CLUSTAL format seed alignment for MF_00378

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

EX7L_HELPY      --------------------MDVLSVSEINAQIKALLEAT--FLQVRVQGEVSNLTIHKV
EX7L_HELPJ      --------------------MHVLSVSEINAQIKALLEAT--FLQVRVQGEVSNLTIHKV
EX7L_CAMJE      -----------------------MTPTELNLKAKALLETH--FDDIVLSGEISKITLHG-
EX7L_THEMA      ------------------MKDYTYSVTEINEYIKDLIEGD--PYLTNVSVYGEISGVRPR
EX7L_BACHD      ----------------MAGHQPILTVSEVTRHLKRTIEDDPLLQDVWMRGEISNFKHHS-
EX7L_BACSU      -----------------MGEAAYVTVSALTKYIKRKFDVDPHLENIWIKGELSNVKIHT-
EX7L_LACLA      -------------------MTEYLSVSTLTKYLKAKFDRDRYLERVYLTGEISNFRRRP-
EX7L_HAEIN      ------------------MSDNIYSVSQLNSAARQMLEGN--FCQIWLTGEISNFTQPV-
EX7L_PASMU      ------------------MSEHIYSVSQLNQTVRVMLENQ--LRQVWLTGEISNFTQPV-
EX7L_ECOLI      --------------MLPSQSPAIFTVSRLNQTVRLLLEHE--MGQVWISGEISNFTQPA-
EX7L_VIBCH      -------------MSSSLANRNIYTVSRLNSEVRLLLENE--MGIVWLVGEISNFSAPV-
EX7L_PSEAE      --------MRNDPFQRLGLDREVLTVSQLNQRARLLLEDV--FPQVWVEGELSNLARPA-
EX7L_XYLFA      ----------------MQHRDEILTPSQLNTLARDLLESA--FPLVWIEGELGNVSRPS-
EX7L_NEIMA      --------------MSDFFHSDVLSVSELNAFAKSLLENH--LAGLWIAGEVSNLTRAA-
EX7L_NEIMB      --------------MSDFFHSDVLSVSELNAFAKSLLENH--LAGLWIAGEVSNLTRAA-
EX7L_CHLMU      ----------------MSITSPPVEVSVLTDSIKNLLEKN--FLRVVVKGELSNVSLQT-
EX7L_CHLTR      ----------------MSITSPPIEVSVLTDSIKNLLEKN--FLRVVVKGELSNVSLQT-
EX7L_CHLPN      ------------------MSSPPQAVASLTERIKTLLESN--FCQIIVKGELSNVSLQP-
EX7L_RICPR      ----------MIDNCIANQASKEFSVSEISNKIKELLENN--FGYIKVKGEISGLKRAS-
EX7L_ZYMMO      MNSFSFDGSDLLAKSDATDNVRAFSVSEISGALKRTVEDA--FSHIRVRGEISGFTQAG-
EX7L_MYCLE      --MTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQLAQITMRPN
EX7L_MYCTU      -----------------MTQNSAENPFPVRAVAIRVAGWIDKLGAVWVEGQLAQITMRPD
EX7L_STRCO      ----------------MAANSTPEGPLPVGEVSRLIGGWIDRLGAVWVEGQITQLSRRPG
EX7L_DEIRA      ------MTEPDSKPKKGRAGRKKAEPVRPPEQFLELAELLDYVGQVIARGVPGGVWVRAE
                                                                            

EX7L_HELPY      ------SGHAYFSLKDS-------------------QSVIKCVLFKGNANRLKFALKEGQ
EX7L_HELPJ      ------SGHAYFSLKDS-------------------QSVIRCVLFKGNANRLKFALKEGQ
EX7L_CAMJE      ------SGHWYFDLKDE-------------------RSSIACAMFKGANLKVGFKPAVGD
EX7L_THEMA      ------KGHIFFSLVEE-------------------NARLECVIFGGDNMGIRLQE--GR
EX7L_BACHD      ------RGHMYFTLKDE-------------------HAKMSAVMFAGNNRFLNFKPENGM
EX7L_BACSU      ------RGHIYFTLKDE-------------------NARMQSVMFARQSERLPFKPENGM
