CLUSTAL format seed alignment for MF_00379

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MNME_THEMA      ---------------------MDTIVAVAT-PPGK--GAIAILRLSGPDS-----WKIVQ
MNME_THESQ      ---------------------MDTIVAVAT-PPGK--GAIAILRLSGPDS-----WKIVQ
MNME_THEP1      ---------------------MDTIVAVAT-PPGK--GAIAILRLSGPDS-----WKIVQ
MNME_FERNB      -----------MNILRGDNLNRDTIVALST-PPGI--GAIAIIRISGNKSL-ELTEKTIK
MNME_THEM4      --------------------MFDTIAAVSS-PHGT--GAIAVIRIDGPKS------HDIA
MNME_PSELT      --------------------MPDTIVAIST-PIGT--GAISVIRMSGSKS-----WQICQ
MNME_PETMO      -------------------MLNDTIVAISS-PIGT--GAIGVVRISGDHV------KNII
MNME_AYWBP      -------------------MFFDTIAAIST-PLGT--GGVSVIRVSGNNS-----ITEIN
MNME_ONYPE      -------------------MFFDTIAAIST-PLGT--GGVSVIRVSGNNS-----IAEIN
MNME_ACHLI      -------------------MQFQTIAAIAT-PLGT--AGISVIRVSGDEA-----ISKVN
MNME_BACAN      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGDDA-----VEKVN
MNME_BACHK      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGDDA-----VEKVN
MNME_BACCZ      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGDDA-----VEKVN
MNME_BACAH      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGDDA-----VEKVN
MNME_BACC1      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGDDA-----VEKVN
MNME_BACCR      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGDDA-----VEKVD
MNME_BACMK      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGDDA-----IEKVD
MNME_BACCN      -------------------MEFDTIAAIST-ALGE--GAIAIVRVSGEDA-----IEKVN
MNME_BACSU      ---------------------MDTIAAIST-PMGE--GAIAIVRLSGPEA-----IQIAD
MNME_BACVZ      ---------------------MDTIAAIST-PMGE--GAIAIVRLSGPEA-----VKIAD
MNME_BACP2      ---------------------MDTIAAIST-PMGE--GAIAIIRLSGPEA-----VQIAD
MNME_BACLD      ---------------------MDTIAAIST-PMGE--GAIAIVRMSGPEA-----LAIAD
MNME_GEOKA      ------------------MTEFDTIAAIST-PMGE--GAIAIVRLSGDQA-----VEIAD
MNME_GEOTN      ------------------MTEFDTIAAIST-PMGE--GAIAIVRLSGDEA-----VEIAD
MNME_LYSSC      -------------------MEFDTIAAIST-PMGE--GAIAIVRLSGDEA-----VAIAD
MNME_OCEIH      ------------------MLDTDTITAIST-PVGE--GAIAIVRLSGSEA-----ITITS
MNME_BACSK      -------------------MEMDTIAAIST-ALGE--GAIGIVRLSGDQA-----IAIGD
MNME_BACHD      -------------------MEFDTIAAIST-ALGE--GAIGIVRLSGDEA-----VQLAD
MNME_EXIS2      ------------------MMEFDTIAAIST-PMGE--GAIAIVRLSGPKA-----VETAD
MNME_STAAC      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAE      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAT      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAA3      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAA2      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAA9      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAR      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAW      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAN      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAA8      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAA1      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAM      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAS      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAAB      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIAD
MNME_STAES      -------------------MDFDTITSIST-PMGE--GAIGIVRLSGPQA-----IEIGD
MNME_STAEQ      -------------------MDFDTITSIST-PMGE--GAIGIVRLSGPQA-----IEIGD
MNME_STAHJ      -------------------MDFDTITSIST-PMGE--GAIGIVRLSGPQA-----VEIGD
MNME_STAS1      -------------------MDLDTITSIST-PMGE--GAIGIVRLSGVDA-----VDIAD
MNME_LISMO      -------------------MEFDTIAAIST-PPGE--GAIAIIRLSGPEA-----IQIAD
MNME_LISMF      -------------------MEFDTIAAIST-PPGE--GAIAIIRLSGPEA-----IQIAD
MNME_LISIN      -------------------MEFDTIAAIST-PPGE--GAIAIIRLSGPEA-----IQIAD
MNME_LISW6      -------------------MEFDTIAAIST-PPGE--GAIAIIRLSGPEA-----IQIAD
MNME_ENTFA      --------------MQSATMEFDTIAAIST-PPGE--GAISIVRLSGEQA-----VAIAN
MNME_LACP3      --------------MSASITAYDTIAAIST-PPGE--GAISIVRLSGETA-----VATAN
MNME_LACSS      --------------MPTTVTEFDTITAIST-PPGE--GAISIVRLSGDDS-----LAIIK
MNME_LACS1      -------------MATMVPTEFDTIAAIST-PPGE--GAISIVRLSGEDA-----VKIAN
MNME_LACPL      ---------------MPTTTEFDTIAAIST-PPGE--GGISIIRISGDQT-----FNVVT
MNME_LACBA      --------------MAVTTTEFDTIAAIST-PPGE--GGISIIRLSGEEV-----FQVAA
MNME_PEDPA      --------------MQTVSTEFDTIAAIST-PPGE--GGISIIRISGVDA-----LKTAS
MNME_LACLM      ---------------MTLTQEFDTIAAIST-PLGE--GAIAIVRLSGTDA-----LKIAQ
MNME_LACLS      ---------------MTLTQEFDTIAAIST-PLGE--GAIAIVRLSGTDA-----LKIAQ
MNME_LACLA      ---------------MTLTQEFDTIAAIST-PLGE--GAIAIVRLSGTDA-----LKIAQ
MNME_STRA1      ---------------MSITKEFDTIAAIST-PLGE--GAIGIVRISGTDA-----LKIAS
MNME_STRA5      ---------------MSITKEFDTIAAIST-PLGE--GAIGIVRISGTDA-----LKIAS
MNME_STRA3      ---------------MSITKEFDTIAAIST-PLGE--GAIGIVRISGTDA-----LKIAS
MNME_STRAG      ---------------MSITKEFDTIAAIST-PLGE--GAIGIVRISGTDA-----LKIAS
MNME_STRTD      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----IAIAN
MNME_STRT1      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----IAIAN
MNME_STRT2      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----IAIAN
MNME_STRMU      ----------------MITNEFDTITAIAT-PLGE--GAIGIVRISGSKA-----LAIIK
MNME_STRP8      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRPD      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRP6      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRP3      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRPG      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRP1      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRPC      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRPM      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRPF      ---------------MSITKEFDTITAIST-PLGE--GAIGIVRLSGTDA-----LAIAQ
MNME_STRGC      ----------------MITREFDTIAAIST-PLGE--GAIGIVRLSGTDS-----FAIAQ
MNME_STRSV      ----------------MITREFDTIAAIST-PLGE--GAIGIVRLSGTDS-----FAIAQ
MNME_STRR6      ----------------MITREFDTIAAIST-PLGE--GAIGIVRLSGTDS-----FAIAQ
MNME_STRP2      ----------------MITREFDTIAAIST-PLGE--GAIGIVRLSGTDS-----FAIAQ
MNME_STRPI      ----------------MITREFDTIAAIST-PLGE--GAIGIVRLSGTDS-----FAIAQ
MNME_STRPN      ----------------MITREFDTIAAIST-PLGE--GAIGIVRLSGTDS-----FAIAQ
MNME_STRSY      ----------------MITKEFDTIAAIST-PLGE--GAIGIVRLSGTDA-----FAIAS
MNME_STRS2      ----------------MITKEFDTIAAIST-PLGE--GAIGIVRLSGTDA-----FAIAS
MNME_LACGA      --------------MAQVLTQFDTIAAIST-PIGE--GGISIVRLSGEDA-----VAIAN
MNME_LACJO      --------------MAQVLTQFDTIAAIST-PIGE--GGISIVRLSGEDA-----VAIAN
MNME_LACAC      --------------MAQVLTEFDTIAAIST-PIGE--GGISIVRMSGEDA-----IKIAN
MNME_LACH4      --------------MAQTLTEFDTIAAIST-PIGE--GGISIVRMSGEDA-----VKIAN
