CLUSTAL format seed alignment for MF_00377

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DNAA_TREDE       -----------------MSEWDYKIFWDEAVNQFKEELA---------------FSIFSM
DNAA_TREPA       -----------------MDAVGYEVFWNETLSQIRSEST---------------EAEFNM
DNAA_BORBU       -------------------MEKSKNIWSLILTEIKKELS---------------EEEFYV
DNAA_BACHD       -------------------MENIHDLWERALKSMEKKVS---------------KPSFET
DNAA_BACSU       -------------------MENILDLWNQALAQIEKKLS---------------KPSFET
DNAA_STAAM       --------------------MSEKEIWEKVLEIAQEKLS---------------AVSYST
DNAA_DEIRA       ---------------------MSQEIWADVLAYVRKNVS---------------DLEYTT
DNAA_THET8       --------------------MSHEAVWQHVLEHIRRSIT---------------EVEFHT
DNAA_STRCO       ---------------MADVPADLAAVWPRVLEQLLGEGRG--QG---------VESKDEH
DNAA_STRRE       ---------------MADVPADLAAVWPRVLEQLLGEGRG--QG---------VEAKDEH
DNAA_STRAQ       ---------------MADVPADLAAVWPRVLEQLLGEGQ---QG---------IEPKDKQ
DNAA_MICLU       ----------------MVADQAVLSSWRSVVGSLEDDAR--------------VSARLMG
DNAA_MYCAV       --------------MADDPGSSFTTVWNAVVSELNGEPVADAEP-NRTTLVTPLTPQQRA
DNAA_MYCPA       --------------MADDPGSSFTTVWNAVVSELNGEPVADGGAANRTTLVTPLTPQQRA
DNAA_MYCLE       --------------MADDLSLGFTTVWNAVVSELNGESNTDDEATNDSTLVTPLTPQQRA
DNAA_MYCTU       --------------MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQRA
DNAA_MYCSM       --------------MTADPDPPFVAVWNSVVAELNGDVNGDRQG---DPSLPVLTPQQRA
DNAA_PROMA       ---------------------MLEASWEKVQSSLKQNLS---------------KPSYET
DNAA_PROMP       -------------------MQAANPIWAEVQQLLQKNLS---------------KPSFET
DNAA_SYNY3       -------------------MVSCENLWQQALAILATQLT---------------KPAFDT
DNAA_STRPN       --------------------MKEKQFWNRILEFAQERLT---------------RSMYDF
DNAA_STRP1       ------------------MTENEQIFWNRVLELAQSQLK---------------QATYEF
DNAA_LACLA       ----------------MASLNENQKFWARVTELAQQSIG---------------KQAYDF
DNAA_BUCAI       ---------------------MSLCLWKQCLDRLQDELP---------------NTEFSM
DNAA_BUCAP       ---------------------MSLCLWKQCLDRLQSELP---------------STEFSM
DNAA_ECOLI       ---------------------MSLSLWQQCLARLQDELP---------------ATEFSM
DNAA_SALTY       ---------------------MSLSLWQQCLARLQDELP---------------ATEFSM
DNAA_SERMA       ---------------------MSLSLWQQCLARLQDELP---------------ATEFSM
DNAA_PROMI       ---------------------MSLSLWQHCLARLQDELP---------------ATEFSM
DNAA_VIBCH       ---------------------MSSSLWLQCLQRLQEELP---------------AAEFSM
DNAA_VIBHA       ---------------------MSSSLWLQCLQQLQEELP---------------ATEFSM
DNAA_PSEAE       ---------------------MSVELWQQCVDLLRDELP---------------SQQFNT
DNAA_PSEPK       ---------------------MSVELWQQCVELLRDELP---------------AQQFNT
DNAA_HAEIN       --------------------MNLSNLWQSCLLQLQDQVS---------------ASDLST
DNAA_PASMU       ------------------MKPDLSSLWQECLLQLQDQIS---------------LTDFST
DNAA_XYLFA       -----------------------MESWSRCLERLETEFP---------------PEDVHT
DNAA_NEIMA       --------------------MTLAEFWPLCLRRLHDMLP---------------HGQFAQ
DNAA_NEIMB       --------------------MTLAEFWPLCLRRLHDMLP---------------QGQFAQ
DNAA_CAUVC       MTMKGGVASQDFSAAIATACEPAANVWSKVCVALKRELG---------------DAAFGS
DNAA_RHIME       --------------------MRHDALFERVSARLKAQVG---------------PDVFAS
DNAA_RICPR       --------MSTNQIPLTDQGDNYVNVWSYVAQDLYNHYG---------------ETLYNS
DNAA_ZYMMO       -----------MQPPSQDWASLLPAAWSEARQILRKKCG---------------SRTFES
DNAA2_CHLMU      -----------------MLTCNDCSTWEQFVNYIKTRCS---------------KTAFEN
DNAA2_CHLTR      -----------------MLTCNDCSTWEQFVNYIKTRCS---------------KTAFEN
DNAA2_CHLPN      -----------------MLTCNECTTWEQFLNYVKTRCS---------------KTAFEN
DNAA_AQUAE       -----------------------------MELNALIKKI---------------ESVDSY
DNAA_THEMA       ---------------------------MKERILQEIKTR---------------VNRKSW
DNAA_HELPY       -----------------MDTNNNIEKEILALVKQNPKVS---------------LIEYEN
DNAA_HELPJ       -----------------MDTNNNIEKEILALVKQNPKVS---------------LIEYEN
DNAA_CAMJE       ------------------------MNPSQILENLKKELS---------------ENEYEN
DNAA1_CHLMU      -----------------------MRAWEEFLLLQEKEIG---------------TDTVNK
DNAA1_CHLTR      -----------------------MRAWEEFLLLQEKEIG---------------VDTVNK
DNAA1_CHLPN      -----------------------MRAWEEFLLLQEKEIG---------------TNTVDK
DNAA_ACHLA       -------------------MSPNSTLWQTILQDLEKLYN---------------EETYNE
DNAA_MYCCT       --------------------MNLNDILKELKLSLIANKN-------------IDESVYND
DNAA_SPICI       --------------------MNTKELWIEVKEILSRDES-------------VSPEIYNY
DNAA_MYCGE       -----------------------MEQFNAFKSLLKKHYE-------------KTIGFHDK
DNAA_MYCPN       -----------------------MEQFSAFKLLLKKQYE-------------TTLGFYDK
DNAA_UREPA       ------------------MANNYQTLYDSAIKRIPYDLI-----------------SDQA
                                                                             

DNAA_TREDE       WFLPSKYEKST--ENTVYLSVPSKFFRDQMIHNYKNGIEKKLFELSGKKISIDFIIKPNT
DNAA_TREPA       WFAHLFFIASF--ENAIEIAVPSDFFRIQFSQKYQEKLERKFLELSGHPIKLLFAVKKGT
DNAA_BORBU       WFENLCFLESI--GDNIKISTPNLFHKNQIEKRFTKKIKEILIKNGYNNIVIVFTNQPPK
DNAA_BACHD       WLKQTKANSIE--DSTIIITAPNEFARDWLEK-HYDELISETIDDLTGVRLYPKFVIPTS
DNAA_BACSU       WMKSTKAHSLQ--GDTLTITAPNEFARDWLES-RYLHLIADTIYELTGEELSIKFVIPQN
DNAA_STAAM       FLKDTELYTIK--DGEAIVLSSIPFNANWLNQ-QYAEIIQAILFDVVGYEVKPHFITTEE
DNAA_DEIRA       WFAPVKPLGVQ--EGSLLLGVRNSFTKDWFRD-HYLELLLAALRSLGAEHPQVEFQVLPA
DNAA_THET8       WFERIRPLGIR--DGVLELAVPTSFALDWIRR-HYAGLIQEALGLLGAQAPRFELRVVPG
DNAA_STRCO       WIRRCQPLALV--ADTALLAVPNEFAKGVLEG-RLAPIVSETLSRECGRPIRIAITVDDT
DNAA_STRRE       WIRRCQPLALV--ADTALLAVPNEFAKGVLEG-RLAPIVSETLSRECGRPIRIAITVDDS
DNAA_STRAQ       WIERCQPLALV--ADTALLAVPNEWGKRVLEG-RLAPLISETLTRECGRPIRIAITVDDS
DNAA_MICLU       FVYLAQPQGLI--GNTLLLAVPNETTRETLQGTQVADALTDALTQEFREEILLAISIDAN
DNAA_MYCAV       WLNLVRPLTIV--EGFALLSVPSSFVQNEIER-HLRAPITDALSRRLGQQIQLGVRIAPP
DNAA_MYCPA       WLNLVRPLTIV--EGFALLSVPSSFVQNEIER-HLRAPITDALSRRLGQQIQLGVRIAPP
DNAA_MYCLE       WLNLVQPLTII--EGFALLSVPSSFVQNEIER-HLRTPITDALSRRLGQQIQLGVRIAPP
DNAA_MYCTU       WLNLVQPLTIV--EGFALLSVPSSFVQNEIER-HLRAPITDALSRRLGHQIQLGVRIAPP
DNAA_MYCSM       WLKLVKPLVIA--EGFALLSVPTPFVQNEIER-HLREPIVTALSRKLGQRVELGVRIATP
DNAA_PROMA       WIRPTEFSGFK--NGELTLIAPNSFSSAWLKN-NYSQTIQETAEEIFGEPVTVHVKVKAN
DNAA_PROMP       WIRPAKFNCFE--NGLLTLITPNNFTSDWLRK-NYSETIEKAAEEICGHNVKVVFKSETN
DNAA_SYNY3       WIKASVLISLG--DGVATIQVENGFVLNHLQK-SYGPLLMEVLTDLTGQEITVKLITDGL
DNAA_STRPN       YAIQAELIKVE--ENVATIFLPRSEMEMVWEK-QLKDIIVVAGFEIYDAEITPHYIFTKP
DNAA_STRP1       FVHDARLLKVD--KHIATIYLDQM-KELFWEK-NLKDVILTAGFEVYNAQISVDYVFEED
DNAA_LACLA       FIEPAQLMSVE--QDTANILLDSGMKKDYWKK-Q-SDLITTAGFEVFGRMIDYELYANDE
DNAA_BUCAI       WIRSLKAKLN---NNILEIYAPNKFVLEWVKDKYLNHLKKILQDYCGTNSPLIKFEIYQI
DNAA_BUCAP       WIRSLKAKLN---NNILEIYAPNQFILDWVKDKYLIHFKKILQDFCGSNSPFIKFKVYQT
DNAA_ECOLI       WIRPLQAELS---DNTLALYAPNRFVLDWVRDKYLNNINGLLTSFCGADAPQLRFEVGTK
DNAA_SALTY       WIRPLQAELS---DNTLALYAPNRFVLDWVRDKYLNNINGLLNTFCGADAPQLRFEVGTK
DNAA_SERMA       WIRPLQAELS---DNTLALYAPNRFVLDWVRDKYLNNINGLLNDFCGTDAPLLRFEVGSK
DNAA_PROMI       WIRPLQAELS---DNTLALYAPNRFVLDWVREKYINNINALLVDFCGSDVPSLRFEVGNK
DNAA_VIBCH       WVRPLQAELN---DNTLTLFAPNRFVLDWVRDKYLNNINRLLMEFSGNDVPNLRFEVGSR
DNAA_VIBHA       WVRPLQAELN---DNTLTLFAPNRFVLDWVRDKYLNSINRLLQEYCGNDVPSLRFEVGSR
DNAA_PSEAE       WIRPLQVEAE---GDELRVYAPNRFVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSK
DNAA_PSEPK       WIRPLQVEAE---GDELRVYAPNRFVLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSR
DNAA_HAEIN       WLRPLQADVVA--DNHIVLYASNMFVKGWVETHYLAQIQQICQTLAQNPELRISLKEGVK
DNAA_PASMU       WLRPLQADFSV--QNTIVLYASNVFIKQKVDESYLAQLTKVAQELSGNAELVVQVKVGVK
DNAA_XYLFA       WLRPLQADQR---GDSVVLYAPNPFIIELVEERYLGRLRELLSYFSGIREVVLAIGSRPK
DNAA_NEIMA       WIAPLTVGEE---GGVWVVYGKNQFACNMLKSQFAGKIEAVREELAAGRSAFVFKPGEGV
DNAA_NEIMB       WIAPLTVGEE---GGVWVVYGKNQFACNMLKSQFAGKIEAVREELAAGRSAFVFKPGEGV
DNAA_CAUVC       WIAPAML--REAATGDVVLVTSTGIARDWIRRSAWRRIGELWAAHDA----------TGR
DNAA_RHIME       WFGRLKL--HSVSKSVVRLSVPTTFLKSWINNRYLDLITTLVQQEDSEILKVEILVRTAT
DNAA_RICPR       WFSKVNF--IESSLNTVILCAPTNFIRDWIKSKYAMVILQLFQHYNNAIKSIEII--TKE
DNAA_ZYMMO       WLKSLMLADFDSQKKIIRLACPSEFMANWISSHLSDELLLAWRTVWPGIAEVKVS--VRN