EX7L_LACLA      -------NHQYFALKDE-------------------GAVIQATMWAGQFRKLDFELEEGM
EX7L_HAEIN      ------SGHWYLTLKDE-------------------NAQVRCAMFRMKNLRVAFRPQNGM
EX7L_PASMU      ------SGHWYLTLKDE-------------------NAQVRCAMFRMKNMRVSFRPQNGM
EX7L_ECOLI      ------SGHWYFTLKDD-------------------TAQVRCAMFRNSNRRVTFRPQHGQ
EX7L_VIBCH      ------SGHWYLTLKDS-------------------QAQVKCAMFKGNNRLVNFKPQNGQ
EX7L_PSEAE      ------SGHVYFTLKDS-------------------NAQIRCALFRQNALRVRQALRDGL
EX7L_XYLFA      ------SGHLYVTLKDA-------------------QAQVRCAMFKPKSQWLTFQPREGL
EX7L_NEIMA      ------SGHYYFSLKDS-------------------RAQVRCAMFKGAAARLAKPLKEGD
EX7L_NEIMB      ------SGHYYFSLKDS-------------------RAQVRCAMFKGAAVRLAKPLKEGD
EX7L_CHLMU      ------SGHLYFAIKDS-------------------KAVLNGAFFHFRSKYFDRRPKDGD
EX7L_CHLTR      ------SGHLYFAIKDS-------------------KAVLNGAFFHFRSKYFDRKPKDGD
EX7L_CHLPN      ------SGHLYFGIKDS-------------------QAFLNGAFFHFKSKYYDRKPKDGD
EX7L_RICPR      ------SGHAYFNLKEN-------------------TAILACTCWRPILAKIKFPLNDGM
EX7L_ZYMMO      ------SGHCYLALKDD-------------------KAVLDSVIWRGVVSRISFRPENGM
EX7L_MYCLE      ------AKTVFMVLRDPA-----------------ADISLIVTCSRDFVLRAPVKLAEGI
EX7L_MYCTU      ------AKTVFMVLRDPA-----------------ADMSLTVTCSRDLVLSAPVKLAEGV
EX7L_STRCO      ------AGVVFLTLRDPS-----------------YDISVSVTCYRQVFDAVADVVGEGA
EX7L_DEIRA      IASLTDRRHLYLDLVQAGEGGAGGVGEVAKCRATVWARERFALEAKFRGATSGATLSAGL
                          :. : :                                          * 

EX7L_HELPY      EVVVFGGISVYVPRGDYQINCFEIEPKDIGSLTLALEQLKEKLRLKGYFDEENKLPKPHF
EX7L_HELPJ      EMVVFGGISVYAPRGDYQINCFEIEPKEIGSLTLALEQLKEKLRLKGYFDEANKLPKPNF
EX7L_CAMJE      FLELCGSVSLYPESGRYQFIATSMKKAGFGDLEAQFLALKERLQKEGLFDPRFKKSLPKF
EX7L_THEMA      MALVEGSVSVYIPHGTYRFICSNVRYLDQAGMYQIKFETTLKKLLEEGLLSRPKKTVPRF
EX7L_BACHD      KVIVRGEVNVYEPFGQYQLYALEMQPDGIGNLYLAYEQLKERLEQEGLFKEENKKPLPPV
EX7L_BACSU      KVLVRGGISVYEPSGNYQLYAKEMQPDGVGALYLAYEELKKKLAGEGLFDDRYKKQIPAF
EX7L_LACLA      KVLAVGRISIYPPSGSYSINIESLVPDGVGALAVKFEQLKKKLTAEGLFEQRWKQTLPQF
EX7L_HAEIN      QVLVRANVSLYEPRGDYQLIIDSMHPAGEGLLQQQFEALKMKLAAEGLFAQNLKKTLPHF
EX7L_PASMU      QVLVHASVSLYEPRGDYQLIIESMHPAGEGLLQQQFEALKMQLAAEGLFAQHLKKSLPPF
EX7L_ECOLI      QVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAKLQAEGLFDQQYKKPLPSP
EX7L_VIBCH      QVLVKARLSLYEPRGDYQIILESMQPEGDGRLQQQFEQLKMQLAAEGLFAQTRKKPLPEN
EX7L_PSEAE      AVKVRGKISLFEGRGDYQLIADTVEPAGDGALRLAFEALKEKLAGEGLFASERKRPLPAH