MNME_LACDB      --------------MVQRLTEFDTIAAIST-PLGE--GGISIVRVSGEDA-----VAIVN
MNME_LACDA      --------------MVQRLTEFDTIAAIST-PLGE--GGISIVRVSGEDA-----VAIVN
MNME_MYCGE      ------------------MKSEINIFALAT-APFN--SALHIIRFSGPDV-----YEILN
MNME_MYCPN      ------------------MDTKQTMFALAT-APFN--SAIHIIRLSGPDV-----YRIIN
MNME_MYCGA      -------------MINKIMKKYETIYALAT-APYN--SAIHVIRLSGPDA-----FEIIN
MNME_UREPA      ---------------------MSTIVALAT-APMN--CAIHIIRVSGPKA-----FEIIN
MNME_UREP2      ---------------------MSTIVALAT-APMN--CAIHIIRVSGPKA-----FEIIN
MNME_MYCPE      --------------------MNDTITAIAT-PNIN--SAISIIRISGPNT-----YEIVS
MNME_MYCMS      ------------------MLINDTVVAPAT-NIST--QAIALIRVSGSEA-----FLIVN
MNME_MYCCT      ------------------MLINDTVVAPAT-NIST--QAIALIRVSGSEA-----FLIVN
MNME_MESFL      -----------------MNNLNQTIVAPTT-NIST--QAISLIRISGDDS-----FNIIN
MNME_MYCPU      --------------------MFDNIVAISSGAKVN--QAISIIRLSGPDV-----FEIMK
MNME_MYCMO      --------------------MFDTIAAIATGNSI---QAISIIRISGSDS-----FKIVK
MNME_MYCAP      -------------------MINDTITAISSGGKIN--QAISIIRVSGPDS-----VNVVK
MNME_MYCS5      ---------------MNYQSYSDTICAISSGNNIN--QPISIIRISGKNA-----QSIVS
MNME_MYCHJ      -------------------MLSDTICAIAS-GQIN--QAISIIRISGPNA-----FKIME
MNME_MYCH2      -------------------MLSDTICAIAS-GQIN--QAISIIRISGPNA-----FKIME
MNME_MYCH7      -------------------MLSDTICAIAS-GQIN--QAISIIRISGPNA-----FKIME
MNME_CAMJE      --------------------MSDTIAAIAT-AHGV--GSISIVRLSGERA-----LEFAL
MNME_CAMJJ      --------------------MSDTIAAIAT-AHGV--GSISIVRLSGERA-----LEFAL
MNME_CAMJR      --------------------MSDTIAAIAT-AHGV--GSISIVRLSGERA-----LEFAL
MNME_CAMJ8      --------------------MSDTIAAIAT-AHGV--GSISIVRLSGERA-----LEFAL
MNME_CAMJD      --------------------MSDTIAAIAT-AHGV--GSISIVRLSGERA-----LEFAL
MNME_CAMC5      ----------------MISSKNDDIAAIAT-AHGI--GSICIIRLSGSTA-----LQSAL
MNME_CAMC1      --------------------MSETIAALAT-AYGI--GSVSIVRLSGKDA-----LATSL
MNME_CAMHC      --------------------MSETIVAVAT-AHGI--GGISIVRLSGENA-----LSLSD
MNME_CAMFF      ----------------------MNIVALAS-AYGV--GSISIVRLSGDGA-----YDLAI
MNME_SULDN      -------------------MSEDTISAIAT-ANGI--GSIAIIRISGDRA-----LEIAS
MNME_ARCB4      ------------------MFENDTIVAIAT-ANGI--GSISIVRVSGAKA-----LEIAT
MNME_NITSB      ----------------MNFENNSTIAAIAT-AYGV--GSIAIVRISGPKS-----LSIAQ
MNME_SULNB      ----------------MEKKMQNTIAAIAT-AYGV--SSISIIRVSGNAA-----LDIAK
MNME_HELHP      ----------MKNTLSSMILDDSTIVAIAT-PIGV--GAISIVRLSGEKA-----YHIAL
MNME_WOLSU      ----------MISTNNSS--TPETIIALST-PSGA--GALAVVKLSGSRA-----LEIAL
MNME_HELPY      ---------MKNTSSSTTLTMNDTIAAIAT-PLGK--GAISIIKISGHNA-----LNILK
MNME_HELPJ      ---------MKNTSSSTTLTMNDTIAAIAT-PLGK--GAISIIKISGHNA-----LNILK
MNME_HELPH      ---------MKNTSSSTTLTMNDTIAAIAT-PSGK--GAISIIKISGHNA-----LNILK
MNME_HELAH      --------------------MNDTIAAVAT-PLGK--GAISIVKISGNNA-----LNILK
MNME_ECOLI      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_ECOLC      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_SHIBS      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_ECODH      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_SHIFL      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_SHIF8      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_SHIDS      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_ECO57      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_ECOUT      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_ECOL5      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_ECOK1      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_ECOL6      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_ECOSM      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_ECO24      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_ECOHS      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----FKAREVAE
MNME_SHISS      -------------MSDN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_SALCH      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKARDVAQ
MNME_SALPB      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKARDVAQ
MNME_SALTY      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKARDVAQ
MNME_SALPA      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKARGVAQ
MNME_SALTI      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKARDVAQ
MNME_SALAR      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LNAKKVAQ
MNME_CITK8      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_ENT38      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKAREVAE
MNME_KLEP7      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRISG-----LKARDVAQ
MNME_CROS8      -------------MSHN-----DTIVAQAT-PPGR--GGVGILRVSG-----QQARNVAQ
MNME_YERPA      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAASEVAH
MNME_YERPN      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAASEVAH
MNME_YERPP      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAASEVAH
MNME_YERPE      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAASEVAH
MNME_YERPS      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAASEVAH
MNME_YERP3      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAASEVAH
MNME_YERPY      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAASEVAH
MNME_YERE8      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRVSG-----RAAATVAQ
MNME_SERP5      -------------MSTT-----DTIVAQAT-PPGR--GGVGILRISG-----RGAKDVAQ
MNME_PECAS      -------------MSNT-----DTIVAQAT-PPGR--GGVGILRVSG-----QAAAEVAH
MNME_PHOLL      -------------MNTT-----DTIVAQAT-PPGR--GGVGILRVSG-----PKAAQVAE
MNME_SODGM      -------------MSQT-----DTITALAT-PPGR--GSVGILRVSG-----PLAAPVAR
MNME_ACTP2      ---------------MK-----DTIVAQAT-PIGR--GGVGILRISG-----PLAQEVAK
MNME_ACTPJ      ---------------MK-----DTIVAQAT-PIGR--GGVGILRISG-----PLAQEVAK
MNME_HAEDU      ---------------MK-----ETIVAQAT-PIGR--GGVGILRVSG-----PLAQQVAQ
MNME_HAEI8      ---------------MK-----ETIVAQAT-APGR--GGIGILRVSG-----PLATKVAQ
MNME_HAEIE      ---------------MK-----ETIVAQAT-APGR--GGIGILRVSG-----PLATEVAQ
MNME_HAEIN      ---------------MK-----ETIVAQAT-APGR--GGIGILRVSG-----PLATKVAQ
MNME_HAEIG      ---------------MK-----ETIVAQAT-APGR--GGIGILRVSG-----PLATEVAQ
MNME_MANSM      -------------MMTK-----ETIVAQAT-PIGR--GGVGILRVSG-----PLATEVAK
MNME_ACTSZ      ---------------MK-----ETIVAQAT-PIGR--GGVGILRVSG-----PLAADVAK
MNME_PASMU      ---------------MK-----ETIVAQAT-APGR--GGIGILRVSG-----PKAVEVAH
MNME_HAES1      --------------MSR-----DTIVAQAT-PIGR--GGVGILRVSG-----PLAQQVAE
MNME_HISS2      --------------MSR-----DTIVAQAT-PIGR--GGVGILRVSG-----PLAQQVAE
MNME_AERHH      --------------MTT-----DTIVAQAT-APGR--GGVGIVRVSG-----PAAEQVAE
MNME_AERS4      --------------MTT-----DTIVAQAT-APGR--GGVGIVRVSG-----PAAEQVAE
MNME_SHEB8      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKASDVAM
MNME_SHEB9      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKASDVAM
MNME_SHEB5      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKASNVAM
MNME_SHEPC      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKATDVAM
MNME_SHESW      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKATDVAM
MNME_SHESA      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKATDVAM
MNME_SHESM      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKATDVAM
MNME_SHESR      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKATDVAM
MNME_SHEON      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKATNVAM
MNME_SHEFN      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DLATNVAT
MNME_SHEDO      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DLATNVAM
MNME_SHEHH      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----DLASNVAM
MNME_SHEPA      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----DLATNVAI
MNME_SHESH      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DQASEVAM
MNME_SHEWM      --------------MTT-----DTIVAQAT-APGR--GGVGIIRISG-----DKASDVAM
MNME_SHELP      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----DKASDVAM
MNME_SHEAM      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----KLASDVAH
MNME_VIBCH      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----PLAAHVAQ
MNME_VIBC3      --------------MTT-----DTIVAQAT-ALGR--GGVGIIRVSG-----PLAAHVAQ
MNME_VIBCB      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----PKANQVAL
MNME_VIBPA      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----PKANQVAL
MNME_VIBVU      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----PQAAQVAL
MNME_VIBVY      --------------MTT-----DTIVAQAT-APGR--GGVGIIRVSG-----PQAAQVAL
MNME_ALIF1      ------------MTLHT-----DTIVAQAT-APGR--GGVGIIRVSG-----PKAKDVAL
MNME_PHOPR      ------------MNEYT-----DTIVAQAT-PPGR--GGVGIIRVSG-----PKAKEVAL
MNME_PSYIN      ------------MIKAI-----DTIVAQAT-APGR--GGVGIIRISG-----PDVEAVAK
MNME_PSEA6      -------MTVEQNTPDQ-----DTIVAQAT-ASGR--GGVGIVRVSG-----SLAAKVAE
MNME_PSEHT      -------------MINQ-----DTIAAQAT-APGR--GGVGIIRVSG-----SLAKSVAE
MNME_IDILO      ---------MQTETDFD-----DTIVAQAT-PPGR--GGVGIVRVSG-----KACKEVAE
MNME_COLP3      ----------MTSISQT-----TTIAAQAT-APGR--GGVGIIRVSG-----PEAKNVAQ
MNME_CHRSD      --------MTATPLYRQ-----DTIAAIAT-PPGR--GGVGIIRLSG-----PASRDLAE
MNME_MARMS      -------MTDFQYATDQ-----DTIAAQAT-APGR--GGVGIIRLSG-----PKSLAIAK
MNME_MARHV      ------------MQPAT-----DTIAAIAT-APGQ--AGVGIVRVSG-----PRAMAIAR
MNME_HAHCH      ------------MYAEN-----DTIVAIAT-PPGK--GGVGVVRVSG-----PKARAIAH
MNME_PSEAE      ------------MQAAT-----ETIVAIAT-AQGR--GGVGIVRVSG-----PLAGQMAV
MNME_PSEAB      ------------MQAAT-----ETIVAIAT-AQGR--GGVGIVRISG-----PLAGQIAV
MNME_PSEA7      ------------MQAAT-----ETIAAIAT-APGR--GGVGIVRVSG-----PLAGRIAV
MNME_PSEPU      ------------MNTVR-----ETIAAIAT-AQGR--GGVGIVRLSG-----PLAAKAGL
MNME_PSEP1      ------------MNTVR-----ETIAAIAT-AQGR--GGVGIVRLSG-----PLAAKAGL
MNME_PSEPK      ------------MNTVR-----ETIAAIAT-AQGR--GGVGIVRLSG-----PLAAKAGL
MNME_PSEPG      ------------MNTVR-----ETIAAIAT-AQGR--GGVGIVRLSG-----PLAGKAGQ
MNME_PSEPW      ------------MNTVR-----ETIAAIAT-AQGR--GGVGIVRLSG-----PLAAKAGQ
MNME_PSEE4      ------------MNTVR-----ETIAAIAT-AQGR--GGVGIVRLSG-----PLASQAGQ
MNME_PSEF5      ------------MNVPR-----ETIAAIAT-AQGR--GGVGIVRISG-----PLAGAAAK
MNME_PSEPF      ------------MSAPR-----ETIAAVAT-AQGR--GGVGIVRISG-----PLASVAAK
MNME_PSE14      ------------MNVPR-----ETIAAIAT-AQGR--GGVGIVRVSG-----PLAGRAAE
MNME_PSEU2      ------------MNVPR-----ETIAAIAT-AQGR--GGVGIIRVSG-----PLAGKAAE
MNME_PSESM      ------------MNVPR-----ETIAAIAT-AQGR--GGVGIVRVSG-----PLAGKTAQ
MNME_PSEMY      ------------MNHAR-----DTIAAVAT-AQGR--GGVGIVRVSG-----PLSGQLAQ
MNME_PSEU5      ------------MIPAR-----DTIAAVAT-APGR--GGVGIVRVSG-----PRARAIAI
MNME_SACD2      -----------MTTQTN-----ETIAAIAT-APGR--GGVGIIRVSG-----PKALPIAQ
MNME_HYDCU      -----------MDFSTN-----DTIAAIAT-APGR--GGVGIVRVSG-----IKAAEIAE
MNME_LEGPC      --------------MSI-----DTIVAIAT-PPGR--GGVGIVRISG-----PNAYAIAL
MNME_LEGPH      --------------MSI-----DTIVAIAT-PPGR--GGVGIVRISG-----PNAYAIAL
MNME_LEGPA      --------------MSI-----DTIVAIAT-PPGR--GGVGIVRISG-----PKAYAIAL
MNME_LEGPL      --------------MSI-----DTIVAIAT-PPGR--GGVGIVRISG-----PNAYAIAL
MNME_ALCBS      -----------MLTSSP-----DTIVAIAT-APGR--GGVGVVRLSG-----PQALSIAS
MNME_METCA      -----------MAAPDR-----DTITAIAT-PPGK--GGVGIVRISG-----SNLGPVLD
MNME_NITOC      ---------MVHYPSDRTRRLSDTIAAIAT-PPGQ--GSVGIVRVSG-----PFCRQIAE
MNME_ALKEH      --------------MAR-----TTICALAT-PPGR--GGVAVIRVSG-----PAVPAIAR
MNME_COXBU      -------------MTYVFP---ETIAAQAT-PSGR--GGIGVVRVSG-----EKTKAIAQ
MNME_COXBN      -------------MTYVFP---ETIAAQAT-PSGR--GGIGVVRVSG-----EKTKAIAQ
MNME_COXBR      -------------MTYVFP---ETIAAQAT-PSGR--GGIGVVRVSG-----EKTKAIAQ
MNME_PSYCK      MALAAPESSKNLGLSSL-----PTIAAIAT-PLGR--GGVGVIRLSG-----THAYSIAC
MNME_PSYA2      MALANPDSLKNSNLSSL-----PTIAAIAT-PLGR--GGVGVIRLSG-----TRAYSIAC
MNME_PSYWF      -------------MTHT-----TTIAAIAT-PVGR--GGVGIIRLSG-----PKAYAIAC
MNME_ACIBY      ----------MNNMHSQ-----TTIAAIAT-PPGR--GGVGVIRLSG-----PKAYDIAQ
MNME_ACIBT      ----------MNNMHSQ-----TTIAAIAT-PPGR--GGVGVIRLSG-----PKAYDIAQ
MNME_ACIAD      --MICIFLFLGFYMQYQ-----TTIAAIAT-PPGR--GGVGVIRLSG-----PKASLIAE
MNME_DICNV      -------------MIAN-----ETIAAIAT-PPGI--GGVCIIRISG-----AQAHAIAV
MNME_BORBR      --------------MSLY----APIAAIAT-APGR--GGIGVVRISG-----PDLAELAQ
MNME_BORPA      --------------MSLY----APIAAIAT-APGR--GGIGVVRISG-----PDLAELAQ
MNME_BORPE      --------------MSLY----APIAAIAT-APGR--GGIGVVRISG-----PDLAELAQ
MNME_BORPD      ------------MASSTH----VPIAAIAT-APGR--GGIGVVRISG-----PDLSALAR
MNME_BORA1      --------------MSHA----LPIAAIAT-APGR--GGIGVVRVSG-----PRLDAYIR
MNME_CUPPJ      -------------MTAPL----PPIAAIAT-APGR--GGIGVVRVSG-----PDVRPVMH
MNME_CUPNH      -------------MTAPQ----VPIAAIAT-APGR--GGIGVVRVSG-----PDVGPVMR
MNME_CUPMC      -------------MTVSQ----IPIAAIAT-APGR--GGIGVVRVSG-----PDVGAVMR
MNME_RALSO      --MTSPTVSDAASAPIRT----VPIAAIAT-APGR--GGIGVVRVSG-----PDVRAVMQ
MNME_BURM7      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURMA      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURP6      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURP0      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURMS      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURM9      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURPS      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURP1      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRLSLGRAGEAAARALSD
MNME_BURTA      ------------MLATDS----DPIVAIAT-ASGR--GGIGVVRISLGRAGEAAALALSD
MNME_BURCA      ------------MLATDS----DPIVAIAT-AAGR--GGIGVVRVSFGRGGEAAALPLID