DNAA2_CHLMU      WIAPIQVLEES--REKIRLEIPNIFVQSYLLDNYKKDLCSFVPLDAEGNPALEFVVSEIK
DNAA2_CHLTR      WIAPIQVLEES--SEKIRLEIPNIFVQSYLLDNYKKDLCSFVPLDAEGNPALEFVVAEIK
DNAA2_CHLPN      WISPIQVLEET--QEKIRLEVPNIFVQNYLLDNYKRDLCSFVPLDVHGEPALEFVVAEHK
DNAA_AQUAE       AREFLKKFEIKQEKGKFLFIAPGEDYREWLETIVNTFLEEEVRKLIEVKEKEE-------
DNAA_THEMA       ELWFSSFDVKSIEGNKVVFSVGNLFIKEWLEKKYYSVLSKAVKVVLGNDATFEITYEAFE
DNAA_HELPY       YFSQLKYNPNASKSDIAFFYAPNQVLCTTITAKYGALLKEILSQNKVGMHLAHSVDVRIE
DNAA_HELPJ       YLSQLKYNPNASKSDIAFFYAPNKFLCTTITAKYGALLKEILSQNKVGMHLAHSVDVRIE
DNAA_CAMJE       YLSNLKFNEKQSKADLLVFNAPNELMAKFIQTKYGKKIAHFYEVQSGNKAIINIQAQSAK
DNAA1_CHLMU      WLRSLKVLCFD--ACNLYLEAKDSFQVTWFEEHIRHKVKANLINNNGKPIRVRVTSLDKS
DNAA1_CHLTR      WLRSLKVLCFD--ACNLYLEAKDSFQVTWFEEHIRHKVKASLINNNGKPIRVRVTSLDKS
DNAA1_CHLPN      WLRSLKVLCFD--ACNLYLEAQDSFQITWFEEHIRHKVKSGLVNNNNKPIRVHVTSVDKA
DNAA_ACHLA       LFLPVTSTFKD-QNGLLTMVVANEFLKNRINKLYIAKINELATKYSSTPVRLKFVSQEEV
DNAA_MYCCT       YIKTINIYKKDLSNYVVVVKSQFGLLAIKQFRPTIENEIKKILKQPVNISFTYEQEYQKQ
DNAA_SPICI       YISDTNLYTVSDNNCLITTKSE---IAIGVFEAGLNEKIKNILKKLTGIQYNISFELEKN
DNAA_MYCGE       YIKDINRFVFKNNVLLILLENE-----FARNSLNDNSEIIHLAESLYEGIKSVNFVNEQD
DNAA_MYCPN       YIKNLKRFALKNNVLFVIVDNE-----FARETLNSNPDIVGLASKLYDDIRAVRFVNEQD
DNAA_UREPA       YAILQNAKTHKVCDGVLYIIVANAFEKSIINGNFINIISKYLSEEFKKENIVNFEFIIDN
                                                                             

DNAA_TREDE       SEDLSKAEN---------------------------------------------------
DNAA_TREPA       PHGNTAPPK---------------------------------------------------
DNAA_BORBU       THSNKQETKNPALNETFSK-----------------------------------------
DNAA_BACHD       ----QLDEPFVEQELK--------------------------------------------
DNAA_BACSU       ----QDVEDFMPKP----------------------------------------------
DNAA_STAAM       LANYSNNETATPKETT--------------------------------------------
DNAA_DEIRA       AQDALLLPNDPPPAPE--------------------------------------------
DNAA_THET8       VVVQEDIF----------------------------------------------------
DNAA_STRCO       AGEPA-GPAPQAPQSPPSRPQHRYEEPELPAPGQGGREEYRDRDE--------YEGYGRN
DNAA_STRRE       AGEPP-PAAPPAQQTP----KPRYEEPELPSGPYEGYGRHRGGADQLPGTEPRPEQLPSA
DNAA_STRAQ       AGEPPSPPAPPMHQSHQSQQGHRYPAQQRDDAPRGDAYDGYGHRP-----------SD--
DNAA_MICLU       LQPPR-TPSSEARRSSLAGGPSGAAAPDVELPPAATAATSRRAVA---------------
DNAA_MYCAV       PDDVEDALIPSAEPFP---------DTDADLSARRRTDSRASGER---------------
DNAA_MYCPA       PDDVEDAPIPPAEPFP---------DTDAALSADDGADGEPVENG---------------
DNAA_MYCLE       STDHIDDNSSSADVLL---------TDDCGTDTDENY-------G---------------
DNAA_MYCTU       ATDEADDTTVPPSENP---------ATTSPDTTTDND--EIDDSA---------------
DNAA_MYCSM       TDEPEDAPDSFADSPA---------PASVPAGPADADEID--DDR---------------
DNAA_PROMA       AESSDEHYSSAPITPP--------------------------------------------
DNAA_PROMP       INNNSNSSDSVSQQNI--------------------------------------------
DNAA_SYNY3       EPHSLIGQESS-------------------------------------------------
DNAA_STRPN       QDTTSSQVEEATNLTL--------------------------------------------
DNAA_STRP1       LMIEQNQ----TKINQ--------------------------------------------
DNAA_LACLA       LTELELHRLNNQSSIE--------------------------------------------
DNAA_BUCAI       YKENKLKKNIE-------------------------------------------------
DNAA_BUCAP       SKEKKFKKNIL-------------------------------------------------
DNAA_ECOLI       PVTQTPQAAVTSNVAAPA------------------------------------------
DNAA_SALTY       PVTQTLKTPVH-NVVAPA------------------------------------------
DNAA_SERMA       PITQVISQTVT---ASVS------------------------------------------
DNAA_PROMI       PVSARTTESVP---KTVT------------------------------------------
DNAA_VIBCH       PVVAPKPAPVRTAADVAA------------------------------------------
DNAA_VIBHA       RVAAPKPAPTRTPADVAA------------------------------------------
DNAA_PSEAE       RSRTPRAAIVPSQTHVAPPPPVA-------------------------------------
DNAA_PSEPK       RSSAPRAAPNAPVSAAVAASLAQ-------------------------------------
DNAA_HAEIN       PAPKIVESTPNTSLRSES------------------------------------------
DNAA_PASMU       PEPKPAQPSALPTHHN--------------------------------------------
DNAA_XYLFA       TTELPVPVDTT-------------------------------------------------
DNAA_NEIMA       CYEMAAVEGAVEPAEPSLHAGSEE-----------------------------------M
DNAA_NEIMB       RYEMAAVEGAVEPAEPSLHAVSEG-----------------------------------M
DNAA_CAUVC       RIDLKSRLEFEAAAGAYV------------------------------------------
DNAA_RHIME       RGHRPTAPEESVAAAAEA------------------------------------------
DNAA_RICPR       ------------------------------------------------------------
DNAA_ZYMMO       PESQPLLLDVTEIELPLG------------------------------------------
DNAA2_CHLMU      RSSPQIAASVTKPA----------------------------------------------
DNAA2_CHLTR      RSSPLVTPSIAKPA----------------------------------------------
DNAA2_CHLPN      KPSAPVASQKESNEGI--------------------------------------------
DNAA_AQUAE       ------------------------------------------------------------
DNAA_THEMA       PHSS--------------------------------------------------------
DNAA_HELPY       VAPKI-------------------------------------------------------
DNAA_HELPJ       VAPKI-------------------------------------------------------
DNAA_CAMJE       QSNK--------------------------------------------------------
DNAA1_CHLMU      TPFK--------------------------------------------------------
DNAA1_CHLTR      TPFK--------------------------------------------------------
DNAA1_CHLPN      APFYK-------------------------------------------------------
DNAA_ACHLA       IEEPVADRKLTIDYR---------------------------------------------
DNAA_MYCCT       LEKTESINK---------------------------------------------------
DNAA_SPICI       INKQASVIS---------------------------------------------------
DNAA_MYCGE       FFFNLAKLE---------------------------------------------------
DNAA_MYCPN       FFINLAKLE---------------------------------------------------
DNAA_UREPA       EKLLINSNFLIKETNI--------------------------------------------
                                                                             

DNAA_TREDE       ------EGGNDKKEDAA-------------------------------------------
DNAA_TREPA       ------HVHTYLE-----------------------------------------------
DNAA_BORBU       -FDKLKEKTTSKEAIQN-------------------------------------------
DNAA_BACHD       ------------------------------------------------------------
DNAA_BACSU       ------------------------------------------------------------
DNAA_STAAM       ------------------------------------------------------------
DNAA_DEIRA       -------AAAPTPKTKA-------------------------------------------
DNAA_THET8       ------------------------------------------------------------
DNAA_STRCO       RADQLPTARPAYPQEYQ-RPEPGSWPRPAQQDDYGWQQQRLGFPERDPYASPNQEPYGQE
DNAA_STRRE       RPDQLPTVRPAYPSEYH-RPEPGAWPRPAQ-DEYGWQQPRLGFPERDPYASPS-------
DNAA_STRAQ       --DGMPTRRPAYPDYQQQRPEPGAWPRTQE--DLSWQQPRHGGYQDREQPSGE-------
DNAA_MICLU       --EELPGFRIEPPADVV-------------------------------------------
DNAA_MYCAV       --GAVTNTQPGWTNYFT-------------------------------------------
DNAA_MYCPA       --EPVTDTQPGWPNYFT-------------------------------------------
DNAA_MYCLE       --EPLTGEYQGLPTYFT-------------------------------------------
DNAA_MYCTU       --AARGDNQHSWPSYFT-------------------------------------------
DNAA_MYCSM       --DARVNAQESWPKYFS-------------------------------------------
DNAA_PROMA       --------LEASPGSVD-------------------------------------------
DNAA_PROMP       --------NSQSKSFSI-------------------------------------------
DNAA_SYNY3       ------------------------------------------------------------
DNAA_STRPN       ------------------------------------------------------------
DNAA_STRP1       ------------------------------------------------------------
DNAA_LACLA       ------------------------------------------------------------
DNAA_BUCAI       ------------NNNNN-------------------------------------------
DNAA_BUCAP       ------------QKIQN-------------------------------------------
DNAA_ECOLI       ------QVAQTQPQRAA-------------------------------------------
DNAA_SALTY       ------QTTTAQPQRVA-------------------------------------------