EX7L_XYLFA      RVLARGRLTLYEARGDYQIVLDHLEEAGEGALRRAFEQLRIRLEAEGLFDPARKQPLPVH
EX7L_NEIMA      HIEVSGKISIYEARGEFQITVNEVRLKGLGQLYEAYERLKAQLQAEGAFAAERKKPLPTR
EX7L_NEIMB      HIEVSGKISIYEARGEFQITVNEVRLKGLGQLYEAYERLKAQLQAEGAFAAERKKPLPVR
EX7L_CHLMU      YVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLAAEGYFDPKRKRQIPSE
EX7L_CHLTR      YVILHGKLTVYAPRGQYQIVAYALTFSGEGNLLQQFEERKQRLAAEGYFDPKRKKPLPSG
EX7L_CHLPN      AVIIHGKLAVYAPRGQYQIVAHALVYAGEGDLLQKFEETKRRLTAEGYFATEKKKPLPFA
EX7L_RICPR      EVVIGGKLSSYSGNSRYQLSVDNLQPAGLGAMLQILNERKTRLEKEGLFNKKR-IPIPFL
EX7L_ZYMMO      EVIATGRLTTYAGRSRYQLVIEQLEIAGQGALMALLDRRRRMLAEEGLFNADRKRALPFM
EX7L_MYCLE      QVVVCGKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKRPIPFL
EX7L_MYCTU      QVVVCGKPSFYTGRGTFSLRLSEIRAVGIGELLARIDRLRRLLDAEGLFDPRLKRPIPYL
EX7L_STRCO      RVVVHAKPEWYAPRGQLSLRAAEIKPVGVGELLARLEQLKKALAREGLFAAERKQPLPFL
EX7L_DEIRA      KVLLFGTAEFHPQYGFSFNVLDISPEYTLGDAALRLEAMRAELVAEGSYGLNRLLPVPTD
                     .    .   .              .               :           *  

EX7L_HELPY      PKRVAVITSQNSAAWADMKKIASKRWPMCELVCINTLMQGEGCVQSVVESIVYADSFHDT
EX7L_HELPJ      PKRVAVITSQNSAAWADMKKIASKRWPMCELVCINTLMQGEGCVQSVVESIAYADSFYDT
EX7L_CAMJE      PKKVGIITSKTSAALQDMLKLIHQKEYFLAKIYIFDALTQ----GNNAPFSLIQALKKAD
EX7L_THEMA      PRKIGIITSRDSAALQDVIRTARERKAPIEIYVFHTSVQG----DS-AREELIKALRKAN
EX7L_BACHD      ARQIAIVTSPTGAAIRDIASTIKRRFPVAQLTLLPVLVQGE---EAPHSIAKAIRQANEV
EX7L_BACSU      PATIGVVTSPTGAAVRDVITTLKRRYPLVKVIVLPALVQGE---NASRSIVTRIEEANEK
EX7L_LACLA      SKKIAVVTSPSGAVIRDIITTVQRRFPMSQIVLYPTKVQGQ---GSAEEIAGNIRRANQR
EX7L_HAEIN      SKAVGIITSSTGAALQDILHILARRDPSLKVVIYPTAVQGK---EATAEIVQMIELANAR
EX7L_PASMU      CKSVGIVTSQTGAALQDILQILRRRDPSLQVVIYPTAVQGK---EASAEIVQMIELANRR
EX7L_ECOLI      AHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGD---DAPGQIVRAIELANQR
EX7L_VIBCH      PRCVGIITSRTGAALHDILHVLKRRDPNLPVVIYPTLVQGE---EAAIQIAQAIGRANTR
EX7L_PSEAE      PRRIGIVSSPSGAVIRDIISVFRRRAPQVELTLVPTAVQGR---EAVAQIVRALQLADRQ
EX7L_XYLFA      PRRIAVITSPSGAVIRDIFSVLMRRFPLVEIELLPSLVQGD---TAAAQITHLLRCADSS
EX7L_NEIMA      PQCIGIVTSLAAAALRDVVTTLKRRAPEIPVIVYPTPVQGA---GSELQIAQAIKTASQR
EX7L_NEIMB      PQCIGIVTSLAAAALRDVVTTLKRRAPEIPVIVYPTPVQGA---GSELQIAQAIKTASQR
EX7L_CHLMU      ARTIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGP---TAAQEISRAIQVFNQE
EX7L_CHLTR      ARVIGVITSPTGAVIQDILRVLSRRCHQFQVILYPVTVQGA---TAAQEISQAIQFFNQN
EX7L_CHLPN      PQCIGVITSPTGAVIQDILRVLSRRARNYKILVYPVTVQGN---SAAHEISKAIEVMNAE
EX7L_RICPR      PDKIGVITSITGAVIKDIIHRIRERFPTRIIIWQVSVQGEN----SGHEMAEAIEGFNNL