MNME_BURCH      ------------MLATDS----DPIVAIAT-AAGR--GGIGVVRVSFGRGGEAAALPLID
MNME_BURCC      ------------MLATDS----DPIVAIAT-AAGR--GGIGVVRVSFGRGGEAAALPLID
MNME_BURL3      ------------MLATDS----DPIVAIAT-AAGR--GGIGVVRVSFGRGGEAAALPLID
MNME_BURCM      ------------MLATDS----DPIVAIAT-AAGR--GGIGVVRVSFGRGGEAAALPLID
MNME_BURA4      ------------MLATDS----DPIVAIAT-AAGR--GGIGVVRVSFGRGGEAAALPLID
MNME_BURVG      ------------MLATDS----DPIVAIAT-AAGR--GGIGVVRVSFGRGGEAAAQALSD
MNME_PARXL      ------------MLTTDS----DPIVAIAT-APGR--GGIGVVRISFGRAGEAAAQPLMQ
MNME_JANMA      -------------MNFDS----SPIAAIAT-APGR--GGIGVVRVSG-KNISSIIEAVCA
MNME_HERAR      -------------MTFDS----SPIAAIAT-APGR--GGIGVVRISG-KDLSSVMRAVCG
MNME_ACISJ      ------------MLPRHS----DPIVAIAT-APGR--GAVGIVRVSG-----KQIGALVQ
MNME_ACIAC      ------------MLPRHT----DPIAAIAT-APGR--GAVGIVRVSG-----RGIGPLVE
MNME_VEREI      --------------MRRH----DPIVAIAS-AAGR--GAIGIVRVSG-----NALGALAQ
MNME_RHOFT      -----------MSLPRHQ----DPIVAIAT-APGR--GAVGIVRVSG-----KSIGSLMQ
MNME_POLSJ      ------------MLARHH----DPIVAIAT-APGR--GAVGIVRVSG-----KDIAPVIA
MNME_POLNA      ------------MLARHH----HPIVAIAT-APGR--GGVGIVRLSG-----QRIAPVVQ
MNME_LEPCP      ------------MLPRHH----EPIAAIAT-APGR--GAVGIVRVSG-----RGLTALAT
MNME_METPP      -----------MLLPRHH----DPIVAIAT-APGR--GAVGIVRVSG-----RGLGALIE
MNME_NEIMA      -------------MSDNV----PTIAAVAT-APGR--GGVGVIRISG-----KNLLPMAQ
MNME_NEIMB      -------------MSDNV----PTIAAVAT-APGR--GGVGVIRISG-----KNLLPMAQ
MNME_NEIM0      -------------MSDNV----PTIAAVAT-APGR--GGVGVIRISG-----KNLLPMAQ
MNME_NEIMF      -------------MSDNV----PTIAAVAT-APGR--GGVGVIRISG-----KNLLPMAE
MNME_NEIG1      -------------MSDNV----PTIAAVAT-APGR--GGVGVIRISG-----KNLLPMAQ
MNME_CHRVO      -----------MNLSYTP----ATICAVAT-APGR--GGVGVIRVSG-----KDLLPFAQ
MNME_AZOSB      ---------MASKAPRPP----EAIAAIAT-APGR--GGIGVVRVSG-----AGLTGFAQ
MNME_AROAE      ---------MRSPAPSLP----DIIAALAT-APGR--GGIGVVRVSG-----AALAPFAR
MNME_DECAR      ---------------MKS----DTIAAIAT-APGR--GGVGVIRISG-----SNLLPFAF
MNME_NITEU      --------------MTSN----DTIAAIAT-PPGR--GGIGIVRISG-----TNLESLAR
MNME_NITEC      --------------MKNN----DTIAAIAT-PPGR--GGIGIVRISG-----TNLEQLAQ
MNME_NITMU      --------------MTRS----DVIAAIAT-PPGR--GGIGVVRVSG-----RNLQSLAL
MNME_THIDA      ---------MANPLPPRP----DLIAAVAT-APGR--GGVGVVRVSG-----PDVGPLAV
MNME_METFK      --------------MPVV----DTIAAIAT-APGS--GGIGVVRISG-----PSSRLIAE
MNME_POLAQ      -------------MMTRK----VPIIAVAT-APGK--AGVGVVRISG-----QGLGELVE
MNME_FRATF      -------------MYTK-----DTIVAIAT-PQGN--GGIGIIRISG-----IDALEIAE
MNME_FRATH      -------------MYTK-----DTIVAIAT-PQGN--GGIGIIRISG-----IDALEIAE
MNME_FRATO      -------------MYTK-----DTIVAIAT-PQGN--GGIGIIRISG-----IDALEIAE
MNME_FRATT      -------------MYTK-----DTIVAIAT-PQGN--GGIGIIRISG-----IDALAIAE
MNME_FRAT1      -------------MYTK-----DTIVAIAT-PQGN--GGIGIIRISG-----IDALAIAE
MNME_FRATW      -------------MYTK-----DTIVAIAT-PQGN--GGIGIIRISG-----IDALAIAE
MNME_FRATN      -------------MYTK-----DTIVAIAT-PQGN--GGIGIIRISG-----IDALAIAE
MNME_FRAP2      -------------MYTK-----DTIVAVAT-PQGN--GGIGIVRISG-----SDALSIAE
MNME_RUTMC      ------------MNSSE-----TTICALAS-GVCK--GGIGVVRVSG-----PLCKVIAK
MNME_VESOH      ------------MNSSK-----TTICALAS-SVGK--GGIGIVRVSG-----PLCKVIAK
MNME_XANAC      -----------MSMSSST----STIVAIAS-AAGI--GGVGIVRLSG------PQSVQIA
MNME_XANC5      -------------MSSSA----STIVAIAS-AAGI--GGVGIVRLSG------AQSVQIA
MNME_XANOM      -------------MSSST----STIVAIAS-AAGT--GGVGIVRLSG------PQSRQIA
MNME_XANOR      -------------MSSST----STIVAIAS-AAGT--GGVGIVRLSG------PQSRQIA
MNME_XANCP      -------------MNALP----STIVAIAT-AAGT--GGIGIVRLSG------PQSVQIA
MNME_XANC8      -------------MNALP----STIVAIAT-AAGT--GGIGIVRLSG------PQSVQIA
MNME_XANCB      -------------MNASP----STIVAIAT-AAGT--GGIGIVRLSG------PQSVQIA
MNME_XYLFA      ---------MSQRSTKMG----DTIAAIAT-ASGA--AGIGIIRLSG------SLIKTIA
MNME_XYLFT      ---------MSQRSTKMG----DTIAAIAT-ASGA--AGIGIIRISG------SQIKTIA
MNME_BLOFL      ------------MKNNEI----DTIAAIST-PIGR--GGIGIIRVSG-----KLVPEVAM
MNME_BLOPB      -------------MNYTI----DTVVAIST-PPGR--GGIGIIRISG-----KSVPEIAP
MNME_BAUCH      -------------MNLTF----DTIAAQAT-PNGR--GGIGIVRVSG-----TLTTRVAK
MNME_WIGBR      --------------MFKK----DSIVAIAT-PPGK--GGIGIIRVSG-----NLSVKIAK
MNME_BUCCC      --------------MKFF----DTIVSPAT-VIGR--SGIGIIRISG-----ISVLKIIK
MNME_BUCAI      ---------------MRN----ETIVAQVT-CPGK--SAVGILRISG-----FQTKIVAI
MNME_BUCMP      --------------MIHI----ETIVAPVT-SPGK--SAVSILRISG-----SQTKIVAK
MNME_BUCAP      --------------MIRN----DTIIAQVT-CPGK--SAVGILRVSG-----IHANQVAF
MNME_BUCBP      -------------MNVFN----DTIVSRVT-SEGK--SSVGIIRISG-----KLAFEVSI
MNME_CAUVC      --------------------MTDTIFALAT-AAGR--SAVAVVRVSG-----PRSSEIAA
MNME_CAUSK      --------------------MNDTIYAPAT-GAGA--AAVAVVRISG-----ARSADIVR
MNME_MARMM      --------------------MNTTVYALAT-PAGR--SGVAVIRLSG-----GGAGGMLD
MNME_RHORT      -------------------MTVDTIFAPAT-ARGR--AGVAIVRLSG-----PRAATALT
MNME_MAGSA      --------------------MSETIYALAS-AAGR--AGIAVWRLSG-----EGSGTALS
MNME_PARL1      ---------------------METIYALST-AAGR--AGIAVLRLSG-----PHARAALR
MNME_NITWN      -----------------MHPREQTIFALSS-GRPP--SAIAVVRASG-----SQAGTALR
MNME_NITHX      -----------------MHPREQTIFALSS-GRPP--SAIAVVRVSG-----AEAGTALQ
MNME_BRASO      -----------------MHPHDQTIFALSS-GRLP--SAIAIVRLSG-----PHAGAALQ
MNME_BRASB      -----------------MHPHDQTIFALSS-GRPP--SAIAIVRLSG-----VGAGPALQ
MNME_BRADU      -----------------MHPRDQTIFALSS-GRPP--SAIAVVRVSG-----AQAGLVLT
MNME_RHOP5      -----------------MHASDQTIFALSS-GRPP--SAIAIVRVSG-----SRGAKIVE
MNME_RHOPS      -----------------MHPSDQTIFALAT-GQLP--SAIAMVRVSG-----PRAGDLLT
MNME_RHOP2      -----------------MHPNDQTIFALAS-GRLP--SALAIVRVSG-----ARARDVLA
MNME_RHOPA      -----------------MHPSDQTIFALAT-GPLP--SAIAIVRVSG-----SRAGEVLT
MNME_RHOPB      -----------------MHSRQQTIFALSS-GRPP--AALAIVRVSG-----PEAAIVLE
MNME_METPB      -------------MTDALPVREETIFAPAS-GFGR--AAVAVVRVSG-----PAAGPALD
MNME_METRJ      ------------------MNETDTLFAPAS-GFGR--AAVAVIRISG-----PAAGGVLA
MNME_METS4      --------------------MTDTIFAPAS-GFGR--AAVAVIRISG-----PGAASCLT
MNME_AZOC5      -----------------MTRSSDTIFALSS-GRVP--SGVAVVRASG-----PRAREAGL
MNME_BEII9      ----MTHFAQAEPASLSHAATLETIFAPAS-GQGR--SAVAIVRVSG-----PKAGFLLG
MNME_RHIEC      -------------------MLSDTIYALSS-GAPP--SGVSIVRISG-----PLTRNILI
MNME_RHIL3      -----------------MAMLSDTIYALSS-GAPP--SGVSVVRVSG-----PLTRDILV
MNME_SINMW      ------------------MQFTDTIYALSS-GSPP--AGVALIRVSG-----PATADALA
MNME_RHIME      ------------------MLSTDTIYALSS-GSLP--AGVAIIRVSG-----PETADALV
MNME_AGRFC      -----------------MPDSADTIYALSS-GALP--AGVAVIRISG-----AKAFIALR
MNME_BRUC2      --------------MSEIGSYHDTIFALSS-GRLP--SGVAVIRISG-----PKTRFVYE
MNME_BRUSU      --------------MSEIGSYHDTIFALSS-GRLP--SGVAVIRISG-----PKTRFVYE