DNAA_SERMA       ------SAPAAPAARTA-------------------------------------------
DNAA_PROMI       ------HPAVNSTPTNS-------------------------------------------
DNAA_VIBCH       ------ESSAPAQLAQR-------------------------------------------
DNAA_VIBHA       ------ESSAPAQLQAR-------------------------------------------
DNAA_PSEAE       PPPAPVQPVSAAPVVVP-------------------------------------------
DNAA_PSEPK       TQAHKTAPAAAVEPVAV-------------------------------------------
DNAA_HAEIN       ------------------------------------------------------------
DNAA_PASMU       ------------------------------------------------------------
DNAA_XYLFA       --------------GRL-------------------------------------------
DNAA_NEIMA       PVQEVLLDELPSEEPVK-------------------------------------------
DNAA_NEIMB       PVQEVLLDELPSEEPVK-------------------------------------------
DNAA_CAUVC       ---EATPKAVAAEPIEI-------------------------------------------
DNAA_RHIME       ---AVVPPSRRSAAPTV-------------------------------------------
DNAA_RICPR       --------LPGTTQAVI-------------------------------------------
DNAA_ZYMMO       ---DQPRPLPKKPAKKK-------------------------------------------
DNAA2_CHLMU      ------------------------------------------------------------
DNAA2_CHLTR      ------------------------------------------------------------
DNAA2_CHLPN      ------------------------------------------------------------
DNAA_AQUAE       ------------------------------------------------------------
DNAA_THEMA       ------------------------------------------------------------
DNAA_HELPY       ------------------------------------------------------------
DNAA_HELPJ       ------------------------------------------------------------
DNAA_CAMJE       ------------------------------------------------------------
DNAA1_CHLMU      ------------------------------------------------------------
DNAA1_CHLTR      ------------------------------------------------------------
DNAA1_CHLPN      ------------------------------------------------------------
DNAA_ACHLA       ------------------------------------------------------------
DNAA_MYCCT       ------------------------------------------------------------
DNAA_SPICI       ------------------------------------------------------------
DNAA_MYCGE       ------------------------------------------------------------
DNAA_MYCPN       ------------------------------------------------------------
DNAA_UREPA       ------------------------------------------------------------
                                                                             

DNAA_TREDE       ------------------------------------------------------------
DNAA_TREPA       ------------------------------------------------------------
DNAA_BORBU       ------------------------------------------------------------
DNAA_BACHD       ------------------------------------------------------------
DNAA_BACSU       ------------------------------------------------------------
DNAA_STAAM       ------------------------------------------------------------
DNAA_DEIRA       ------------------------------------------------------------
DNAA_THET8       ------------------------------------------------------------
DNAA_STRCO       PPPPYSHENRTSYQQDYRPQPPERPSYDAQRGDYEQARGEYEQPRGDYDKPRGDYDQQRG
DNAA_STRRE       -----SQDAYGSPSQDYRPQGMDRPPYEQQRGDYDTPRAEYEPARPDYDSARPDYESARP
DNAA_STRAQ       -PYRESESYRERENEQYREQAPEQWRQPYGTGRPQQPQHDYRSGPP----EHQGYEQQRP
DNAA_MICLU       ------------------------------------------------------------
DNAA_MYCAV       ------------------------------------------------------------
DNAA_MYCPA       ------------------------------------------------------------
DNAA_MYCLE       ------------------------------------------------------------
DNAA_MYCTU       ------------------------------------------------------------
DNAA_MYCSM       ------------------------------------------------------------
DNAA_PROMA       ------------------------------------------------------------
DNAA_PROMP       ------------------------------------------------------------
DNAA_SYNY3       ------------------------------------------------------------
DNAA_STRPN       ------------------------------------------------------------
DNAA_STRP1       ------------------------------------------------------------
DNAA_LACLA       ------------------------------------------------------------
DNAA_BUCAI       ------------------------------------------------------------
DNAA_BUCAP       ------------------------------------------------------------
DNAA_ECOLI       ------------------------------------------------------------
DNAA_SALTY       ------------------------------------------------------------
DNAA_SERMA       ------------------------------------------------------------
DNAA_PROMI       ------------------------------------------------------------
DNAA_VIBCH       ------------------------------------------------------------
DNAA_VIBHA       ------------------------------------------------------------
DNAA_PSEAE       ------------------------------------------------------------
DNAA_PSEPK       ------------------------------------------------------------
DNAA_HAEIN       ------------------------------------------------------------
DNAA_PASMU       ------------------------------------------------------------
DNAA_XYLFA       ------------------------------------------------------------
DNAA_NEIMA       ------------------------------------------------------------
DNAA_NEIMB       ------------------------------------------------------------
DNAA_CAUVC       ------------------------------------------------------------
DNAA_RHIME       ------------------------------------------------------------
DNAA_RICPR       ------------------------------------------------------------
DNAA_ZYMMO       ------------------------------------------------------------
DNAA2_CHLMU      ------------------------------------------------------------
DNAA2_CHLTR      ------------------------------------------------------------
DNAA2_CHLPN      ------------------------------------------------------------
DNAA_AQUAE       ------------------------------------------------------------
DNAA_THEMA       ------------------------------------------------------------
DNAA_HELPY       ------------------------------------------------------------
DNAA_HELPJ       ------------------------------------------------------------
DNAA_CAMJE       ------------------------------------------------------------
DNAA1_CHLMU      ------------------------------------------------------------
DNAA1_CHLTR      ------------------------------------------------------------
DNAA1_CHLPN      ------------------------------------------------------------
DNAA_ACHLA       ------------------------------------------------------------
DNAA_MYCCT       ------------------------------------------------------------
DNAA_SPICI       ------------------------------------------------------------
DNAA_MYCGE       ------------------------------------------------------------
DNAA_MYCPN       ------------------------------------------------------------
DNAA_UREPA       ------------------------------------------------------------
                                                                             

DNAA_TREDE       -----------------------------------KPSSAESKKKSVKTEGGR-------
DNAA_TREPA       ------------------------------------------KNSPAEVPSKK-------
DNAA_BORBU       -----------------------------------IQDRIKMYIKKEEEEPTN-------
DNAA_BACHD       ---------------------------------------KPMKQPPAQNGE---------
DNAA_BACSU       ---------------------------------------QVKKAVKEDTSD---------
DNAA_STAAM       ---------------------------------------KPSTETTEDNHV---------
DNAA_DEIRA       -----------------------------------------APTPPPSTPG---------
DNAA_THET8       -----------------------------------------QAAPAEAP-----------
DNAA_STRCO       DYDQRG-PRRDLPEPPPGSGHVHRGGPVGPGPATGAPGPLAAQPAPATGPG---------
DNAA_STRRE       EYDQRDPVRRELPEPP-----AHRGGPGADMPSAGAPGPPAAQPAPASGPG---------
DNAA_STRAQ       DRQDQG-----QG--P------RQGGHGPGRTGGSVPGPMGAQPAPAPGPG---------