EX7L_ZYMMO      PKIIGVVSSPSGAVIRDILHRLADRCPTHVILWPVPVQGDQ----AAAKVAAAVRGFSAL
EX7L_MYCLE      PNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGP---NAVSQIVEALRELDRN
EX7L_MYCTU      PNMIGLITGRASAAERDVTTVASARWPAARFAVRNVAVQGP---NAVGQIVEALRELDRD
EX7L_STRCO      PQLIGLVCGRASAAERDVLENARHRWPAVRFEVRNVPVQGV---HAVPQVVQAVKELDAR
EX7L_DEIRA      FARVAVIAPREAAGLGDFRREADPLEAAGLVEFHYLEATFQ----GREAGASLLRAVAAA
                   :.::    .*   *.                                          

EX7L_HELPY      K-----NAFDAIVVARGGGSMEDLYSFNDEKIADALYLAKTFSMSAIGHESDFLLSDLVA
EX7L_HELPJ      K-----NAFDAIVVARGGGSMEDLYSFNDEKIADALYLAKTFSMSAIGHESDFLLSDSVA
EX7L_CAMJE      D-----MDLDVLIIARGGGSREDLFCFNDENLAREIFKAKTPIISAIGHEIDYVISDFVA
EX7L_THEMA      E-----YDLDLVMIVRGGGSKEDLWVFNEEDVIREILRLRHPVVTGIGHEIDRVIADFVA
EX7L_BACHD      ------GGFDLLIVGRGGGSIEELWAFNEELVARAIYQSVIPIISAVGHETDYTIADFVA
EX7L_BACSU      ------EICDVLIVGRGGGSIEELWAFNEEIVARAIFASNIPIISAVGHETDFTISDFVA
EX7L_LACLA      ------GDFDVMIIGRGGGSIEDLWGFNEEIVVRAIFESRIPIISSVGHETDVTLADFVA
EX7L_HAEIN      ------QEVDVLIVGRGGGSLEDLWCFNEEEVARAIFRSTLPIISAVGHETDVTIADFVA
EX7L_PASMU      ------QEVDALIVGRGGGSLEDLWCFNEEMVARAIFHSQLPIISAVGHETDVTIADFVA
EX7L_ECOLI      ------NECDVLIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVSAVGHETDVTIADFVA
EX7L_VIBCH      ------AECDVLIVGRGGGSLEDLWCFNHEIVARTIAASEIPIISAVGHEIDVTIADFVA
EX7L_PSEAE      ------G-FDALILARGGGSLEDLWCFNEEAVARAVAACATPIVSAVGHETDVSISDFVA
EX7L_XYLFA      ------GRYDAILIARGGGSLEDLWAFNNEQLARTIAAAHTPVISAIGHETDFTLADFAA
EX7L_NEIMA      ------AECDVLIVCRGGGSIEDLWAFNEEPVVRAIEACTVPVVSGVGHETDFTLADFVA
EX7L_NEIMB      ------AECDVLIVCRGGGSIEDLWAFNEEPVVRAIESCTVPVVSGVGHETDFTLADFVA
EX7L_CHLMU      N-----IKIDTLIVARGGGSIEDLWAFNEEILVKAIAASSIPIISAVGHETDFTLCDFAA
EX7L_CHLTR      S-----MGVHALIIARGGGSIEDLWAFNEEELVKSIVASSIPIISAVGHETDFTLCDFAS
EX7L_CHLPN      N-----LA-DVLIIARGGGSIEDLWAFNEEILVKAIHASTIPIVSAVGHETDYTLCDFAS
EX7L_RICPR      ---EEIHKPSVIIVARGGGSIEDLWSFNDEILVRAAYNSKIPIISAVGHEADYTLIDLAA
EX7L_ZYMMO      KAGDAIPRPDLLIVARGGGSLEDLWPFNEEILVRAVAESSIPVISAVGHETDTTLCDYAA
EX7L_MYCLE      ------VDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVISAVGHEPDNPLCDLVA
EX7L_MYCTU      ------PDVDVIVLARGGGSVEDLLPFSDETLCRAIAACRTPVVSAVGHEPDNPLCDLVV
EX7L_STRCO      ------DDVDVIVVARGGGSVEDLLPFSDEQLVRAVAACRTPVVSAIGHEPDSPLLDLVA
EX7L_DEIRA      RELHQEKALDALFVIRGGGAVTDLAWLNDLELARALATFPAPVVTGLGHARDDTLPDEVA
                           :.: ****:  :*  :..  :           ::.:**  *  : * . 

