EHRRG      ---------------------
COAE_EHRRW      ---------------------
COAE_ANAMM      ASA------------------
COAE_WOLTR      ---------------------
COAE_WOLPM      ---------------------
COAE_BRUA2      ---------------------
COAE_BRUAB      ---------------------
COAE_BRUME      ---------------------
COAE_BRUSU      ---------------------
COAE_RHILO      ---------------------
COAE_RHOP2      ---------------------
COAE_RHOPA      ---------------------
COAE_RHOPB      ---------------------
COAE_NITWN      ---------------------
COAE_BRADU      ---------------------
COAE_CAUVC      ---------------------
COAE_RHIEC      ---------------------
COAE_AGRFC      ---------------------
COAE_RHIME      ---------------------
COAE_MAGSA      ---------------------
COAE_RHORT      ---------------------
COAE_RHOS4      ---------------------
COAE_RUEPO      ---------------------
COAE_JANSC      ---------------------
COAE_NOVAD      ---------------------
COAE_GLUOX      ---------------------
COAE_BARHE      ---------------------
COAE_BARQU      ---------------------
COAE_ZYMMO      ---------------------
COAE_GEOMG      ---------------------
COAE_GEOSL      ---------------------
COAE_ANADE      ---------------------
COAE_PELCD      ---------------------
COAE_MOOTA      ---------------------
COAE_LEIXX      ---------------------
COAE_SYMTH      GAGPCDGPGAAPEAERRGGDR
COAE_COREF      ---------------------
COAE_CORGL      ---------------------
COAE_CORJK      ---------------------
COAE_CORDI      ---------------------
COAE_STRAW      ---------------------
COAE_STRCO      ---------------------
COAE_THEFY      ---------------------
COAE_FRACC      DTAASGTDTAAPAG-------
COAE_CUTAK      ---------------------
COAE_BIFLO      ---------------------
COAE_SYNAS      REVG-----------------
COAE_DEHM1      ---------------------
COAE_DEHMC      ---------------------
COAE_AROAE      ---------------------
COAE_CHRVO      ---------------------
COAE_THIDA      ---------------------
COAE_NITMU      ---------------------
COAE_NITEU      ---------------------
COAE_BORBR      ---------------------
COAE_BORPA      ---------------------
COAE_BORPE      ---------------------
COAE_BORA1      ---------------------
COAE_BURMA      ---------------------
COAE_BURP1      ---------------------
COAE_BURPS      ---------------------
COAE_BURTA      ---------------------
COAE_BURL3      ---------------------
COAE_CUPPJ      ---------------------
COAE_RALSO      ---------------------
COAE_DECAR      ---------------------
COAE_METCA      ---------------------
COAE_RHOFT      ---------------------
COAE_NEIMA      ---------------------
COAE_NEIMB      ---------------------
COAE_NEIG1      ---------------------
COAE_BUCAI      Y--------------------
COAE_BUCAP      ---------------------
COAE_WIGBR      ---------------------
COAE_BLOPB      ---------------------
COAE_LEGPA      ---------------------
COAE_LEGPH      ---------------------
COAE_LEGPL      ---------------------
COAE_YERPS      ---------------------
COAE_YERPE      ---------------------
COAE_PECAS      ---------------------
COAE_SODGM      ---------------------
COAE_PHOLL      ---------------------
COAE_SALTY      ---------------------
COAE_SALTI      ---------------------
COAE_SALCH      ---------------------
COAE_SALPA      ---------------------
COAE_SHIBS      ---------------------
COAE_SHIDS      ---------------------
COAE_SHISS      ---------------------
COAE_ECOLI      ---------------------
COAE_ECO57      ---------------------
COAE_ECOL6      ---------------------
COAE_SHIFL      ---------------------
COAE_VIBVU      ---------------------
COAE_VIBVY      ---------------------
COAE_VIBPA      ---------------------
COAE_VIBCH      ---------------------
COAE_ALIF1      ---------------------
COAE_PHOPR      ---------------------
COAE_SHEON      ---------------------
COAE_HAEI8      ---------------------
COAE_HAEIN      ---------------------
COAE_PASMU      ---------------------
COAE_MANSM      ---------------------
COAE_HAEDU      ---------------------
COAE_IDILO      ---------------------
COAE_COLP3      ---------------------
COAE_PSE14      ---------------------
COAE_PSEU2      ---------------------
COAE_PSESM      ---------------------
COAE_PSEF5      ---------------------
COAE_PSEPF      ---------------------
COAE_PSEPK      ---------------------
COAE_PSEAE      ---------------------
COAE_HAHCH      ---------------------
COAE_PSEHT      ---------------------
COAE_ACIAD      ---------------------
COAE_PSYA2      ---------------------
COAE_PSYCK      ---------------------
COAE_NITOC      ---------------------
COAE_COXBU      ---------------------