DNAA_MICLU       ------------------------------PAANAAPNGNGKPTPAPPSTS---------
DNAA_MYCAV       -----------------------------------------ERPHAIDPAV---------
DNAA_MYCPA       -----------------------------------------ERPHAIDPAV---------
DNAA_MYCLE       -----------------------------------------ERPHHTESTV---------
DNAA_MYCTU       -----------------------------------------ERPHNTDSAT---------
DNAA_MYCSM       -----------------------------------------RPEPDTSSDD---------
DNAA_PROMA       -----------------------------------------SSGSSLRLSK---------
DNAA_PROMP       -----------------------------------------NQSNNLINRS---------
DNAA_SYNY3       --------------------------------------------LPMETTP---------
DNAA_STRPN       ----------------------------------------YNYSPKLVSIP---------
DNAA_STRP1       ----------------------------------------KPKQQALNSLP---------
DNAA_LACLA       ----------------------------------------EQPRSTAKPAS---------
DNAA_BUCAI       ----------------------------------------KNEKLIWSNIPKFK------
DNAA_BUCAP       ----------------------------------------LNAKPIWDKIPIFK------
DNAA_ECOLI       ----------------------------------------PSTRSGWDNVPAP-------
DNAA_SALTY       ----------------------------------------PAARSGWDNVPAP-------
DNAA_SERMA       ----------------------------------------APSRPSWDNAAAQ-------
DNAA_PROMI       ----------------------------------------QPVRPSWDNQPQSQL-----
DNAA_VIBCH       ----------------------------------------KPIHKTWDDDS--AA-----
DNAA_VIBHA       ----------------------------------------KPVHKTWDDDAQ-VI-----
DNAA_PSEAE       ----------------------------------------REELPPVTTAPSVSSDPYEP
DNAA_PSEPK       ----------------------------------------AAAEPVLVETSSRDS-----
DNAA_HAEIN       -----------------------------------------AVDFQAESSA---------
DNAA_PASMU       ---------------------------------------------KEENKP---------
DNAA_XYLFA       ----------------------------------------SS------------------
DNAA_NEIMA       ----------------------------------------PAASKTAADILAERMRNLPH
DNAA_NEIMB       ----------------------------------------PAASKTAADILAERMKNLPH
DNAA_CAUVC       ----------------------------------------VLPVSTDAPTVVAPS-----
DNAA_RHIME       ----------------------------------------AIAAAAVAAAPARPV-----
DNAA_RICPR       ----------------------------------------ESPTKTFADIGNSAL-----
DNAA_ZYMMO       ----------------------------------------QSVPATPKSTSPEKK-----
DNAA2_CHLMU      ---------------------------------------------VEVSEENK-------
DNAA2_CHLTR      ---------------------------------------------TEVSEENK-------
DNAA2_CHLPN      ---------------------------------------------SEVFEETK-------
DNAA_AQUAE       ------------------------------------------------------------
DNAA_THEMA       --------------------------------------------YSEPLV----------
DNAA_HELPY       -------------------------------------------QINAQSN----------
DNAA_HELPJ       -------------------------------------------QVNAQSN----------
DNAA_CAMJE       --------------------------------------------STKIDI----------
DNAA1_CHLMU      -------------------------------------------ESQIQQEK---------
DNAA1_CHLTR      -------------------------------------------ETQIQQEK---------
DNAA1_CHLPN      -------------------------------------------EKQMQQEK---------
DNAA_ACHLA       ------------------------------------------------------------
DNAA_MYCCT       -------------------------------------------DHSDIIS----------
DNAA_SPICI       -------------------------------------------KIDTLTE----------
DNAA_MYCGE       -------------------------------------------ENSRDTL----------
DNAA_MYCPN       -------------------------------------------EDNRETL----------
DNAA_UREPA       ------------------------------------------------------------
                                                                             

DNAA_TREDE       --------------------------------GQHPDLRPEYNFEDFVVGPNNNFGVNAA
DNAA_TREPA       --------------------------------SFHPDLNRDYTFENFVSGEETKFSHSAA
DNAA_BORBU       --------------------------------FKNPFLKKRYTFENFIIGPNNKLAYNAS
DNAA_BACHD       --------------------------------MPNNMLNDKYTFDTFVIGSGNRFAHAAS
DNAA_BACSU       --------------------------------FPQNMLNPKYTFDTFVIGSGNRFAHAAS
DNAA_STAAM       --------------------------------LGREQFNAHNTFDTFVIGPGNRFPHAAS
DNAA_DEIRA       --------------------------------DNRKTLNPKYTFENFVVGPNNNLAHAAA
DNAA_THET8       ----------------------------------RPKLNPKYTFENFVVGPNNSMAHAAA
DNAA_STRCO       --------------------------------EPTARLNPKYLFDTFVIGASNRFAHAAA
DNAA_STRRE       --------------------------------EPTARLNPKYLFDTFVIGASNRFAHAAA
DNAA_STRAQ       --------------------------------EPHARLNPKYLFDTFVIGASNRFAHAAA
DNAA_MICLU       --------------------------------AETSRLNDRYHFETFVIGSSNRFAHAAA
DNAA_MYCAV       --------------------------------AAGTSLNRRYTFDTFVIGASNRFAHAAV
DNAA_MYCPA       --------------------------------AAGTSLNRRYTFDTFVIGASNRFAHAAA
DNAA_MYCLE       --------------------------------TGGTSLNRRYTFETFVIGASNRFAHAAA
DNAA_MYCTU       --------------------------------AGVTSLNRRYTFDTFVIGASNRFAHAAA
DNAA_MYCSM       --------------------------------SNAVNLNRRYTFDTFVIGASNRFAHAAT
DNAA_PROMA       --------------------------------KTLPLLNLRYVFNRFVVGPNSRMAHAAA
DNAA_PROMP       --------------------------------KKSHSLNTRYVFKRFVVGPNSRMAHAAA
DNAA_SYNY3       --------------------------------KNATALNGKYTFSRFVVGPTNRMAHAAS
DNAA_STRPN       --------------------------------YSDTGLKEKYTFDNFIQGDGNVWAVSAA
DNAA_STRP1       --------------------------------TVTSDLNSKYSFENFIQGDENRWAVAAS
DNAA_LACLA       --------------------------------PLVSGLNEKYNFENFVQGPGNRWTLAAA
DNAA_BUCAI       ------------------------------NLSYRSNINKRYNFQNFVEGKSNQLARSAA
DNAA_BUCAP       ------------------------------KSSHRSNINKKHSFENFIEGKSNQLARAAA
DNAA_ECOLI       -----------------------------AEPTYRSNVNVKHTFDNFVEGKSNQLARAAA
DNAA_SALTY       -----------------------------AEPTYRSNVNVKHTFDNFVEGKSNQLARAAA
DNAA_SERMA       -----------------------------PELSYRSNVNPKHTFDNFVEGKSNQLARAAA
DNAA_PROMI       -----------------------------PELNYRSNVNPKHKFDNFVEGKSNQLARAAA
DNAA_VIBCH       -----------------------------ADITHRSNVNPKHKFNNFVEGKSNQLGLAAA
DNAA_VIBHA       -----------------------------ADINHRSNVNPKHKFNNFVEGKSNQLGLAAA
DNAA_PSEAE       EEPSIDPLAAAMPAGAAPAVRTERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAA
DNAA_PSEPK       -FDAMAEPAAAPPSGGGR--AEQRTVQVEGALKHTSYLNRTFTFDTFVEGKSNQLARAAA
DNAA_HAEIN       ------------------------------SVKFESHLNTKHLFDNFVEGKSNQLARAVG
DNAA_PASMU       ------------------------------QTVIRSYLNPKHVFENFVEGKSNQLARAVA
DNAA_XYLFA       ------------------------------TVPFNGNLDTHYNFDNFVEGRSNQLARAAA
DNAA_NEIMA       EPRQAAGSASRPESAAVAKARTDAQRDAEEARYEQTNLSPDYTFDTLVEGKGNRLAAAAA
DNAA_NEIMB       EPRQAAGSASRPESVAVAKARTDVQRDAEEARYEQTNLSPDYTFDTLVEGKGNRLAAAAA
DNAA_CAUVC       -----------------------------AKSPRTQGLQERFTFETFVPGPANEFAHAVA
DNAA_RHIME       -----------------------------QAPLFGSPLDQRYGFDSFVEGSSNRVALAAA
DNAA_RICPR       -----------------------------NSENIVSTLDVRFTFDNFVVGVPNELAYAAA
DNAA_ZYMMO       -----------------------------AEGEDQNQFEERYNFDNFVVGKANDLAYRAA
DNAA2_CHLMU      --------------------------------DFQLKLNGAYRFDNFIEGPSNQFVKSAA
DNAA2_CHLTR      --------------------------------DFQLKLNGAYRFDNFIEGPSNQFVKSAA
DNAA2_CHLPN      --------------------------------DFELKLNLSYRFDNFIEGPSNQFVKSAA
DNAA_AQUAE       ----------------------------KKKVEIKDFLNPKYTLENFIVGEGNRLAYEVV
DNAA_THEMA       ----------------------------KKRAVLLTPLNPDYTFENFVVGPGNSFAYHAA
DNAA_HELPY       ----------------------------INYKAIKTSVKDSYTFENFVVGSCNNTVYEIA
DNAA_HELPJ       ----------------------------INYKATKTSVKDSYTFENFVVGSCNNTVYEIA
DNAA_CAMJE       ----------------------------AHIKAQSTILNPSFTFESFVVGDSNKYAYGAC
DNAA1_CHLMU      ---------------------------TAYFTMQYGDIDPQMSFANFLVTPENDLPVRIL
DNAA1_CHLTR      ---------------------------TAYFTMKYGDIDPNMSFANFLVTPENDLPVRIL
DNAA1_CHLPN      ---------------------------TAYFTMHYGSVNPEMTFSNFLVTPENDLPFRVL
DNAA_ACHLA       ----------------------------------QGNLNSTYTFDSFVVGKSNMFAFRMA
DNAA_MYCCT       --------------------------------KKNKKVNEN-TFENFVIGSSNEQAFIAV