EX7L_HELPY      DLRASTPSNAMEILLPSSD--------------------------------------EWL
EX7L_HELPJ      DLRASTPSNAMEILLPSSD--------------------------------------EWL
EX7L_CAMJE      DFRAPTPSAAIDTLFYSKL--------------------------------------DIE
EX7L_THEMA      DVSMHTPTGAAEYVIPDAS--------------------------------------EIH
EX7L_BACHD      DVRAATPTGAAELAVPDLK--------------------------------------ELI
EX7L_BACSU      DIRAATPTGAAEIAVPHTT--------------------------------------DLI
EX7L_LACLA      DSRAATPTAAAELATPNTKV-------------------------------------DLI
EX7L_HAEIN      DLRAPTPSAAAELVSRNQD--------------------------------------ELL
EX7L_PASMU      DLRAPTPSAAAELVSRDQQ--------------------------------------ALL
EX7L_ECOLI      DLRAPTPSAAAEVVSRNQQ--------------------------------------ELL
EX7L_VIBCH      DVRAPTPSAAAELVSRDHR--------------------------------------HKQ
EX7L_PSEAE      DVRAPTPSAAAELLAPNAG--------------------------------------DLQ
EX7L_XYLFA      DIRAPTPSVAAELLVPDQR--------------------------------------ALR
EX7L_NEIMA      DVRAPTPTGAAELVSPNRQ--------------------------------------ESL
EX7L_NEIMB      DMRAPTPTGAAELVSPNRQ--------------------------------------ESL
EX7L_CHLMU      DVRAPTPSAAAEIVCKSSEQYHQELQNLLRHLSSHSRQFIAAKKNLLSHWKKHLATADFY
EX7L_CHLTR      DVRAPTPSAAAEIVCKSSDQYRQELQNLRRYVLSHARQFIAAKKNLLTHWQRHLASVDFY
EX7L_CHLPN      DVRAPTPSAAAEIVCKSSEEQVQVFEGYLRHLLSHSRQLLTSKKQQLLPWRRFLDRAEFY
EX7L_RICPR      DKRAPTPTAAAEFAVPVRS--------------------------------------ILN
EX7L_ZYMMO      DLRAPTPTAAAELAVPVRS--------------------------------------ELV
EX7L_MYCLE      DLRAATPTDAAKKVVPDAA--------------------------------------VEQ
EX7L_MYCTU      DLRAATPTDAAKKVVPDTA--------------------------------------AEQ
EX7L_STRCO      DLRASTPTDAAKKVVPDVG--------------------------------------EEY
EX7L_DEIRA      CLRTDTPSKAAAYLVRTVV-----------------------------------------
                     **: *                                                  

EX7L_HELPY      QRLDGFNVKLHRSFKTLLHQKKAHLEHLVASLKRLSFE--NKHHLNALKLEKLKIALENK
EX7L_HELPJ      QRLDGFNVKLHRSFKTLLHQKKAHLEHLAASLKRLSFE--NKHHLNALKLEKLTIALDNK
EX7L_CAMJE      QSLDLMEEKLMQLWNYKIQNYENLLLNLSKFFKFNSLP--KIIDEKIKQSHNIEKQLNHL
EX7L_THEMA      EDLDSFFEKLITSLSNRFDMEERRLETLYFRLRMIGRRKLELNEFKIERVKELAAKLRKK
EX7L_BACHD      SRVNQYTERLKRAQHELLKRQKEHLQRLQKSYAFRYPA--QLVKQKELELDQQLERLTKH
EX7L_BACSU      ERTKTAEVRMTRAMQQHLGQKKERIQTLQSSYAFRFPK--RLYAQKEQQFDLAYQQFQAQ
EX7L_LACLA      NWANEQEKRLFNRLTHVIKIRRERVDKLSQSVVFRQPE--RLYDGHLQKLDRLCERLSVL
EX7L_HAEIN      QQLRHQQQRLDMAFDRLFTRKSQRLKQLALRLQNQHPQ--NQLRAQQAKNEQLTHRLQLA
EX7L_PASMU      QQLVYQRQRLEMALDRLFKQKDDRLQRLRLRLHNQHPQ--RQLSAQKQLMQQLAHRLDWS
EX7L_ECOLI      RQVQSTRQRLEMAMDYYLANRTRRFTQIHHRLQQQHPQ--LRLARQQTMLERLQKRMSFA
EX7L_VIBCH      QALHQWQAKLASTMRHYLAQQETQFARLQHKLDKQHPQ--ARLERQQQQLDELSLRLEQK
EX7L_PSEAE      QRLDGLRRRLVLRMRDQLLRERLRLEGVARRLRHPGE----RLRQQAQRLDDLDMRLRRA
EX7L_XYLFA      QHLGQLQQRLLHLQQHRLDQAIQRADQLGLRLQARNPE--MHLRLLAQRQAEAGRRLEQC
EX7L_NEIMA      HRLAQAQGRLKTVLEQRYFDASQKLDWLARQIRHPRQ----KLDEQRASIGKLAQTLSYS
EX7L_NEIMB      HRLAQAQCRLKTVLEQRYFDASQKLDWLARQIRHPRQ----KLDEQRASIGKLAQTLSYS