MNME_BRUA2      --------------MSEIGSYHDTIFALSS-GRLP--SGVAVIRISG-----PKTRFVYE
MNME_BRUAB      --------------MSEIGSYHDTIFALSS-GRLP--SGVAVIRISG-----PKTRFVYE
MNME_BRUME      --------------MSEIGSYHDTIFALSS-GRLP--SGVAVIRISG-----PKTRFVYE
MNME_BRUO2      --------------MSEIGSYHDTIFALSS-GRLP--SGVAVIRISG-----PKTRFVYE
MNME_BRUSI      --------------MSEIGSYHDTIFALSS-GRLP--SGVAVIRISG-----PKTRFVYE
MNME_OCHA4      --------------MSEIASLQDTIFALSS-GRLP--SGVAVVRISG-----PKVRFVLE
MNME_BARHE      ---------------------MDTIFAVSS-GLLP--SGVAVIRLSG-----SHVVHVVT
MNME_BART1      ---------------------MDTIFAVSS-GLLP--SGVAVIRLSG-----PHVVHIVK
MNME_BARQU      ---------------------MDTIFAVSS-GLLP--SGVAVIRLSG-----PHVINIVK
MNME_BARBK      ---------------------MDTIFAVSS-GLLP--SGVAVIRVSG-----PRVVDIVK
MNME_CHESB      --------------MPDQIPVRDTIFALSS-GSLP--SGIAVIRISG-----ADTRAVLE
MNME_RHILO      ------------------MISGDSIVALSS-GRLP--AGVAVLRISG-----PQTRFVVE
MNME_HYPNA      ------------------MAARDTICALAS-GPPP--SAIAIIRISG-----PAVAEIGK
MNME_GRABC      -------------------MSQETIFALAS-GAGR--AAIAVIRISG-----PATRNTVT
MNME_ACICJ      ----------------MSLAPSDVIFAPAS-GVG---GAISLLRLSG-----AGVARVIG
MNME_GLUOX      --------MTRSSLPDAPDNTPQVIFALAT-GPSR--AAIAIMRASG-----PGSDAILK
MNME_ERYLH      ---------------------METIFALSS-GAPP--AAIGVIRISG-----TEARGALE
MNME_NOVAD      --------------------MTDTIFALSS-GQPP--AGIGVIRISG-----PGAGAALS
MNME_SPHWW      -------MPPAPLENSPGASASDTIFALSS-GAPP--AGVAVVRISG-----PMAGVAID
MNME_SPHAL      ------------------------------------------MRISG-----IDAAKALQ
MNME_ZYMMO      ---------------------MKTIFALSS-GRPP--AGIAVIRISG-----SAAADTAC
MNME_RUEST      ---------------------METIFALAT-AQGK--AGVAVIRVSG-----PHAIEIGE
MNME_RUEPO      ---------------------MDTIFALAT-AQGK--AGVAVIRLSG-----PRAYHTAC
MNME_ROSDO      ---------------------MDTVFALGS-AQGR--AGVSVIRLSG-----PAAWAVAE
MNME_RHOS4      ---------------------MDTIYALAS-ARGK--AGVAVLRLSG-----PRSHEAVQ
MNME_RHOS1      ---------------------MDTIYALAS-ARGK--AGVAVLRLSG-----PRSHEAVQ
MNME_RHOS5      ---------------------MDTIYALAS-ARGK--AGVAVLRLSG-----PQAYEAVA
MNME_DINSH      ---------------------MDTIFALAS-APGK--SGVAVLRISG-----SRAFHAGR
MNME_JANSC      ---------------------MQTIFAQAT-ARGK--AGVAIIRISG-----PDAFEVGR
MNME_PARDP      ---------------------MDTIFAEAT-PPGR--GGVSVVRLSG-----PKAHATLE
MNME_RICAH      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICFE      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICRO      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICRS      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICCN      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICM5      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICCK      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICPR      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICTY      ---------------------METIFAQSS-AFGK--AGVAVFRISG-----PKSLEVLQ
MNME_RICB8      ---------------------METIFAQSS-SFGK--AGVAVFRVSG-----TKSLEVLK
MNME_RICBR      ---------------------METIFAQSS-SFGK--AGVAVFRVSG-----TKSLEVLK
MNME_ORITB      -------------------MTSKTIFAQSS-AKGK--AGVAVFRISG-----SLSLLIVE
MNME_ANAMM      ------------------MSRADTIFALST-PMGK--SGVAVIRVSG-----HDALKSMQ
MNME_ANAPZ      ----------------MVKRQTDTIFALST-AQGK--SGVAVIRISG-----PSSMEALR
MNME_EHRCJ      -------------------MIMSTIFALCT-PWGK--SGVAVIRVSG-----KDAAKAFL
MNME_EHRCR      ---------------------MTTIFALCT-PWGR--SGVAVIRISG-----EDAAKAFV
MNME_EHRRW      ---------------------MSTIFALCT-PWGK--SGVAVIRVSG-----QDAVKTFM
MNME_EHRRG      ---------------------MSTIFALCT-PWGK--SGVAVIRVSG-----QDAVKTFM
MNME_WOLTR      -----------------MMNTDETIFALST-VFGK--SGVAVIRISG-----NHALKALN
MNME_WOLPM      -----------------MTNTNETIFALST-VFGK--SGVAVIRISG-----NYALKALN
MNME_NEOSM      ---------------------MSTIYALST-VFGK--SGVAVFRISG-----PDALRALE
MNME_PELUB      ----------------------MTIYALST-GPGI--SGIAIVRVSG-----KDTKKVIK
MNME_DEIRA      ----------MTFARSSRSGLQDTIAAVAT-APGS--AGVGIVRVSG-----PRALEIAD
MNME_DEIGD      ---------------MTRTGLSDTIAAIAT-APGS--AGVGIVRISG-----PDALGIAD
MNME_THET8      ------------------MNLKDPICAIAT-PPGK--GAIGVVRLSG-----EGALEIAA
MNME_THET2      -----------------MRALRDPICAIAT-PLGK--GAIGVVRLSG-----EGALEIAA
MNME_HALHL      ---MVHTASGREVRHGLEDDDADTICAMAT-PSGQ--GGVAVVRVSG-----SRALEVAE
MNME_MYXXD      -----------------MTSSSMTIAALAT-APAA--GAVGILRLSG-----PEALDVGR
MNME_RHOBA      ----------------MTSEADDTIAAIAS-PMTP--APRGIVRLSG-----HDCIDVLC
MNME_AQUAE      --------------------MREPIVAIAT-PYGE--SAIGIVRLSG-----KGVLDLVK
MNME_MAGMM      ------------MLRTPLLHEQDCIIGMAT-PPGT--SGVAVLRLSG-----PGVLSLVV
MNME_KORVE      ------------------MNLDDTIVAIAT-PPGR--GGIGVVRLAG-----PEARTVAL
MNME_SOLUE      ------------------MLGAETIVAIAT-PPGR--AGIGMVRVSG-----PDARAIVS
MNME_CHLTR      ------------------MLRNDTITAIAT-PPGE--GSIAIVRVSG-----PDAISISD
MNME_CHLTB      ------------------MLRNDTITAIAT-PPGE--GSIAIVRVSG-----PDAISISD
MNME_CHLT2      ------------------MLRNDTITAIAT-PPGE--GSIAIVRVSG-----PDAISISD
MNME_CHLTA      ------------------MLRNDTITAIAT-PPGE--GSIAIVRVSG-----PDAISISD
MNME_CHLMU      ------------------MLQNDTIAAIAT-PPGE--GSVAIVRVSG-----PDAISISN
MNME_CHLCV      ------------------MIKNDTIAAIAT-PPGE--GSIAIVRISG-----PEAIQITD
MNME_CHLFF      ------------------MIKNDTIAAIAT-PPGE--GSIAIVRVSG-----PEAIQITD
MNME_CHLAB      ------------------MIKNDTIAAIAT-PPGE--GSIAIVRISG-----PEAIQITD
MNME_CHLPN      ------------------MLKHDTIAAIAT-PPGE--GSIAVVRLSG-----PQAIVIAD
MNME_PARUW      -----------MEFIHQPYYPGETIAAIAT-PPGE--GGVAIIRISG-----DQSLEVAA
MNME_OPITP      -----------------MPPLEDTIAALAT-PAGI--SALAILRASG-----PDTRRIAE
MNME_BDEBA      -----------MGPMIRGDRDKDTICAIST-PHGV--GGISVIRVSG-----PQTLNIVS
MNME_DESHY      --------------------MDDTIIALAT-AVGE--GSIHVLRLSG-----PQAQEIIE
MNME_ALKMQ      ------------------MFLDDTIAAIAT-AHGE--AGIGIVRISG-----EKALHIID
MNME_ALKOO      ------------------MYIDDTIAAIAT-APGE--AGIGIVRISG-----EKAIELID
MNME_CLOD6      ------------------MFIDDTIAAIAT-APGE--GGIGILRISG-----EKALKVAE
MNME_FINM2      --------------------MDDCIAAISS-ATGE--AGIGIVRMTG-----EGCADVLD
MNME_FUSNN      -------------------MLLDTIAAIST-PRGE--GGISIVRMSG-----QDSLNILE
MNME_CLOB1      ------------------MKEFDTIAAVAT-PVGE--GGISIIRISG-----DKSLDIVS
MNME_CLOBK      ------------------MKEFDTIAAVAT-PVGE--GGISIIRISG-----DKSLDIVS
MNME_CLOBH      ------------------MKEFDTIAAVAT-PVGE--GGISIIRISG-----DKSLDIVS
MNME_CLOBL      ------------------MKEFDTIAAVAT-PVGE--GGISIIRISG-----DKSLDIVS
MNME_CLOBM      ------------------MKEFDTITAVAT-PVGE--GGISIIRISG-----DKSLDIVS
MNME_CLOK5      ------------------MLEFDTITAIAT-VLGE--GGISIIRISG-----ENSLSIAN
MNME_CLOTE      ------------------MKDFDTIAAIST-VLGE--GGISIIRISG-----DKSLAIVN
MNME_CLONN      ------------------MKEFDTIAAIAT-NLGE--SGVSIIRVSG-----DKALSIVS
MNME_CLOAB      ------------------MKEFDTIAAIST-AIGN--SGISIIRVSG-----KEALSIVD