DNAA_SPICI       --------------------------------NNNLAYYENYTFENFVRGDSNHEAMQAA
DNAA_MYCGE       --------------------------------YQNSGLSKNYTFQNFVISEGNKRAYEAG
DNAA_MYCPN       --------------------------------YQSSGLSKNFTFKNFVVGDGNRRVYEAG
DNAA_UREPA       -----------------------------KNRFNFSDELLRYNFNNLVISNFNQKAIKAI
                                                            :  ::    .       

DNAA_TREDE       IAVSTNPGS----AYNPFLIYGGVGLGKTHLMQAIGNKIWD-T-TKLKVIYVTAENFTNE
DNAA_TREPA       ISVSKNPGT----SYNPLLIYGGVGLGKTHLMQAIGHEIYK-T-TDLNVIYVTAENFGNE
DNAA_BORBU       LSISKNPGK----KYNPCLIYGGVGLGKTHLLQSIGNKTEELH-HNLKILYVTAENFLNE
DNAA_BACHD       LAVAEAPAK----AYNPLFIYGGVGLGKTHLMHAIGHYVMDHN-PNAKVVYLSSEKFTNE
DNAA_BACSU       LAVAEAPAK----AYNPLFIYGGVGLGKTHLMHAIGHYVIDHN-PSAKVVYLSSEKFTNE
DNAA_STAAM       LAVAEAPAK----AYNPLFIYGGVGLGKTHLMHAIGHHVLDNN-PDAKVIYTSSEKFTNE
DNAA_DEIRA       LAVAESPGK----AYNPLFIYGDVGLGKTHLMHAVGHYLAERF-PEKRIEYVSTETFTNE
DNAA_THET8       VAVAESPGR----AYNPLFIYGGVGLGKTHLMHAVGHSVAKRF-PHLRIEYVSTETFTNE
DNAA_STRCO       VAVAEAPAK----AYNPLFIYGESGLGKTHLLHAIGHYARSLY-PGTRVRYVSSEEFTNE
DNAA_STRRE       VAVAEAPAK----AYNPLFIYGESGLGKTHLLHAIGHYARSLY-PGTRVRYVSSEEFTNE
DNAA_STRAQ       VAVAEAPAK----AYNPLFIYGESGLGKTHLLHAIGHYARSLY-PGTRVRYVSSEEFTNE
DNAA_MICLU       NAVAEAPAK----AYNPLFIYGESGLGKTHLLHAIGHYARRLY-PGLRVRYVNSEEFTND
DNAA_MYCAV       LAIAEAPAR----AYNPLFIWGESGLGKTHLLHAAGNYAQRFF-PGMRVKYVSTEEFTND
DNAA_MYCPA       LAIAEAPAR----AYNPLFIWGESGLGKTHLLHAAGNYAQRLF-PGMRVKYVSTEEFTND
DNAA_MYCLE       LAIAEAPAR----AYNPLFIWGESGLGKTHLLHAAGNYAQRLF-PGMRVKYVSTEEFTND
DNAA_MYCTU       LAIAEAPAR----AYNPLFIWGESGLGKTHLLHAAGNYAQRLF-PGMRVKYVSTEEFTND
DNAA_MYCSM       LAIAEAPAR----AYNPLFIWGESGLGKTHLLHAAGNYAQRLF-PGMRVKYVSTEEFTND
DNAA_PROMA       MAVAESPGR----EFNPLFICGGVGLGKTHLMQAIGHYRLEID-PGAKVSYVSTETFTND
DNAA_PROMP       LAVAESPGR----EFNPLFICGGVGLGKTHLMQAVGHYRVEID-PDAKVLYVSTETFSSD
DNAA_SYNY3       LAVAESPGR----EFNPLFLCGGVGLGKTHLMQAIAHYRLEMY-PNAKVYYVSTERFTND
DNAA_STRPN       LAVSEDLAL----TYNPLFIYGGPGLGKTHLLNAIGNEILKNI-PNARVKYIPAESFIND
DNAA_STRP1       IAVANTPGT----TYNPLFIWGGPGLGKTHLLNAIGNSVLLEN-PNARIKYITAENFINE
DNAA_LACLA       IAVADKPGD----TYNPLFIYGGAGLGKTHLMHAIGNQILTDN-PTARIKYVSSENFVND
DNAA_BUCAI       FQAARNPGN----SYNPLFLYGATGLGKTHLLHAIGNEILSYK-YDIKIIFMNSECFVQD
DNAA_BUCAP       SQVAKNPGN----SYNPLFLYGGTGLGKTHLLHAIGNGILAYK-YNVKIIYMHSERFVQD
DNAA_ECOLI       RQVADNPGG----AYNPLFLYGGTGLGKTHLLHAVGNGIMARK-PNAKVVYMHSERFVQD
DNAA_SALTY       RQVADNPGG----AYNPLFLYGGTGLGKTHLLHAVGNGIMARK-PNAKVVYMHSERFVQD
DNAA_SERMA       RQVADNPGG----AYNPLFLYGGTGLGKTHLLHAVGNGIMARK-ANAKVVYMHSERFVQD
DNAA_PROMI       RQVADNPGG----AYNPLFLYGGTGLGKTHLLHAVGNSIMERK-ANAKVVYMHSERFVQD
DNAA_VIBCH       RQVSDNPGA----AYNPLFLYGGTGLGKTHLLHAVGNAIVDNN-PNAKVVYMHSERFVQD
DNAA_VIBHA       RQVSDNPGA----AYNPLFLYGGTGLGKTHLLHAVGNAIVDNN-PNAKVVYMHSERFVQD
DNAA_PSEAE       WQVADNLKH----GYNPLFLYGGVGLGKTHLMHAVGNHLLKKN-PNAKVVYLHSERFVAD
DNAA_PSEPK       WQVADNPKH----GYNPLFLYGGVGLGKTHLMHAVGNHLLKKN-PNAKVVYLHSERFVAD
DNAA_HAEIN       QKLAQAPGEP---SANPFFLYGGTGLGKTHLLHAIGNGILADK-PNARVLYIHANNFMQH
DNAA_PASMU       QKVADNPGEP---SSNPLFLYGGTGLGKTHLLHAIGNGILSRN-TNARVLYIHANNFMQQ
DNAA_XYLFA       WQAAQKPGDR---THNPLLLYGGTGLGKTHLMFAAGNVMRQVN-PTYKVMYLRSEQFFSA
DNAA_NEIMA       QAIAESPGQ----SYNPFFLYGSTGLGKTHLVQAVGNELLKNR-PDAKVRYMHSDDYIRS
DNAA_NEIMB       QAIAESPGQ----SYNPFFLYGSTGLGKTHLVQAVGNELLKNR-PDAKVRYMHSDDYIRS
DNAA_CAUVC       RRIANWADG----HFNPVLFHGPYGFGKTHLLNALAWEAMRNA-PEKRVVYLTAERFLST
DNAA_RHIME       RTIAEAGAGA--VRFNPLFIHSSVGLGKTHLLQAIALAALQSA-RAPRVVYLTAEYFMWR
DNAA_RICPR       RAVAESSGAV--FESNPLFLYGGVGLGKTHLMHAIGWYIKQNN-PRRKVIYMSAEKFMYQ
DNAA_ZYMMO       CTFAE--GGK--LDFNPLFLYGGTGLGKTHLMHAVGIEYLKRH-PNSTALYMSAEKFMYD
DNAA2_CHLMU      LGIAARPGR----SYNPLFIHGGVGLGKTHLLHAVGHYVREHH-KNLRIHCITTEAFIND
DNAA2_CHLTR      LGIAARPGR----SYNPLFIHGGVGLGKTHLLHAVGHYVREHH-KNLRIHCITTEAFIND
DNAA2_CHLPN      VGIAGKPGR----SYNPLFIHGGVGLGKTHLLHAVGHYVREHH-KNLRIHCITTEAFIND
DNAA_AQUAE       KEALENLGSL----YNPIFIYGSVGTGKTHLLQAAGNEAKKR---GYRVIYSSADDFAQA
DNAA_THEMA       LEVAKHPGR-----YNPLFIYGGVGLGKTHLLQSIGNYVVQNE-PDLRVMYITSEKFLND
DNAA_HELPY       KKVAQSDT----PPYNPVLFYGGTGLGKTHILNAIGNHALEK---HKKVVLVTSEDFLTD
DNAA_HELPJ       KKVAQSDT----PPYNPVLFYGGTGLGKTHILNAIGNHALEK---HKKVVLVTSEDFLTD
DNAA_CAMJE       KAIAHKDKL-G-KLYNPIFVYGPTGLGKTHLLQAVGNASLEM---GKKVIYATSENFIND
DNAA1_CHLMU      QEFAKVSEQGKGFPFNPIYLFGPESSGKTHLMQAAVGILRE---AGVKTLYVSSQLFTEH
DNAA1_CHLTR      QEFAKVSEQGKGFPFNPIYLFGPESSGKTHLMQAAVGGLRE---AGVKTLYVTSELFTEH
DNAA1_CHLPN      QEFTKSPDENGGVTFNPIYLFGPEGSGKTHLMQSAISVLRE---SGGKILYVSSDLFTEH
DNAA_ACHLA       MKVADHPGA----VANPFYIFGDVGLGKTHLMQAIGNYILDND-VEKRILYVKADNFIED
DNAA_MYCCT       QTVSKNPGI----SYNPLFIYGESGMGKTHLLKAAKNYIESNF-SDLKVSYMSGDEFARK
DNAA_SPICI       LAVALDLGK----KWNPLFIYGDSGLGKTHLLHAIENKVNEIYKTNNRVKYLKADEFGKI
DNAA_MYCGE       VRLAETQDN----EFSPLFIYGETGLGKTHLLQAIGNEKFRNF-PNARVKYVVSSDFAQE
DNAA_MYCPN       VRISETQDA----DFSPLFIYGETGLGKTHLLQAIGNDKFFHF-PNAKVKYVVSSDFAQE
DNAA_UREPA       ENLFSNNYDNS-SMCNPLFLFGKVGVGKTHIVAAAGNRFANSN-PNLKIYYYEGQDFFRK
                                .*  . .  . ****:: :                    . :   

DNAA_TREDE       FVECVQ--KK-MMPAFKSKYR-KADVLLIDDIHFFQGKV--ETQEELFHTFNELYEKNKQ
DNAA_TREPA       FISTLL--NK-KTQDFKKKYRYTADVLLIDDIHFFENKD--GLQEELFYTFNELFEKKKQ
DNAA_BORBU       FVESIK--TH-ETKKFKKKYR-YLDMLLIDDIHDLQKKE--GIQEELFHTFNALYEDNKQ
DNAA_BACHD       FINAIR--DN-KAVNFRNKYR-NVDVLLIDDIQFLAGKE--QTQEEFFHTFNALHEDNKQ
DNAA_BACSU       FINSIR--DN-KAVDFRNRYR-NVDVLLIDDIQFLAGKE--QTQEEFFHTFNTLHEESKQ
DNAA_STAAM       FIKSIR--DN-EGEAFRERYR-NIDVLLIDDIQFIQNKV--QTQEEFFYTFNELHQNNKQ
DNAA_DEIRA       LINAIR--DD-KTTQFRNRYR-SVDLLLVDDIQFLAGKE--RTQEEFFHTFNALYESNKQ
DNAA_THET8       LINAIR--ED-RMTEFRERYR-SVDLLLVDDVQFIAGKE--RTQEEFFHTFNALYEAHKQ
DNAA_STRCO       FINSIR--DG-KGDSFRKRYR-EMDILLVDDIQFLADKE--STQEEFFHTFNTLHNANKQ
DNAA_STRRE       FINSIR--DG-KGDSFRKRYR-EMDILLVDDIQFLADKE--STQEEFFHTFNTLHNANKQ
DNAA_STRAQ       FINSIR--DG-KGDTFRKRYR-DVDILLVDDIQFLASKE--STQEEFFHTFNTLHNANKQ
DNAA_MICLU       FINSIR--HD-EGASFKQVYR-NVDILLIDDIQFLADKE--ATVEEFFHTFNTLYNNNKQ
DNAA_MYCAV       FINSLR--DD-RKVPFKRTIR-DVDVLLVDDIQFIEGKE--GIQEEFFHTFNTLHNANKQ
DNAA_MYCPA       FINSLR--DD-RKVAFKRSYR-DVDVLLVDDIQFIEGKE--GIQEEFFHTFNTLHNANKQ
DNAA_MYCLE       FINSLR--DD-RKVAFKRSYR-DVDVLLVDDIQFIEGKE--GIQEEFFHTFNTLHNANKQ
DNAA_MYCTU       FINSLR--DD-RKVAFKRSYR-DVDVLLVDDIQFIEGKE--GIQEEFFHTFNTLHNANKQ
DNAA_MYCSM       FINSLR--DD-RKASFKRSYR-DIDILLVDDIQFIEGKE--GIQEEFFHTFNTLHNSNKQ
DNAA_PROMA       LILAIR--QD-RMQAFRDRYR-AADLILVDDIQFIEGKE--YTQEEFFHTFNALHDAGSQ
DNAA_PROMP       LIQSIR--KD-GMHAFKNKYR-SVDLLLIDDIQFLEGKE--YTQEEFFNTFNALYEAGKQ
DNAA_SYNY3       LITAIR--QD-NMEDFRSYYR-SADFLLIDDIQFIKGKE--YTQEEFFHTFNSLHEAGKQ
DNAA_STRPN       FLDHLR--LG-EMEKFKKTYR-SLDLLLIDDIQSLSGKK-VATQEEFFNTFNALHDKQKQ
DNAA_STRP1       FVIHIR--LD-TMDELKEKFR-NLDLLLIDDIQSLAKKTLSGTQEEFFNTFNALHNNNKQ
DNAA_LACLA       YVNATR--KN-QMENFENTYR-NLDLLLLDDVQFFSDKE--GTKNEFFNTFNALYDKGSQ
DNAA_BUCAI       MVKALK--NN-AIEKFKLYYR-SVDALLIDDIQFFAHKE--RSQEEFFHTFNTLIEGNQQ
DNAA_BUCAP       MVKALQ--NN-AIEKFKLYYR-SVDALLIDDIQFFAHKE--RSQEEFFHTFNALLEGNQQ
DNAA_ECOLI       MVKALQ--NN-AIEEFKRYYR-SVDALLIDDIQFFANKE--RSQEEFFHTFNALLEGNQQ
DNAA_SALTY       MVKALQ--NN-AIEEFKRYYR-SVDALLIDDIQFFANKE--RSQEEFFHTFNALLEGNQQ
DNAA_SERMA       MVKALQ--NN-AIEEFKRYYR-SVDALLIDDIQFFANKE--RSQEEFFHTFNALLEGNQQ
DNAA_PROMI       MVKALQ--NN-AIEDFKRYYR-SVDALLIDDIQFFANKE--RSQEEFFHTFNALLEGNQQ
DNAA_VIBCH       MVKALQ--NN-AIEEFKRYYR-SVDALLIDDIQFFANKE--RSQEEFFHTFNALLEGNQQ
DNAA_VIBHA       MVKALQ--NN-AIEEFKRYYR-SVDALLIDDIQFFANKE--RSQEEFFHTFNALLEGNQQ
DNAA_PSEAE       MVKALQ--LN-AINEFKRFYR-SVDALLIDDIQFFARKE--RSQEEFFHTFNALLEGGQQ
DNAA_PSEPK       MVKALQ--LN-AINEFKRFYR-SVDALLIDDIQFFARKE--RSQEEFFHTFNALLEGGQQ
DNAA_HAEIN       MVKAVR--DN-KMDQFKKFYR-SLDALLVDDIQFFAEKE--KTQEEFFHIFNSLFETGRQ
DNAA_PASMU       MVNAVR--DN-KMDEFKKFYR-SLDALLVDDIQFFAEKE--KTQEEFFHIFNNLFDTGRQ
DNAA_XYLFA       MIRALQ--DK-SMDQFKRQFH-QIDALLIDDIQFFAGKD--RTQEEFFHTFNALFDGKQQ
DNAA_NEIMA       FMKAVR--NN-TYDVFKQQYK-QYDLLIIDDIQFIKGKD--RTMEEFFYLYNHFHNEKKQ
DNAA_NEIMB       FMKAVR--NN-TYDVFKQQYK-QYDLLIIDDIQFIKGKD--RTMEEFFYLYNHFHNEKKQ
DNAA_CAUVC       FVRAVM--DR-QTAAFKEELR-AADLLIIDDVHFIAGKQ--STQEELFHTLTALVGEGGR