EX7L_CHLMU      HTAQQTLDYTRLSLERTLDAKLEHYKQHLAQYKRWLKS--DILIRVEKHLSNLNQALESA
EX7L_CHLTR      HTAQQTLDYTRAALERGIETKLEYYKQRFAQYRRWLKS--DVLIRIEKHLADLNQSLMLS
EX7L_CHLPN      TTAQQQLDSIEIAIQKGVQGKIHESKQRYDNISRWLQG--DLVSRMTCRLQSLKKMLSQA
EX7L_RICPR      NTIQSYEKILFNNTNRLIKYHEQSIVNYDKIHSYFSY----YINNRQQLLDEIGFNLLDV
EX7L_ZYMMO      NGLNNLHLRMNNAIARHAKLSEERLEAVRRRLPDGER----LLAPFIQLFDDRASQLERD
EX7L_MYCLE      RLIEDLQRRSAQALRNWVSREQRTLVQLRSRPVLAEPL--RTLTTRSEEIHRAQSAIRRE
EX7L_MYCTU      RLIDDLRRRSAQALRNWVSREQRAVAQLRSRPVLADPM--TMVSVRAEEVHRARSTLRRN
EX7L_STRCO      ERVRLLRDRARRCVAAFVDREERGLAHALARPSIQDPH--RMIEERAEQVTALLDRGRRS
EX7L_DEIRA      -------NAAAQAQEAARTIRAEAARVLVEAEAAAAWARDRALSSAVRRVDAAAAEVDAL
                                                                            

EX7L_HELPY      TLEFLRFKKTLLEKISTQTL----------------------------------------
EX7L_HELPJ      TLEFLRLKKTLLEKISTQLS----------------------------------------
EX7L_CAMJE      LANQMRYNELKLDKLQNAYL----------------------------------------
EX7L_THEMA      LMDYFEHNQKKLDSLGRMLE----------------------------------------
EX7L_BACHD      QRRMVSDAKDRLSQLEYRLK----------------------------------------
EX7L_BACSU      LTALLDRKSRQLERETYRLE----------------------------------------
EX7L_LACLA      TENKVANMKHRYELSAGKLI----------------------------------------
EX7L_HAEIN      ILRQFENTQQKFTALSVRLK----------------------------------------
EX7L_PASMU      MQAVLQQKQAQLRVLWARVE----------------------------------------
EX7L_ECOLI      LENQLKRTGQQQQRLTQRLN----------------------------------------
EX7L_VIBCH      MQQRLATQQQRWDRLSHKIE----------------------------------------
EX7L_PSEAE      FERQLAVRHERLVRLETRLA----------------------------------------
EX7L_XYLFA      LHHVLDRAQGQLRNHHTRLY----------------------------------------
EX7L_NEIMA      MKQNLRAHTARFERQTQALQ----------------------------------------
EX7L_NEIMB      MTQNVRTHTARFERQTQALK----------------------------------------
EX7L_CHLMU      IKNKLYSNKVSLHQLYTS-----------------------------------------R
EX7L_CHLTR      IKNKIYTKKTSLNQLYTS-----------------------------------------C
EX7L_CHLPN      LSHKALSLQVRCHQLKKSLTYPRQIQQASQKLSPWRQQLDTLISRRLHYQKEEYFHKHTR
EX7L_RICPR      LIRFIALKETKIKSFS--------------------------------------------
EX7L_ZYMMO      ISERMTHARHKLNFYAATLR----------------------------------------
EX7L_MYCLE      IIRLVTTETERVGHLATQLA----------------------------------------
EX7L_MYCTU      LTLMVAAETERIGHLAARLA----------------------------------------
EX7L_STRCO      LRHHLDRADSELTHTHARVV----------------------------------------
EX7L_DEIRA      MRQALGLTPQRTLARGYALV----------------------------------------
                                                                            

EX7L_HELPY      ------------------------------------------------------------
EX7L_HELPJ      ------------------------------------------------------------
EX7L_CAMJE      ------------------------------------------------------------
EX7L_THEMA      ------------------------------------------------------------
EX7L_BACHD      --------------------------RIHPEGRLRQAEQARVKLE---------------