COAE_SACD2      ---------------------
COAE_XANC8      ---------------------
COAE_XANCP      ---------------------
COAE_XANC5      ---------------------
COAE_XANOM      ---------------------
COAE_XANOR      ---------------------
COAE_XANAC      ---------------------
COAE_XYLFA      ---------------------
COAE_XYLFT      ---------------------
COAE_HYDCU      ---------------------
COAE_TRIV2      ---------------------
COAE_NOSS1      ---------------------
COAE_SYNY3      ---------------------
COAE_SYNP6      ---------------------
COAE_SYNE7      ---------------------
COAE_THEEB      ---------------------
COAE_SYNJA      ---------------------
COAE_SYNJB      ---------------------
COAE_GLOVI      ---------------------
COAE_PROM9      ---------------------
COAE_PROMP      ---------------------
COAE_PROMT      ---------------------
COAE_PROMA      ---------------------
COAE_SYNSC      ---------------------
COAE_PROMM      ---------------------
COAE_SYNPX      ---------------------
COAE_SYNS9      ---------------------
COAE_BACHK      ---------------------
COAE_BACAN      ---------------------
COAE_BACCZ      ---------------------
COAE_BACCR      ---------------------
COAE_BACC1      ---------------------
COAE_GEOKA      ---------------------
COAE_OCEIH      ---------------------
COAE_BACLD      ---------------------
COAE_BACSU      ---------------------
COAE_BACSK      ---------------------
COAE_BACHD      ---------------------
COAE_CARHZ      ---------------------
COAE_STAAS      ---------------------
COAE_STAAW      ---------------------
COAE_STAA3      ---------------------
COAE_STAAC      ---------------------
COAE_STAAM      ---------------------
COAE_STAAN      ---------------------
COAE_STAAR      ---------------------
COAE_STAAB      ---------------------
COAE_STAHJ      ---------------------
COAE_STAES      ---------------------
COAE_STAEQ      ---------------------
COAE_STAS1      ---------------------
COAE_ENTFA      ---------------------
COAE_LISMF      ---------------------
COAE_LISMO      ---------------------
COAE_LISIN      ---------------------
COAE_LACSS      ---------------------
COAE_LACPL      ---------------------
COAE_LACAC      ---------------------
COAE_LACJO      ---------------------
COAE_STRA1      ---------------------
COAE_STRA5      ---------------------
COAE_STRA3      ---------------------
COAE_STRMU      ---------------------
COAE_STRPM      ---------------------
COAE_STRP1      ---------------------
COAE_STRP3      ---------------------
COAE_STRP6      ---------------------
COAE_STRP8      ---------------------
COAE_STRT1      ---------------------
COAE_STRT2      ---------------------
COAE_STRPN      ---------------------
COAE_STRR6      ---------------------
COAE_LACLA      ---------------------
COAE_CLOAB      ---------------------
COAE_CLOPE      ---------------------
COAE_CLOTE      ---------------------
COAE_BDEBA      ---------------------
COAE_FUSNN      ---------------------
COAE_CALS4      ---------------------
COAE_AQUAE      ---------------------
COAE_LEPIC      ---------------------
COAE_LEPIN      ---------------------
COAE_BACFN      ---------------------
COAE_BACFR      ---------------------
COAE_BACTN      ---------------------
COAE_PORGI      ---------------------
COAE_CHLCH      ---------------------
COAE_PELLD      ---------------------
COAE_CHLTE      ---------------------
COAE_SALRD      ---------------------
COAE_THET2      ---------------------
COAE_THET8      ---------------------
COAE_DEIRA      ---------------------
COAE_CAMJR      ---------------------
COAE_CAMJE      ---------------------
COAE_HELPY      ---------------------
COAE_HELPJ      ---------------------
COAE_WOLSU      ---------------------
COAE_HELHP      ---------------------
COAE_SULDN      ---------------------
COAE_RICFE      ---------------------
COAE_RICCN      ---------------------
COAE_RICBR      ---------------------
COAE_RICTY      ---------------------
COAE_RICPR      ---------------------
COAE_CHLAB      ---------------------
COAE_CHLCV      ---------------------
COAE_CHLFF      ---------------------
COAE_CHLPN      ---------------------
COAE_CHLTA      ---------------------
COAE_CHLTR      ---------------------
COAE_CHLMU      ---------------------
COAE_PARUW      ---------------------
COAE_BORBP      ---------------------
COAE_BORBU      ---------------------
COAE_MYCGE      ---------------------
COAE_MYCPN      ---------------------
COAE_THEMA      ---------------------
COAE_DESPS      ---------------------
COAE_RHOBA      ---------------------
COAE_FRATT      ---------------------