DNAA_RHIME       FATAIR--DN-DALSLKESLR-NIDLLIIDDMQFLQGK---SIQHEFCHLLNMLLDSAKQ
DNAA_RICPR       FVKALR--NK-EVILFKEKFR-SVDVLMIDDIQFICGKD--STQEEFFHTFNTLIDNNRQ
DNAA_ZYMMO       FVASMR--AK-DTHSFKARLR-SADLLMIDDVQFIAGKD--STQEEFFHTMNEVITAGRR
DNAA2_CHLMU      LVHHLR--VK-SIDKMKNFYR-SLDLLLVDDIQFLQNRQ--NFEEEFCNTFETLIHLSKQ
DNAA2_CHLTR      LVHHLR--VK-SIDKMKNFYR-SLDLLLVDDIQFLQNRQ--NFEEEFCNTFETLIHLSKQ
DNAA2_CHLPN      LVYHLK--SK-SVDKMKNFYR-SLDLLLVDDIQFLQNRQ--NFEEEFCNTFETLINLSKQ
DNAA_AQUAE       MVEHLK--KG-TINEFRNMY-KSVDLLLLDDVQFLSGKE--RTQIEFFHIFNTLYLLEKQ
DNAA_THEMA       LVDSMK--EG-KLNEFREKYRKKVDILLIDDVQFLIGKT--GVQTELFHTFNELHDSGKQ
DNAA_HELPY       FLKHLD--NK-TMDSFKAKY-RHCDFFLLDDAQFLQGKP--KLEEEFFHTFNELHANSKQ
DNAA_HELPJ       FLKHLD--NK-NMDSFKKKY-RHCDFFLLDDAQFLQGKP--KLEEEFFHTFNELHANSKQ
DNAA_CAMJE       FTSNLK--NG-SLDKFHEKY-RNCDVLLIDDVQFLGKTD--KIQEEFFFIFNEIKNNDGQ
DNAA1_CHLMU      LVSAIR--SG-EMQRFRAFYR-NVEALFIEDIEVLSGKG--ATQEEFFHTFNSLHTEGKL
DNAA1_CHLTR      LVSAIR--SG-EMQRFRAFYR-NVEALFIEDIEVLSGKG--ATQEEFFHTFNSLHTEGKL
DNAA1_CHLPN      LVSAIR--SG-EMQKFRSFYR-NIDALFIEDIEVFSGKS--ATQEEFFHTFNSLHSEGKL
DNAA_ACHLA       FVSLLSRNKN-KTEEFNAKYK-DIDVILVDDIQIMANAS--KTQMEFFKLFDYLYLNNKQ
DNAA_MYCCT       AVDILQKTHK--EIEQFKNEVCQNDVLIIDDVQFLSYKE--KTNEIFFTIFNNFIENDKQ
DNAA_SPICI       AMDILNQGHE--IIEAFKTSYDIYDCLLIDDIQLLAKRN--KTNELFFHIFNSYIEKNKQ
DNAA_MYCGE       VVDAFYQRDK--GIEKLKKNYENLDLVLIDDTQIFGRKE--KTLEILFNIFNNLVLNKKQ
DNAA_MYCPN       VVNAFYQKEKDQGIEKLKAAYESLDLLLIDDTQIFGKKE--KTLEILFSIFNNLVSKGKQ
DNAA_UREPA       FCSASL--KGTSYVEEFKKEIASADLLIFEDIQNIQSRD--STAELFFNIFNDIKLNGGK
                                         : .:.:* . :           :             

DNAA_TREDE       IVFTCDRPPAELKNLSQRLKSRFERGLNVDLQTPAYEIRYAILLKKMEKHST-------K
DNAA_TREPA       IIFTCDRPVQELKNLSSRLRSRCSRGLSTDLNMPCFETRCAILIKKIQNYNSTYPHKAIH
DNAA_BORBU       LVFTCDRSPSELTNFTDRLKSRFTRGLNVDISKPNFELRAAIVEKKAEEDGI-------N
DNAA_BACHD       IVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAE-------NLD
DNAA_BACSU       IVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAE-------GLD
DNAA_STAAM       IVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPPDYETRMAILQKKIEEE-------KLD
DNAA_DEIRA       IILSSDRPPKDIQTLEGRLRSRFEWGLITDIQSPEYETRVAILKMNAEQG-------HIT
DNAA_THET8       IILSSDRPPKDILTLEARLRSRFEWGLITDIQPPDLETRIAILKMNAEQR-------GLR
DNAA_STRCO       IVLSSDRPPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAVQE-------QLN
DNAA_STRRE       IVLSSDRPPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAVQE-------QLN
DNAA_STRAQ       IVLSSDRPPKQLVTLEDRLRNRFEWGLTTDVQPPELETRIAILRKKAVQE-------QLN
DNAA_MICLU       VVITSDLPPKQLSGFEDRLRSRFEWGLITDIQPPDLETRIAILRKKAEAE-------GLV
DNAA_MYCAV       IVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQME-------RLA
DNAA_MYCPA       IVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQME-------RLA
DNAA_MYCLE       IVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQME-------RLA
DNAA_MYCTU       IVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQME-------RLA
DNAA_MYCSM       IVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMD-------RLD
DNAA_PROMA       IVLASDRPPSQIPRLQERLMSRFSMGLIADVQAPDLETRMAILQKKAEQE-------RVG
DNAA_PROMP       IVIASDRPPSQIPKLQERLISRFSMGLIADIQPPDIETRMAILQKKAEQE-------RMN
DNAA_SYNY3       VVVASDRAPQRIPGLQDRLISRFSMGLIADIQVPDLETRMAILQKKAEYD-------RIR
DNAA_STRPN       IVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPPDFETRIAILQSKTEHL-------GYN
DNAA_STRP1       IVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDFETRVAILTNKIQEY-------NFI
DNAA_LACLA       IVLTSDRIPQELNNLEDRLVSRFSWGLTTDITAPDYETRMAILLIKSESS-------RLE
DNAA_BUCAI       IILTSDRYPKEINGVEDRLKSRFSWGLTIAIDPPEIETRVAILIKKADQN-------NVI
DNAA_BUCAP       IILTSDRYPKEINGVEDRLKSRFGWGLTVAIDPPELETRVAILIKKADEN-------NIV
DNAA_ECOLI       IILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADEN-------DIR
DNAA_SALTY       IILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADEN-------DIR
DNAA_SERMA       IILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADEN-------DIR
DNAA_PROMI       IILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADEN-------QIQ
DNAA_VIBCH       IILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDH-------QIH
DNAA_VIBHA       IILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDH-------QIH
DNAA_PSEAE       VILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKAEQA-------KIE
DNAA_PSEPK       VILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQA-------KVE
DNAA_HAEIN       IILTSDRYPKEIEKIEERLKSRFGWGLTTAIEPPDLETRVAILLKKAEEH-------NMN
DNAA_PASMU       IILTSDRYPKEIEKLEERLKSRFGWGLTTAIEPPELETRVAILLKKAEEK-------NIY
DNAA_XYLFA       IILTCDRYPREVNGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARER-------GAT
DNAA_NEIMA       LILTCDVLPAKIEGMDDRLKSRFSWGLTLELEPPELEMRIAILQKKAEAA-------GIS
DNAA_NEIMB       LILTCDVLPAKIEGMDDRLKSRFSWGLTLELEPPELEMRIAILQKKAEAA-------GIS
DNAA_CAUVC       VVFSADRPPSAMTEMDAHLRSHLSAGLVCGLEPADRNLRLGILERKIQTLGAA-HGFEPS
DNAA_RHIME       VVVAADRAPWELESLDSRVRSRLQGGVAIEMEGPDYEMRLEMLKRRLEAARQ--DDASLE
DNAA_RICPR       MVISCDRSPSDLDNIEDRIKSRLGWGLVADVHSTTYELRLGILESKIEQM-N------VK
DNAA_ZYMMO       LVISADRSPQDLERIESRILSRLSWGLVADVNPADFELRLNIILKKLEAMPQ------VS
DNAA2_CHLMU      IVVTSDKPPG-QLKLSERIIARMEWGLVAHVGVPDLETRVAILQHKAEQK-------GLN
DNAA2_CHLTR      IVVTSDKPPG-QLKLSERIIARMEWGLVAHVGVPDLETRVAILQHKAEQK-------GLN
DNAA2_CHLPN      IVITSDKPPS-QLKLSERIIARMEWGLVAHVGIPDLETRVAILQHKAEQK-------GLL
DNAA_AQUAE       IILASDRHPQKLDGVSDRLVSRFEGGILVEIELDNKTRFKIIKEKLKEFN-------LEL
DNAA_THEMA       IVICSDREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIE-------HGE
DNAA_HELPY       IVLISDRSPKNIAGLEDRLKSRFEWGITAKVMPPDLETKLSIVKQKCQLN-------QIT
DNAA_HELPJ       IVLISDRSPKNIAGLEDRLKSRFEWGITAKVMPPDLETKLSIVKQKCQLN-------KIT
DNAA_CAMJE       IIMTSDNPPNMLKGITERLKSRFAHGIIADITPPQLDTKIAIIRKKCEFN-------DIN
DNAA1_CHLMU      IVISSIFAPGDLKAMEERLISRFEWGIAVPVSPLTREGLKSFLERRIEQL-------NIR
DNAA1_CHLTR      IVISSTFAPGDLKAMEERLISRFEWGISIPVSPLIREGLKSFLERRTEKL-------NIR
DNAA1_CHLPN      IVVSSSYAPVDLVAVEDRLISRFEWGVAIPIHPLVQEGLRSFLMRQVERL-------SIR
DNAA_ACHLA       IVITSDKPASQLTNIMPRLTTRFEAGLSVDIQIPELEHRISILKRKTATLDA-----NLE
DNAA_MYCCT       LFFSSDKSPELLNGFDNRLITRFNMGLSIAIQKLDNKTATAIIKKEIKNQNI-----KTE
DNAA_SPICI       IVITSDKYPDDLGGFEARIISRFSYGLSIGLDSPDFETALKILEQKLKHQNN-----LGL
DNAA_MYCGE       IVLVSDKAPDELIDIDARMISRFKSGLLLKIEKHNLSSLCEILTVKLKEKDP-----NIQ
DNAA_MYCPN       IVFVSDKTPDELANIDPRMVSRFKSGLLLKIEKHNLSSLCEILAVKLKEKDP-----NIQ
DNAA_UREPA       IILTSDRTPNELNGFHNRIISRLASGLQCKISQPDKNEAIKIINNWFEFKK------KYQ
                 :.. .         .  ::  :   *:   :          :                  

DNAA_TREDE       IPNEFIDMVAKNVSSNVRDLEAALTKLIAYTELTKK-T--MDEATAKNLLRDIFGSTRQR
DNAA_TREPA       ISDDVVRLVSENISSNIRDLEGALTKIIAFIEVSG--S--ITIDIVPSLLKEFFLSARPK
DNAA_BORBU       VPKNILNLVAQKVTTNVRDLEAAVTKLKAYIDLDNI-E--IDIEIVEKIIKEIIIYEKET
DNAA_BACHD       IPNEVMLYIANQIDTNIRELEGALIRVVAYSSLINQD---MNADLAAEALKDIIP--NAK
DNAA_BACSU       IPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKD---INADLAAEALKDIIP--SSK
DNAA_STAAM       IPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKP---ITTELTAEALKDIIQ--APK
DNAA_DEIRA       IPQEVLELIARQVTSNIRELEGALMRVVAFASLNNVP---FSRAAAAKALSNVFA---PQ
DNAA_THET8       IPEDALEYIARQVTSNIRELEGALMRAIAFASLNGVE---LTRAVAAKALSDIFA---PR
DNAA_STRCO       APPEVLEFIASRISRNIRELEGALIRVTAFASLNRQP---VDLGLTEIVLKDLIPGGEDS
DNAA_STRRE       APPEVLEFIASRISRNIRELEGALIRVTAFASLNRQP---VDLGLTEIVLKDLIPGGEDS
DNAA_STRAQ       APPEVLEFIASRISRNIRELEGALIRVTAFASLNRQP---VDLGLTEIVLKDLIPGGEES
DNAA_MICLU       APPEALEYIASRISTNIRELEGALIRVTAFASLNRQT---VDIELAEHVLKDLIT--DET
DNAA_MYCAV       VPDDVLELIASSIERNIRELEGALIRVTAFASLNKTP---IDKSLAEIVLRDLIA--DAS
DNAA_MYCPA       VPDDVLELIASSIERNIRELEGALIRVTAFASLNKTP---IDKSLAEIVLRDLIA--DAS
DNAA_MYCLE       VPGDVLELIASSIERNIRELEGALIRVTAFASLNKTA---IDKALAEIVLRDLIA--DAS
DNAA_MYCTU       VPDDVLELIASSIERNIRELEGALIRVTAFASLNKTP---IDKALAEIVLRDLIA--DAN
DNAA_MYCSM       VPDDVLELIASSIERNIRELEGALIRVTAFASLNKTR---IDRSLAEVVLRDLIA--DAT
DNAA_PROMA       LPRDLIQFIAGRFTSNIRELEGALTRAIAFASITGLP---MTVDSIAPMLDPNGQ----G
DNAA_PROMP       LPRDLIQFIAGRFSSNIRELEGAFTRAVAFASITGLP---MTVQSIAPMLDPNSV----G
DNAA_SYNY3       LPKEVIEYIASHYTSNIRELEGALIRAIAYTSLSNVA---MTVENIAPVLNPPVE----K