MNME_CLOPE      ------------------MKEFDTIAAIAT-ALGE--GGIAIIRVSG-----NKALEIVN
MNME_CLOP1      ------------------MKEFDTIAAIAT-ALGE--GGIAIIRVSG-----NKALEIVN
MNME_CLOPS      ------------------MKEFDTIAAIAT-ALGE--GGIAIIRVSG-----NKALEIVN
MNME_CLOB8      ------------------MKEFDTICAIAT-PIGE--GGVSIIRISG-----ENVLKIAS
MNME_LACP7      -------------------MKTDTIAAIAT-GLSN--AGISIVRISG-----DQAFAVID
MNME_THEP3      -------------------MVFDTIAAIST-FPGE--AGIGIVRLSG-----DDALEIIS
MNME_THEPX      -------------------MVFDTIAAIST-FPGE--AGIGIVRLSG-----DDALEIIS
MNME_CALS4      -------------------MEFDTIAAIST-FPGE--AGIGIVRISG-----DEALEIIS
MNME_HUNT2      ------------------MYKEDTIAAIST-PHGA--GGVGIIRISG-----DKAFEIAE
MNME_CARHZ      -------------------MMEDTIAAIST-PLGE--GGIGIVRVSG-----PGAIEAVK
MNME_DESRM      -------------------MLDDTIVAIAT-ALGE--GSIGVIRMSG-----PDAITIGK
MNME_PELTS      -------------------MLDDTIAAIST-PIGE--GGIGIVRISG-----PDAVKVAK
MNME_CALS8      -------------------MEFDTIAAIST-PIGT--GGIGIIRISG-----QNSIEVAG
MNME_SYNWW      -------------------MIGDDIAAIST-APGE--GGIAIVRLSG-----NDVIEKVE
MNME_NATTJ      -------------------MTEDTIAALST-PPGE--GGIAVIRVSG-----PDSQNKVK
MNME_DESPS      --------------MAISYADNETIAAIST-PMGT--GGIGVIRISG-----KESLTILQ
MNME_MOOTA      -------------------MLDDTIAALAT-PPGE--GGISIIRLSG-----SQAIAIVA
MNME_DESAP      -------------------MLHDTIAAVAT-PPGE--GGIGIIRISG-----PDALKIAG
MNME_ROSS1      ------------------MLYDDTIAAIAT-PPGE--GGIGIVRISG-----RDALKILE
MNME_ROSCS      ------------------MMYDDTIAAIAT-PPGE--GGIGIVRISG-----KDALSILE
MNME_CHLAA      --------------------MNDTIAAIAT-PPGE--GGIGIIRLSG-----PDAQSIAL
MNME_SYMTH      -------------------MGEETIAAIAT-GAGE--GGIGIVRISG-----ADALQVAE
MNME_HELMI      -------------------MVGDTIAAVAT-PPGE--GGIGIVRVSG-----PGARDVLK
MNME_GEOSL      ------------------MYVEDTIAAIST-AAGE--GGVGIVRVSG-----PDAPSIAR
MNME_GEOMG      ------------------MYLEDTIAAIGT-PVGE--GGIGIIRVSG-----PDVPAIAR
MNME_GEOUR      ------------------MYVQDTIAAIST-PTGE--GGVGIIRVSG-----RHVLSIAD
MNME_PELPD      ------------------MYMRDTIAAIST-PPGN--GGIGIIRISG-----GSASCIAE
MNME_PELCD      ------------------MINDDTIVAPAT-APGE--GGIGIVRLSG-----SGAEKLLL
MNME_SYNAS      -------------------MLKDTIAAIAT-PAGT--GGIGIVRISG-----SEAASILN
MNME_SYNFM      --------------MVELKGTHDTICAIAT-PVGE--GGIGIIKISG-----PEATAIAR
MNME_DESVH      ------------------MQHDDTIAAIAT-PLGQ--GGIGIIRISG-----PASLEVLR
MNME_DESVV      ------------------MQHDDTIAAIAT-PLGQ--GGIGIIRISG-----PASLEVLR
MNME_DESAG      ---------------MSQHHGTDTIAAVAT-PLGQ--GGVGIIRLSG-----PRSHAILT
MNME_LAWIP      --------------------MCDTIAAIAT-PSGT--GGIGIIRISG-----PKSKERLT
MNME_NOSS1      ------------------MAITGTIAAIAT-AIVPQQGSVGIVRVSG-----SQAIAIAQ
MNME_TRIV2      --------------MTQLLAITGTIAAIAT-AIVPQQGSVGIVRVSG-----SQAIAIAQ
MNME_TRIEI      -------------MVITEMTPRNTIAAIAT-AIVPQQGSVGIVRMSG-----SEAMKIAQ
MNME_ACAM1      -------------------MKQTTIAAIAT-AIVPQQGSIGIVRLSG-----VEAVSIAK
MNME_SYNY3      ------------------MQLEDTIAAIAT-AIVPQQGSIGVVRLSG-----PQSLTIAK
MNME_MICAN      -----------------MLNTGDTIAAIAT-AIVPEQGSIGIVRLSG-----SEAVAIAR
MNME_SYNP2      ------------------MNLGDTIVAIAS-AVVPNQGSIGIVRLSG-----AAALPIAR
MNME_SYNE7      ----------------MVGFSGDTIAAIAT-AIVPQQGSVGIVRLSG-----AAATEIAR
MNME_SYNP6      ----------------MVGFSGDTIAAIAT-AIVPQQGSVGIVRLSG-----AAATEIAR
MNME_THEEB      -----------------MRHFHDTIAAIAT-AIVPQQGSIGIVRLSG-----AKAVAIAQ
MNME_SYNJA      --------------MDLTAPLADTIAAIAT-AVVPEQGSIGIVRLSG-----SRALAIAQ
MNME_SYNJB      --------------MDPTAPLADTIAAIAT-AVVPEQGSVGIVRLSG-----SRALPIVQ
MNME_GLOVI      --------------------MSDTICAIAT-AIVPQQGSVGIVRLSG-----SEALALAK
MNME_PROM1      --------------MNSFSPTEDTIAAIAT-AVSPGQGSIAAIRISG-----SSAIETSK
MNME_PROMT      --------------MNSFSPTEDTIAAIAT-AVSPGQGSIAAIRISG-----SSAIETSK
MNME_PROMA      --------------MDLAFSTEENIAAIAS-AVAPGQGAIAIVKVSG-----ASAKEVVK
MNME_PROM3      -------------MMSSPIPHQQTIAAVAT-AVAPGQGGIAVVRLSG-----PAAEVVGR
MNME_PROMM      -------------MMSSPIPHQQTIAAVAT-AVAPGQGGIAVVRLSG-----PAAEVVGR
MNME_SYNSC      ------------------MPSTDTIAAVAT-AVAPGQGGIAVIRLSG-----PAAEATGR
MNME_SYNPX      ------------------MNASDTIAAVAT-AVAPGQGGIAVVRVSG-----PAAEATGR
MNME_SYNS9      ------------------MPPLDTIAAVAT-AVAPGQGGIAVIRLSG-----PVAEQVAQ
MNME_SYNPW      -------------MQEINRD-AQTIAAVAT-AVAPGQGGIAVIRLSG-----PQAQAAVQ
MNME_SYNS3      -------------MSGIGPDQALSIAAIAT-AVAPGQGGIAVIRLSG-----PSAVRAVA
MNME_SYNR3      ---------------MSLAARDDTIAAIAT-AVAAGAGSVAIVRISG-----PQAEAIGR
MNME_PROMS      --------------MDSIVTTEDTIAAIAS-AISIGKGGVAIIRVSG-----KDAINSCK
MNME_PROM0      --------------MDSIVTTEDTIAAIAS-AISIGKGGVAIIRVSG-----KDAINSCK
MNME_PROM2      --------------MDSIVTTEDTIAAIAS-AISIGKGGVAIIRVSG-----KDSINSCK
MNME_PROM9      --------------MDSIVTTEDTIAAIAS-AISIGKGGVAIIRVSG-----KDSINSCK
MNME_PROM5      --------------MESIVDTEDTIAAIAS-AISLGKGGIAVIRVTG-----EEAINSCK
MNME_PROMP      --------------MESIIDTEDTIAAIAS-AVSLGKGGIAVIRVSG-----EEAINSCK
MNME_CYACA      ------------------MYKRDTIAAIAT-CPNG--GGVSILRLSG-----SKSIDVVK
MNME_CYAM1      -------------MTLANVFIQDTIVAIAT-YLAP--SSVAIIRLSG-----NEAIRLAK
MNME_BACFR      -------------------MNQDTICAIAT-AQG---GAIGSIRVSG-----PEAITITG
MNME_BACFN      -------------------MNQDTICAIAT-AQG---GAIGSIRVSG-----PEAITITG
MNME_BACTN      -------------------MNQDTICAIAT-AQG---GAIGSIRVSG-----PEAISITS
MNME_BACV8      ----------------MKMINQDTICAIAT-AQG---GAIGIIRVSG-----PKAIEITS
MNME_PARD8      ---------------------MSTICAIST-APGV--GGIAVIRVSG-----PDTFKICD
MNME_PORGI      -------------MSILHSFNKDTICAVAT-APGV--GGIAVIRVSG-----ADAFRLVS
MNME_FLAJ1      ------------------MINQDSIVALAT-PSGA--GAIAVIRISG-----AEAVSIGN
MNME_FLAPJ      ------------------MIYHDTIVALAT-PSGA--GAIAVIRISG-----NNAITIAS
MNME_GRAFK      ------------------MKLNDTIVALAT-PSGA--GAIAIIRVSG-----PDALEIVA
MNME_CYTH3      ------------MSTTTVTNHTDTIVALAS-PQGI--GAIGVIRLSG-----PQAFDITS
MNME_SALRD      ------------------MSQSDTIAAIAT-ARGR--AALAVVRTSG-----PAAIEIVD
MNME_CHLTE      ----------MSPSDLHLPVPGHPIAAIAT-PVGV--GALAIVRISG-----AGVLDLAD
MNME_CHLPD      ---------MQQETGIHPIVQCDPIAAIAT-PLGV--GALAVVRISG-----ATAFDIAG
MNME_CHLPM      -----------MTERPLTPEAGEAIAAIAT-PVGV--GALAIVRMSG-----RGVLEIAD
MNME_PELLD      -----------MPASVVLQQPDIPIAAIAT-PVGV--GALAIVRMSG-----KGVFGIAD
MNME_CHLCH      -------------MRNSLSFQDEPIVALAT-PLGV--GALAVVRMSG-----QGVFDIAR
MNME_BORAP      --------------MSKLFERDDDIVALAT-PFLS--SALCVIRSSG-----ASSISKFS
MNME_BORBU      --------------MSKFFERDDDIVALAT-PFLS--SALCVIRSSG-----ASSISKFS
MNME_BORBP      --------------MSNLFQRDDDIVALAT-PFLS--SALCVIRSSG-----ASSIPKFS
MNME_TREPA      -------------MRAHEYALDDDIVAIAT-ALSP--AALGIVRTSG-----SSSIERVA
MNME_TREDE      -------------MQIGKYSLGDPIAAIAT-ALSP--AALGIVRTSG-----EGAIDLAS
MNME_LEPBJ      --------------------MNDTIAAVST-ASGP--GAIGIIRMSG-----PGALSISS