EX7L_BACSU      --------------------------ALHPHEQLKQARTRYQEQT---------------
EX7L_LACLA      --------------------------PTY-------------------------------
EX7L_HAEIN      --------------------------QNPLPYRIQRYQQGLEQLK---------------
EX7L_PASMU      --------------------------KNPLPFTLQKQKQDLAQLK---------------
EX7L_ECOLI      --------------------------QQNPQPKIHRAQTRIQQLE---------------
EX7L_VIBCH      --------------------------LHSPIHLIRQQRFNLIQQE---------------
EX7L_PSEAE      --------------------------AQHPGRTLALLRQKLDSLA---------------
EX7L_XYLFA      --------------------------ALNPRQQIAGLQQHLKHLN---------------
EX7L_NEIMA      --------------------------HYRP--DVSVCKNNIVRLQ---------------
EX7L_NEIMB      --------------------------HCRP--DVSVCKKNIDRFQ---------------
EX7L_CHLMU      FKNELPNLQHRTQHAKHLLNQLSRRLHFVMANSQETKLQRFARLQ---------------
EX7L_CHLTR      LKNELLNLQHHTQHSRNILSQLSRRLHIAIASSQQTHQECLVRLQ---------------
EX7L_CHLPN      LKHAHNVLEQQLRSHVQKLELLGRRLSRGCELNLQNQKIAYANVK---------------
EX7L_RICPR      ------------------------KERINYAKIINYKILELTHQT---------------
EX7L_ZYMMO      -------------PALLQARIAREQARLSACRLPTGQRLVIQEQQKLDNVTRRLKQAYQQ
EX7L_MYCLE      ------------------------------------------------------------
EX7L_MYCTU      ------------------------------------------------------------
EX7L_STRCO      ------------------------------------------------------------
EX7L_DEIRA      ------------------------------------------------------------
                                                                            

EX7L_HELPY      -----------------------------------------TSPFLQTKTERLNRLENAL
EX7L_HELPJ      -----------------------------------------TSPFLQTKTERLNRLENAL
EX7L_CAMJE      -----------------------------------------QHENFFNKSKKFICIR---
EX7L_THEMA      -----------------------------------------SLNPLRPLERGFVLVKK--
EX7L_BACHD      -----------------------------------VLLKKEFQQMMERKEQQFQQAISSL
EX7L_BACSU      -----------------------------------NQLRKNMNIQMKQLHSQFQTVLGKL
EX7L_LACLA      ---------------------------------------GKIVEAKK---NKTEQLYQSL
EX7L_HAEIN      -----------------------------------VRLNFCVNRQVTERQNKLATLCGKL
EX7L_PASMU      -----------------------------------VRLDVALKRELTFKHHQFAALCTKL
EX7L_ECOLI      -----------------------------------YRLAETLRAQLSATRERFGNAVTHL
EX7L_VIBCH      -----------------------------------QRINQSIQRYLIQSRHQLALLSEKL
EX7L_PSEAE      -----------------------------------ARLPRAAREVLKDRRQRLEGLAQTL
EX7L_XYLFA      -----------------------------------PQQPLQRRLQQE--QLRLHGLVRAL
EX7L_NEIMA      -----------------------------------TALPAAFSQLLTHRRQSLTAQAALL
EX7L_NEIMB      -----------------------------------TALSHAFHQLLTHRRQSLTAQAALL
EX7L_CHLMU      -----------------------------------EEFSFMIQHLLTKAKERCQSVQEQM
EX7L_CHLTR      -----------------------------------NELSFTIHHLLTKAKERCQAIQEQA
EX7L_CHLPN      -----------------------------------ETLATILERRYENSVARYSALKEQL
EX7L_RICPR      -----------------------------------AYLFKSVNNTLKNFEYKLELNSTLL