DNAA_STRPN       FQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKD--ITIDIAAEAIRARKQDVSQ-
DNAA_STRP1       FPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDT--ITVDIAAEAIRARKQDGPK-
DNAA_LACLA       FPSETLSYIAGQIDSNVRELEGALNRVEFVARANGIAV--VDIETASQALRSLKNATQQS
DNAA_BUCAI       LSNEVAFFIAKHLRSNVRELEGALNRVILNSRFTHRA---ITVDFAREALQDILAVQE--
DNAA_BUCAP       LSDEVAFFIAKHLRSNVRELEGALNRVIVNANFTHRS---ITVEFVREALRDILALQE--
DNAA_ECOLI       LPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRA---ITIDFVREALRDLLALQE--
DNAA_SALTY       LPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRA---ITIDFVREALRDLLALQE--
DNAA_SERMA       LPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRA---ITIDFVREALRDLLALQE--
DNAA_PROMI       LPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRA---ITIDFVREALRDLLALQE--
DNAA_VIBCH       LPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRP---ITIDFVREALRDLLALQE--
DNAA_VIBHA       LADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRP---ITIDFVREALRDLLALQE--
DNAA_PSEAE       LPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRP---ITIELIRESLKDLLALQD--
DNAA_PSEPK       LPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRD---ITIELIRESLKDLLALQD--
DNAA_HAEIN       LPEEVAFFIAQRLRTNVRELEGALNRVKAMQDFKGGD---IDIDFVRDTLKDILALQE--
DNAA_PASMU       LPEEVAFFIGQKLRTNVRDLEGALNRVSANAEFMGAA---ITIDFVRETLKDMLALQD--
DNAA_XYLFA       IPDEVAFLIAKKMHSNVRDLEGALNTLVARANFTGRA---VTIEFSQETLRDLLRAQQ--
DNAA_NEIMA       IEDEAALFIANLIRSNVRELEGAFNRVGASSRFMNRPV--IDIDLARTALQDIIAEKH--
DNAA_NEIMB       IEDEAALFIANLIRSNVRELEGAFNRVGASSRFMNRPV--IDIDLARTALQDIIAEKH--
DNAA_CAUVC       IRPEVMQFLADRFTDSVRELEGALNTLSARAGEGLSR---MTLDEVQAILRPHLRSGE--
DNAA_RHIME       IPLEILSHVARNVTASGRELEGAFNQLLFRRSFE-PQ---LSIERVDELLGHLVNAGEP-
DNAA_RICPR       IPKDVINFLASKIVSNVRELEGALNKVIAHSNFTLKA---ITLENTQNILRDLLRSNE--
DNAA_ZYMMO       MPEDIVFFLAKRICTNVRELEGALNRVVAYATLSNRP---INMDFVTETLADLLRTTQ--
DNAA2_CHLMU      IPNEIAFYIADHVYGNVRQLEGAINKLTAYCLLFNKPL--TETTVRDTLKELFRTPSK--
DNAA2_CHLTR      IPNEIAFYIADHVYGNVRQLEGAINKLTAYCLLFNKPL--TETTVRDTLKELFRAPSK--
DNAA2_CHLPN      IPNEMAFYIADHIYGNVRQLEGAINKLTAYCRLFGKSL--TETTVRETLKELFRSPTK--
DNAA_AQUAE       RKEVIDYLLENTKNVREIEGKIKLIKLKGFEGLERKE---R-------------------
DNAA_THEMA       LPEEVLNFVAENVDDNLRRLRGAIIKLLVYKETTGKE---VDLKEAILLLKDFIKPNRV-
DNAA_HELPY       LPEEVMEYIAQHISDNIRQMEGAIIKISVNANLMNAS---IDLNLAKTVLEDLQKDH---
DNAA_HELPJ       LPEEVMEYIAQHISDNIRQMEGAIIKISVNANLMNAT---IDLNLAKTVLEDLQKDH---
DNAA_CAMJE       LSNDIINYIATSLGDNIREIEGIIISLNAYATILGQE---ITLELAKSVMKDHIKEK---
DNAA1_CHLMU      IEETALDFLIQALSSHIKSLLHALTTLAKRVAYKKLSHQLLYQGDVEALLQDVLQAAEH-
DNAA1_CHLTR      IEETALDFLIQALSSHVKSLLHALTTLAKRVAYKKLSHQMLYQGDIEALLHDVLQAAES-
DNAA1_CHLPN      IQETALDFLIYALSSNVKTLLHALNLLAKRVMYKKLSHQLLYEDDVKTLLKDVLEAAGS-
DNAA_ACHLA       VSEDILTFIASQFAANIREMEGALIRLISYAQTFNLEITMNVVEEALGAVLKTKKKTNDL
DNAA_MYCCT       VTNEAINFISNYYSDDVRKIKGSVSRLNFWSQQNPE-EKVITIEIISDLFRDIPTSKL--
DNAA_SPICI       FSEESLEFIALNFNSDVRKLEGAIKRLLFLAVMNKKPNEIITLADVEKAFKNAPLQNN--
DNAA_MYCGE       ITNEARHDAAQISGNDVRALNGIATKLLFFAKTSKQ-NLINTENLKEILFEEFEKFHK--
DNAA_MYCPN       ITNEAREKAAQISGNDVRSLNGIATKLLFYVKTTKQ-NLINNDNLKEILFEEFEKFHK--
DNAA_UREPA       ITDEAKEYIAEGFHTDIRQMIGNLKQICFWADNDTNKDLIITKDYVIECSVENEIPLNIV
                                                                             

DNAA_TREDE       N------VTIDLIQRTVADYFSISISDIKSKKRTKSFSFPRQIAMFLCREMTECSTTELG
DNAA_TREPA       H------ITVETILHVVADHFNISYSDLKGKKRNKSVVYPRQIAMFLSKELTELSTTELG
DNAA_BORBU       TNEPNNKINIENIKKILLRELKITHKDIEGHSKKPEITKARHIYAYLLRNFTELSTVEIG
DNAA_BACHD       P----RVLTITDIQKTVGEYFHVKLEDFKAKKRTKSVAFPRQIAMYLSRELTDASLPKIG
DNAA_BACSU       P----KVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIG
DNAA_STAAM       S----KKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLSRELTDFSLPKIG
DNAA_DEIRA       E----AKVEMTDVLRQVAAHYGTTPDLIRGSGRARDIVVPRQVAQYLIRALTDHSLPEIG
DNAA_THET8       E----LEADPLEIIRKVADHFGLKPEELTGSGRKKEVVLPRQLAMYLVRELTRASLPEIG
DNAA_STRCO       A----PEITSTAIMGATADYFGLTVEDLCGTSRGRALVTARQIAMYLCRELTDLSLPKIG
DNAA_STRRE       T----PEITATAIMAATADYFGLTVDDLCGSSRGRQLVTARQIAMYLCRELTDLSLPKIG
DNAA_STRAQ       A----PEITAPAIMAATADYFGLTVDDLCGSSRTRVLVTARQIAMYLCRELTDLSLPKIG
DNAA_MICLU       A----HEITPELILHATGEYFNLTLEELTSKSRTRTLVTARQIAMYLLRELTEMSLPKIG
DNAA_MYCAV       T----MQISAATIMAATAEYFDTTVVELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIG
DNAA_MYCPA       T----MQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIG
DNAA_MYCLE       T----MQISAATIMTATAEYFDTTIEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIG
DNAA_MYCTU       T----MQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIG
DNAA_MYCSM       T----MQISTAAIMAVTAEYFETTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIG
DNAA_PROMA       -----VEVTPKQVLDKVAEVFKVTPDEMRSASRRRPVSQARQVGMYLMRQGTNLSLPRIG
DNAA_PROMP       -----VVVTPKQVIKKVSDFFEVSAEELVSSSRRKPVSQARQIGMYLMRQGTDLSLPKIG
DNAA_SYNY3       -----VAAAPETIITIVAQHYQLKVEELLSNSRRREVSLARQVGMYLMRQHTDLSLPRIG
DNAA_STRPN       M----LVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMYLSRELTDNSLPKIG
DNAA_STRP1       M----TVIPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLAREMTDNSLPKIG
DNAA_LACLA       L----SNLTIKKIQDEVANYYHISFSDLVGPKRPKEIAFPRQIAMYLVRELLGTSLPAIG
DNAA_BUCAI       -----KIITIDNIQKTVAKYYKIKVSDLLSKKRSRSIARPRQMAMAMAKKLTNHSLPEIG
DNAA_BUCAP       -----KLVTIANIQKTVAEYYKIKVADLLSRRRSRSVARPRQMAMAMAKELTNHSLPEIG
DNAA_ECOLI       -----KLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIG
DNAA_SALTY       -----KLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIG
DNAA_SERMA       -----KLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIG
DNAA_PROMI       -----KLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIG
DNAA_VIBCH       -----KLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIG
DNAA_VIBHA       -----KLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNHSLPEIG
DNAA_PSEAE       -----KLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIG
DNAA_PSEPK       -----KLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIG
DNAA_HAEIN       -----RLVTIENIQKVVAEYYRIKVSDLKSKSRARSVTRPRQIAMALAKELTNRSLPEIG
DNAA_PASMU       -----KLVTVENIQKVVAEYYRIKVSDLKGKSRSRSIARPRQLAMALSKELTNRSLPEIG
DNAA_XYLFA       -----QTIGIPNIQKIVADYYGLQIKDLLSKRRTRSLARPRQLAMALAKELTEHSLPEIG
DNAA_NEIMA       -----KVITADIIIDAVAKYYRIKISDVLGKKRTRNIARPRQVAMSLTKELTTLSLPSIG
DNAA_NEIMB       -----KVITADIIIDAVAKYYRIKISDVLGKKRTRNIARPRQVAMSLTKELTTLSLPSIG
DNAA_CAUVC       -----KRITIDDIQKATAEHYGMKQADLLSERRNRAVARPRQAAMWLAKQLTTRSLPDIG
DNAA_RHIME       -----RRVRIEDIQRVVAKHYNVSRQELVSNRRTRVIVKPRQIAMYLSKTLTPRSFPEIG
DNAA_RICPR       -----RIITVEDIQKKVASRYNIKLSDMYSSRRLREVARPRQIAMYLSKTLTPKSLADIG
DNAA_ZYMMO       -----QRVTVEDIQKRVCDHYHLKLADMSSKRRDRVIARPRQVAMYLSKQLTSRSLPEIG
DNAA2_CHLMU      -----QKVSVESILKSVATVFQVKIQDLKGTSRAKNVPLARQVAMYLAKTLITDSLVAIG
DNAA2_CHLTR      -----QKVSVESILKSVATVFQVKIQDLKGSSRAKNVPLARQVAMYLAKTLITDSLVAIG
DNAA2_CHLPN      -----QKISVETILKSVATVFQVKLNDLKGNSRSKDLVLARQIAMYLAKTLITDSLVAIG
DNAA_AQUAE       ----KERDKLMQIVEFVANYYAVKVEDILSDKRNKRTSEARKIAMYLCRKVCSASLIEIA
DNAA_THEMA       ----KAMDPIDELIEIVAKVTGVPREEILSNSRNVKALTARRIGMYVAKNYLKSSLRTIA
DNAA_HELPY       ----AEGSSLENILLAVAQSLNLKSSEIKVSSRQKNVALARKLVVYFARLYTPNPTLSLA
DNAA_HELPJ       ----AEGSSLENILLAVAQSLNLKSSEIKVSSRQKNVALARKLVVYFARLYTPNPTLSLA
DNAA_CAMJE       ----KENITIDDILSLVCKEFNIKPSDVKSNKKTQNIVTARRIVIYLARALTALTMPQLA
DNAA1_CHLMU      -----IRLTPSGIVRATAQYYGVSPENILGRSQSREYVLPRQVAMFLCRQKLSLSYVKIG
DNAA1_CHLTR      -----IRLTPSGIVRATAQYYGVSPESVLGRSQSREYVLPRQVAMFLCRQKLSLSYVKIG
DNAA1_CHLPN      -----VRLTPLKIIRNVAQYYGVSQESILGRSQSREYVLPRQVAMYFCRQKLSLSYVRIG
DNAA_ACHLA       N-----ENNYDKIQSIVADYFQVSLPDLIGKKRHAKFTLPRHIAMYLIKLKYNIPYKTIG
DNAA_MYCCT       -----GILNVKKIKEVVSEKYGISVNAIDGKARSKSIVTARHIAMYLTKEILNHTLAQIG
DNAA_SPICI       -----EKITPKKIKQIVADSYNITIKAMMSKSRVSNVMQARQLAMYFCRTLLDEPFTRIG
DNAA_MYCGE       -----KSFDPYLLIENVCRRFNVPMDSVLSENRKAELVRVRDVCNYLLRQKYNMQFQQIG
DNAA_MYCPN       -----KSFDPYLLIENVCRRFNVPVDSVLSENRKAELVRVRDVCNYILREKYKMQFQQIG
DNAA_UREPA       V---KKQFKPEQIIEIVAKELNIKTDLIKSSIRKNNIVWARDIVCYILKNKLNLTLTDIG
                             :              .    :       *     . :         :.