MNME_LEPBL      --------------------MNDTIAAVST-ASGP--GAIGIIRMSG-----PGALSISS
MNME_LEPIN      --------------------MNDTIAAVST-SSGA--GAIGIIRMSG-----PEALTISS
MNME_LEPIC      --------------------MNDTIAAVST-SSGA--GAIGIIRMSG-----PEALTISS
MNME_LEPBA      --------------------MIDTIAALST-AQGP--GAIGILRVSG-----SLVMPIAL
MNME_LEPBP      --------------------MIDTIAALST-AQGP--GAIGILRVSG-----SLVMPIAL
MNME_UNCTG      ----------------MNYLKEDTIAALST-AAGK--SAIAVIRLSG-----ENSFQIIG
MNME_SULMW      -----------------MLKNDDTIVAIAT-PSGY--GAIAVIRISGNNS-----IKIIK
MNME_CARRP      ---------------------MNTIFSRIT-PLGN--GTLCVIRISGKN---------VK
                                                           :                

MNME_THEMA      KHLRT----------------------RSKIVPRKAIHGWIHEN----------------
MNME_THESQ      KHLRT----------------------RSKIVPRKAIHGWIHEN----------------
MNME_THEP1      KHLRT----------------------RSEIVPRKAIHGWIHEN----------------
MNME_FERNB      NKKIN----------------------IKTLEERRINHGYFYDEN---------------
MNME_THEM4      KKLTG----------------------LNKVEYRRVYTTYLNFE----------------
MNME_PSELT      NVLLR----------------------KTKIEPRKAFHNYVKDSD---------------
MNME_PETMO      DQALK----------------------RKKYTPKKMYYGWLYDKE---------------
MNME_AYWBP      KIFKG--------------------KNLIKAKTHTITHGFILN-----------------
MNME_ONYPE      KIFKG--------------------KDLTKTKTHTITHGFILN-----------------
MNME_ACHLI      QIFKG--------------------KNLNKVKSHTIHYGHILN-----------------
MNME_BACAN      RIFK--------------------GKDLTEVPSHTIHYGHIVDL----------------
MNME_BACHK      RIFK--------------------GKDLTEVPSHTIHYGHIVDL----------------
MNME_BACCZ      RIFK--------------------GKDLTEVPSHTIHYGHIVDL----------------
MNME_BACAH      RIFK--------------------GKDLTEVPSHTIHYGHIVDL----------------
MNME_BACC1      RIFK--------------------GKDLTEVPSHTIHYGHIVDL----------------
MNME_BACCR      RIFK--------------------GKDLTEVPSHTIHYGHIVDL----------------
MNME_BACMK      RIFK--------------------GKDLTQVSSHTIHYGHIVDL----------------
MNME_BACCN      RIFK--------------------GKDLTAVSSHTIHYGHIVDL----------------
MNME_BACSU      KIYKGPK-----------------GKTLSSVESHTIHYGHIVDR----------------
MNME_BACVZ      KMYKGPK-----------------GKTLSSAESHTIHYGHIADS----------------
MNME_BACP2      RMYKGPK-----------------EKKLVSVDSHTIHYGHIVDA----------------
MNME_BACLD      KVYKGPR-----------------GKRLSSVDSHTINYGHIVDP----------------
MNME_GEOKA      RLFRSPS-----------------GKRLKDVPSHTIHYGHIIDP----------------
MNME_GEOTN      RLFRSPT-----------------GKQLKDVPSHTIHYGHIVDP----------------
MNME_LYSSC      KIFKSPG-----------------GKSLTTKDSHTIHYGHLVDP----------------
MNME_OCEIH      QIFE--------------------GKNLQEVPSHTIQYGKIIDP----------------
MNME_BACSK      KLFKG-------------------TKRLEDTPSHTIVYGHLMDD----------------
MNME_BACHD      RVYRG-------------------KKPLQEVPSHTIVYGHIVDP----------------
MNME_EXIS2      RVYRG-------------------ANRLTDVPTHTIHYGKLVEQ----------------
MNME_STAAC      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAE      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAT      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAA3      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAA2      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAA9      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAR      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAW      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAN      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAA8      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAA1      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAM      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAS      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAAB      KLYKG-------------------KHLLNDVPSHTINYGHIIDP----------------
MNME_STAES      ILYKG-------------------KKKLSEVETHTINYGHIIDP----------------
MNME_STAEQ      ILYKG-------------------KKKLSEVETHTINYGHIIDP----------------
MNME_STAHJ      KLYKG-------------------KKKLEDVDSHTINYGHIVDP----------------
MNME_STAS1      KLYKG-------------------KERLEDVTSHTINYGHIIDP----------------
MNME_LISMO      RIFYA-------------------KNSLSEAESHTIHYGHIKE-----------------
MNME_LISMF      RIFYA-------------------KNSLSEAESHTIHYGHIKE-----------------
MNME_LISIN      RIFYA-------------------KNSLSEAESHTIHYGHIKE-----------------
MNME_LISW6      RIFYA-------------------KKNLSEAESHTIHYGHIKE-----------------
MNME_ENTFA      KVYRSG------------------TKDLAKVPTHTIHYGHIVDP----------------
MNME_LACP3      QVFKG--------------------KDLSQVKSHTIHYGHIVDP----------------
MNME_LACSS      RVYRG--------------------KDLDKVASHTINYGHIIDP----------------
MNME_LACS1      KVFKG--------------------KNLEKVPTHTINYGHIVNP----------------
MNME_LACPL      QIFKG--------------------KDLSRVQSHTINYGHIVDP----------------
MNME_LACBA      KLFKG--------------------ADLTQVGSHTIHYGHILDP----------------
MNME_PEDPA      QIYRG--------------------KDLNKVNSHTINYGHIIDP----------------
MNME_LACLM      SVYKG--------------------KNLAQVASHTINYGHIFE-----------------
MNME_LACLS      SVYKG--------------------KNLAQVASHTINYGHIFE-----------------
MNME_LACLA      SVYKG--------------------KNLTQVASHTINYGHIFE-----------------
MNME_STRA1      KIYRG--------------------KDLSAIQSHTLNYGHIVDP----------------
MNME_STRA5      KIYRG--------------------KDLSAIQSHTLNYGHIVDP----------------
MNME_STRA3      KIYRG--------------------KDLSAIQSHTLNYGHIVDP----------------
MNME_STRAG      KIYRGLR-----------------GKDLSAIQSHTLNYGHIVDP----------------
MNME_STRTD      KVFKG--------------------KNLETVDSHTINYGHIVE-----------------
MNME_STRT1      KVFKG--------------------KNLETVDSHTINYGHIVE-----------------
MNME_STRT2      KVFKG--------------------KNLETVDSHTINYGHIVE-----------------
MNME_STRMU      KIFKG--------------------KNLDDVPSHTINYGHIVE-----------------
MNME_STRP8      SVFKG--------------------KNLEQVASHTINYGHIIDP----------------
MNME_STRPD      SVFKG--------------------KNLEQVASHTINYGHIIDP----------------
MNME_STRP6      SVFKG--------------------KNLEQVASHTINYGHIIDP----------------
MNME_STRP3      SVFKG--------------------KNLEQVASHTINYGHIIDP----------------
MNME_STRPG      SVFKG--------------------KSLEQVASHTINYGHIIDP----------------
MNME_STRP1      SVFKG--------------------KNLEQVASHTINYGHIINP----------------
MNME_STRPC      SVFKG--------------------KNLEQVASHTINYGHIIDP----------------
MNME_STRPM      SVFKG--------------------KNLEQVASHTINYGHIIDP----------------
MNME_STRPF      SVFKG--------------------KNLEQVASHTINYGHIIDP----------------
MNME_STRGC      KIFKG--------------------KDLSKVASHTLNYGHIVDP----------------
MNME_STRSV      KIFKG--------------------KNLSEVESHTLNYGHIVDP----------------
MNME_STRR6      KIFKG--------------------KDLNKVASHTLNYGHIIDP----------------