EX7L_ZYMMO      RLSHADLRFKFLAEKLQPLLLEQRWQQKAELLAACSLKPELVTARLNIWQKNIDQLWRVA
EX7L_MYCLE      -----------------------------------------TLGPAATLARGYAIVQALE
EX7L_MYCTU      -----------------------------------------TLGPAATLARGYAIVQTVA
EX7L_STRCO      -----------------------------------------ALSPAATLKRGYAVLQRAD
EX7L_DEIRA      ----------------------------------------------------RDAAGQ--
                                                                            

EX7L_HELPY      KLAHANLKLPQFGALVSK---NNQAIELEALKRGDKIELSNEKTRASAEILSVDRV----
EX7L_HELPJ      KLAYANLKLPQFGALVSK---NHQAIELEALKRGDKIELSNEKARASAEILSVDRV----
EX7L_CAMJE      --------------------KNGKIANLEDLKSDDIVILSSQTSQKEAKIL---------
EX7L_THEMA      --------------------DEKIVKESTDLKRGDVVSLVFKDGTKKAQVIG--------
EX7L_BACHD      NLLSPLRVMERGYALPYKAKTQELIKSVKQVRMNDRLHLRVTDGQLICDVKEIESESGGE
EX7L_BACSU      NALSPLQVMERGYSLAYKE--DKLIKSVSQIEEQDRLEIKLKDGVLTCEVLEKRGEEK--
EX7L_LACLA      LLLDISKIKARGFSLVTDEK-GKIIKSVSDVKKGQTLDVELTDGKVIVEVK---------
EX7L_HAEIN      DGLSPLKVLARGYSIAEN-PQGKAIVSVKDVNQGDFITTQVADGKIVSKVL---------
EX7L_PASMU      DSISPLKVFARGYSIAQN-AQGVAITQLKQVSVGERVITRLADGEIVSQVTDLRPRS---
EX7L_ECOLI      EAVSPLSTLARGYSVTTA-TDGNVLKKVKQVKAGEMLTTRLEDGWIESEVKNIQPVKKSR
EX7L_VIBCH      DAVSPLATLARGYSVTRT-TQGELVRQSAQVKPGDTLVTQLMDGEILSTVNSR-------
EX7L_PSEAE      NVVSPLATLGRGYSILLD-ERGRAIRDAGQTQPGQRLKARLAEGELEVRVEDNHRTPVTL
EX7L_XYLFA      EAVNPLATVARGYALVHRADNNTLVRDSAQVCVGDVLDTKLAHGQLRVRVEVSST-----
EX7L_NEIMA      EAVSPQHILERGFSVVKN-TRGQVIRNADVLKQGQKLHITFADGETDVRVSKEQGQQDLF
EX7L_NEIMB      EAVSPQHILERGFSVVKN-TRGQVIRNADVLKQGQKLHIIFADGETDVRVSKEQGQQDLF
EX7L_CHLMU      ASLNPKNVLKRGFAQLFDFNKHSVIISAESLKQSDLVRVCLQDGEAVLSVKEVWLNNDKK
EX7L_CHLTR      SSLNPKNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGEAVVSVKEVWLNNDKK
EX7L_CHLPN      HSLNPKNVLKRGYAMLFDFNENSAMISVDSLQENARVRIQLQDGEAILTVTNIEICKLIK
EX7L_RICPR      ASLDYHNVLKRGFAIVKG-DAGNFLSSKSAATNEQSLNIKFFDGEINVVLSCHDLNTRSN
EX7L_ZYMMO      EQAHPDKILAKGYARVED-SHSHVVSNAHDAKTHKRLNLIFHDGSVWVAPETPPKSRKAD
EX7L_MYCLE      DGTQT--------------VTAAVLRSVDDAPTGTRLRVRVSDGAIVAVSEGRADGP---
EX7L_MYCTU      QTGPEGG------------SEPQVLRSVHDAPEGTKLRVRVADGALAAVSEGQTNGL---
EX7L_STRCO      GHAVR---------------------DPGEVEPGETLRARVSEGDFSVRVDA--------
EX7L_DEIRA      -----------------------PVTRAAGARAGEPLTLEWSDGSVPVRVE---------
                                                    :                       

EX7L_HELPY      ------------
EX7L_HELPJ      ------------
EX7L_CAMJE      ------------
EX7L_THEMA      ------------
EX7L_BACHD      GYDQK-------
EX7L_BACSU      ------------
EX7L_LACLA      ------------
EX7L_HAEIN      ------------
EX7L_PASMU      ------------
EX7L_ECOLI      KKVH--------
EX7L_VIBCH      ------------
EX7L_PSEAE      SLLD--------
EX7L_XYLFA      ------------
EX7L_NEIMA      DCI---------
EX7L_NEIMB      DCI---------
EX7L_CHLMU      G-----------
EX7L_CHLTR      G-----------
EX7L_CHLPN      G-----------
EX7L_RICPR      ------------
EX7L_ZYMMO      NPPEPPEQTSFL
EX7L_MYCLE      ------------
EX7L_MYCTU      ------------
EX7L_STRCO      ------------
EX7L_DEIRA      ------------