DNAA_TREDE       NDFGGRDHTTILHGCNKIEEQIAADPS---------LEKIIHELRNTIKENTNK------
DNAA_TREPA       IEFGGRDHSTVIYGCQKIEGEILTNPS---------LQANLDLLKSKVQDSIR-------
DNAA_BORBU       KIIGGKTHSTVLYSINKIDRDRNNDKE---------INNLITELMNKIKKN---------
DNAA_BACHD       SEFGGRDHTTVIHAHEKISKLLSTDQE---------LQDKIQDISDKLRS----------
DNAA_BACSU       EEFGGRDHTTVIHAHEKISKLLADDEQ---------LQQHVKEIKEQLK-----------
DNAA_STAAM       EEFGGRDHTTVIHAHEKISKDLKEDPI---------FKQEVENLEKEIRNV---------
DNAA_DEIRA       QFFG-RDHSTVMHAVSKITEQMGKDPE---------LAATVNTLRNRIQGKEEEEEVGA-
DNAA_THET8       QLFGGRDHTTVLYAIQKVQELAESDRE---------VQGLLRTLREACT-----------
DNAA_STRCO       ALFGGRDHTTVMHADRKIRNLMAERRS---------IYNQVTELTNRIKNG---------
DNAA_STRRE       AQFGGRDHTTVMHADRKIRALMAERRS---------IYNQVTELTNRIKNG---------
DNAA_STRAQ       AQFGGRDHTTVMHADRKIRALMAERRS---------IYNQVTELTNRIKNG---------
DNAA_MICLU       QVLGGRDHTTVIHADRKIRELMAERRT---------IYNQVTELTNEIKRKQRGA-----
DNAA_MYCAV       QAFG-RDHTTLMYGQRKILSEMAERRG---------GFDHVKELTTRIRQRSKR------
DNAA_MYCPA       QAFG-RDHTTVMYAQRKILSEMAERRE---------VFDHVKELTTRIRQRSKR------
DNAA_MYCLE       QAFG-RDHTTVMYAQRKILSEMAERRE---------VFDHVKELTTRIRQRSKR------
DNAA_MYCTU       QAFG-RDHTTVMYAQRKILSEMAERRE---------VFDHVKELTTRIRQRSKR------
DNAA_MYCSM       QAFG-RDHTTVMYAEKKIRGEMAERRE---------VFDHVKELTTRIRQRAKR------
DNAA_PROMA       DTFGGKDHTTVMYAIEQVEKKLSSDPQ---------IASQVQKIRDLLQIDSRRKR----
DNAA_PROMP       DEFGGKDHTTVMYAIEQVEKKLSSDPN---------VASQVQKIKDLLQIDSRKNL----
DNAA_SYNY3       EAFGGKDHTTVMYSCDKITQLQQKDWE---------TSQTLTSLSHRINIAGQAPES---
DNAA_STRPN       KEFGGKDHTTVIHAHAKIKSLIDQDDN---------LRLEIESIKKKIK-----------
DNAA_STRP1       KEFGGRDHSTVLHAYNKIKNMISQDES---------LRIEIETIKNKIK-----------
DNAA_LACLA       TAFGGRDHTTVMYAYKQISDKMKNDMD---------VQKDIDSIKRKF------------
DNAA_BUCAI       EAFSGRDHTTVLHACCKIEQLRKENHD---------IKKDFLNLIRTLSK----------
DNAA_BUCAP       DAFSGRDHTTVLHACRKIEQLRKENHD---------IKEDFSNLIRTLSV----------
DNAA_ECOLI       DAFGGRDHTTVLHACRKIEQLREESHD---------IKEDFSNLIRTLSS----------
DNAA_SALTY       DAFGGRDHTTVLHACRKIEQLREESHD---------IKEDFSNLIRTLSS----------
DNAA_SERMA       DAFGGRDHTTVLHACRKIEQLREESHD---------IKEDFSNLIRTLSS----------
DNAA_PROMI       DAFGGRDHTTVLHACRKIEQLREESHD---------IKEDFSNLIRTLSS----------
DNAA_VIBCH       DAFGGRDHTTVLHACRKIEQLREESHD---------IKEDYSNLIRTLSS----------
DNAA_VIBHA       DAFGGRDHTTVLHACRKIEQLREESHD---------IKEDYSNLIRTLSS----------
DNAA_PSEAE       VAFGGRDHTTVLHACRKIAQLRESDAD---------IREDYKNLLRTLTT----------
DNAA_PSEPK       DMFGGRDHTTVLHACRKINELKESDAD---------IREDYKNLLRTLTT----------
DNAA_HAEIN       RAF-DRDHTTVLNACREVPKFREQDNS---------IQEDWANLIRTLSA----------
DNAA_PASMU       KNFGDKDHTTVLHACRKIAELREQEHS---------LEEDWSNLIRTLSV----------
DNAA_XYLFA       DAFAGRDHTTVLHACRQIKLLMETETK---------LREDWDKLMRKFSE----------
DNAA_NEIMA       DSFGGRDHTTVMHGIRAVAKLREEDPE---------LAQDYEKLLILIQN----------
DNAA_NEIMB       DSFGGRDHTTVMHGIRAVAKLREEDPE---------LAQDYEKLLILIQN----------
DNAA_CAUVC       RRFGGRDHTTVLHAVRRIEALRAEDSA---------LSHDLETLTRKLRG----------
DNAA_RHIME       RRFGGRDHTTVLHAVRKIEELISADTK---------LSHEIELLKRLINE----------
DNAA_RICPR       KKFGKKDHTTVMHAIKKVEELLENDIE---------LREEINLLMKILQN----------
DNAA_ZYMMO       QRFGGRDHTTVIHAIRQIEKLRITDED---------VDSDVRLLMRQFEG----------
DNAA2_CHLMU      AAFG-KTHSTVLYACKTIEQKIEKDAL---------LKNQISLCKNNIAIDSPQHFV---
DNAA2_CHLTR      AAFG-KTHSTVLYACKTIEQKIEKDAL---------LKNQISLCKNNIAIDSPQHFV---
DNAA2_CHLPN      AAFG-KTHSTVLYACKTIEHKLQNDET---------LKRQVNLCKNHIVG----------
DNAA_AQUAE       RAFKRKDHTTVIHAIRSVEEEKKKDRK---------FKHLVGFLEKQAFDKIC-------
DNAA_THEMA       EKFNRSHPVVVDSVKKVKDSLLKGNKQ---------LKALIDEVIGEISRRALSG-----
DNAA_HELPY       QFLDLKDHSSISKMYSGVKKMLEEEKSPFVLSLREEIKNRLNELNDKKTAFNSSE-----
DNAA_HELPJ       QFLDLKDHSSISKMYSSVKKMLEEEKSPFILSLREEIKNRLNELNDKKTAFNSSE-----
DNAA_CAMJE       NYFEMKDHTAISHNVKKITEMIENDAS---------LKAKIEELKNKILVKSQS------
DNAA1_CHLMU      EVFS-RDHSTVISSIRAISQKLDEDDRE------SDVSCGVQELTKRLSSAYQSLDLIVD
DNAA1_CHLTR      EVFS-RDHSTVISSIRAISQKLEEDDRE------CDVSRAIQELTKRLSSAYQSLDFIED
DNAA1_CHLPN      DVFS-RDHSTVISSIRLIEQKIEENS--------HDIHMAIQDISKNLNSLHKSLEFFPS
DNAA_ACHLA       SLFNDRDHSTVLSACEKVERDMRMDSN---------LKFAVDSIVKK-------------
DNAA_MYCCT       EEFGGRDHTTVINAERKIEMMLKKDKQ---------LKKTVDILKNKILTK---------
DNAA_SPICI       TEFGGKDHTTVMNSVKKVEAHISTNKE---------FKHLVNAIRRKIEGR---------
DNAA_MYCGE       KIFK-RSHSSVLMAVKRVAKMIENDSS---------LRDVITSLVI--------------
DNAA_MYCPN       KIFK-RNHSTVVAAVKRVAKMIEKDDS---------LQDIITSLVI--------------
DNAA_UREPA       KLLNGREHTTISHSISKVQKILDDENSQ--------EALQINLIINKF------------
                   :       :                                                 

DNAA_TREDE       -----
DNAA_TREPA       -----
DNAA_BORBU       -----
DNAA_BACHD       -----
DNAA_BACSU       -----
DNAA_STAAM       -----
DNAA_DEIRA       -----
DNAA_THET8       -----
DNAA_STRCO       -----
DNAA_STRRE       -----
DNAA_STRAQ       -----
DNAA_MICLU       -----
DNAA_MYCAV       -----
DNAA_MYCPA       -----
DNAA_MYCLE       -----
DNAA_MYCTU       -----
DNAA_MYCSM       -----
DNAA_PROMA       -----
DNAA_PROMP       -----
DNAA_SYNY3       -----
DNAA_STRPN       -----
DNAA_STRP1       -----
DNAA_LACLA       -----
DNAA_BUCAI       -----
DNAA_BUCAP       -----
DNAA_ECOLI       -----
DNAA_SALTY       -----
DNAA_SERMA       -----
DNAA_PROMI       -----
DNAA_VIBCH       -----
DNAA_VIBHA       -----
DNAA_PSEAE       -----
DNAA_PSEPK       -----
DNAA_HAEIN       -----
DNAA_PASMU       -----
DNAA_XYLFA       -----
DNAA_NEIMA       -----
DNAA_NEIMB       -----
DNAA_CAUVC       -----
DNAA_RHIME       -----
DNAA_RICPR       -----
DNAA_ZYMMO       -----
DNAA2_CHLMU      -----
DNAA2_CHLTR      -----
DNAA2_CHLPN      -----
DNAA_AQUAE       -----
DNAA_THEMA       -----
DNAA_HELPY       -----
DNAA_HELPJ       -----
DNAA_CAMJE       -----
DNAA1_CHLMU      -----
DNAA1_CHLTR      -----
DNAA1_CHLPN      EEMII
DNAA_ACHLA       -----
DNAA_MYCCT       -----
DNAA_SPICI       -----
DNAA_MYCGE       -----
DNAA_MYCPN       -----
DNAA_UREPA       -----