MNME_STRP2      KIFKG--------------------KDLNKVASHTLNYGHIIDP----------------
MNME_STRPI      KIFKG--------------------KDLNKVASHTLNYGHIIDP----------------
MNME_STRPN      KIFKG--------------------KDLNKVASHTLNYGHIIDP----------------
MNME_STRSY      TVFKG--------------------KDLATVPSHSLNYGHAIDP----------------
MNME_STRS2      TVFKG--------------------KDLATVPSHSLNYGHAIDP----------------
MNME_LACGA      KLFKG--------------------ADLTKVPTHTIHYGHIVDP----------------
MNME_LACJO      KLFKG--------------------ADLTQVPSHTIHYGHIVDP----------------
MNME_LACAC      EVFKG--------------------ADLAQVPTHTIHYGHIIDP----------------
MNME_LACH4      EVFKG--------------------ADLTKVPTHTIHYGHIVDP----------------
MNME_LACDB      RLFKG--------------------KDLEKVPSHTINYGHIVDP----------------
MNME_LACDA      RLFKG--------------------KDLEKVPSHTINYGHIVDP----------------
MNME_MYCGE      KITNK----------------------KITRKGMQIQRTWIVDE----------------
MNME_MYCPN      QITNK----------------------EVKPLGMRIQRVWLIDH----------------
MNME_MYCGA      KICDK----------------------QITKEGYRIQNARIVD-----------------
MNME_UREPA      KISTI----------------------KIKKETFKIWYTILKD-----------------
MNME_UREP2      KISTI----------------------KIKKETFKIWYTILKD-----------------
MNME_MYCPE      KITKK----------------------EITKTGYTFVKEFIYQ-----------------
MNME_MYCMS      KLIKD----------------------KKLEEKRGLFLRKLYF-----------------
MNME_MYCCT      KLIKD----------------------KKLEEKRGLFLRKLYF-----------------
MNME_MESFL      KLLKT----------------------KIKEEK-NVWVRKMFD-----------------
MNME_MYCPU      KIFTG----------------------KVGKDK-SITYGYIKN-----------------
MNME_MYCMO      KIFTG----------------------KIGKNK-TITYGNILNH----------------
MNME_MYCAP      KIFTG----------------------KVGTSH-TITFGNIVDNL---------------
MNME_MYCS5      KIFSG----------------------KVGENK-TITYGFIKEN----------------
MNME_MYCHJ      KIFLG----------------------KVGRSM-EITFGWIHDD----------------
MNME_MYCH2      KIFLG----------------------KVGKSM-EITFGWIHDD----------------
MNME_MYCH7      KIFLG----------------------KVGKSM-EITFGWIHDD----------------
MNME_CAMJE      KLS-----------------------HKTKLTPRHATFTKLFNQ----------------
MNME_CAMJJ      KLS-----------------------HKTKLTPRHATFTKLFNQ----------------
MNME_CAMJR      KLS-----------------------HKTKLTPRHATFTKLFNQ----------------
MNME_CAMJ8      KLS-----------------------HKTKLTPRHATFTKLFNQ----------------
MNME_CAMJD      RFS-----------------------RKTKLTPRHATFTKLFNQ----------------
MNME_CAMC5      KLT-----------------------KISNLSPRLATLTKIYSL----------------
MNME_CAMC1      KLL-----------------------KLSNLEPRYAKLAKIYSI----------------
MNME_CAMHC      ILINKNRKKNKTQNSVSSSQNRIQNFKKINLKPRYATLCELYDN----------------
MNME_CAMFF      NLC------------------------KKPLTPRYAHLRKLYCE----------------
MNME_SULDN      KIT-----------------------HKDNFTPRYASLSNIYDF----------------
MNME_ARCB4      KIS-----------------------KKNNFKARLATLSTIYDS----------------
MNME_NITSB      KLS-----------------------KKKDIQPRVAHLVTLYDD----------------
MNME_SULNB      KIS-----------------------HLEEVKPRHAHLTSLYNS----------------
MNME_HELHP      ALT-----------------------HKESLKPRYAHLCHIYDA----------------
MNME_WOLSU      KLS-----------------------RRDHLQPRHATLANLWNR----------------
MNME_HELPY      QLT-----------------------QKQDFTPRYAYVHDIFS-----------------
MNME_HELPJ      QLT-----------------------QKQDFTPRYAYVCDIFS-----------------
MNME_HELPH      QLT-----------------------KKQDFTPRYAYVRDIFS-----------------
MNME_HELAH      QLT-----------------------KKQDFTPRYAYVCDIFS-----------------
MNME_ECOLI      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECOLC      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_SHIBS      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECODH      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_SHIFL      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_SHIF8      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_SHIDS      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECO57      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECOUT      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECOL5      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECOK1      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECOL6      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECOSM      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECO24      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_ECOHS      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_SHISS      TVLG-KLPKP-----------------------RYADYLPFKDADGS-------------
MNME_SALCH      EVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_SALPB      EVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_SALTY      EVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_SALPA      EVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_SALTI      EVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_SALAR      TVLG-KLPKP-----------------------RYADYLPFKDADGA-------------
MNME_CITK8      AVLG-KLPKP-----------------------RYADYLPFKDADGT-------------
MNME_ENT38      AVLG-KLPKP-----------------------RYADYLPFNDADGT-------------
MNME_KLEP7      AVLG-KLPKP-----------------------RYADYLPFNDVDGT-------------
MNME_CROS8      AVLG-KLPKA-----------------------RYADYLPFKDADGT-------------
MNME_YERPA      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_YERPN      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_YERPP      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_YERPE      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_YERPS      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_YERP3      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_YERPY      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_YERE8      AVLG-KLPKP-----------------------RYADYLPFKDVDGS-------------
MNME_SERP5      ALLG-KLPKP-----------------------RYADYLPFRDAAGA-------------
MNME_PECAS      AVLG-KLPKP-----------------------RHADYLPFRDTNGT-------------
MNME_PHOLL      VVLG-KLPKP-----------------------RYADYLPFRDVDGQ-------------
MNME_SODGM      ALLG-KLPRP-----------------------RQAEYLPFRDDDGT-------------
MNME_ACTP2      EVLG-KELKP-----------------------RLANYLPFKDQDGT-------------
MNME_ACTPJ      EVLG-KELKP-----------------------RLANYLPFKDQDGT-------------
MNME_HAEDU      EILG-KTLTP-----------------------RLAHYLPFKDNDGE-------------
MNME_HAEI8      AILG-KCPKP-----------------------RMADYLPFKDADGT-------------
MNME_HAEIE      AILG-KCPKP-----------------------RMADYLPFKDADGT-------------
MNME_HAEIN      AILG-KCPKP-----------------------RMADYLPFKDADGT-------------
MNME_HAEIG      AILG-KCPKP-----------------------RMADYLPFKDADGT-------------
MNME_MANSM      AVVD-KELKP-----------------------RMANYLPFKDEDGT-------------
MNME_ACTSZ      AVVG-KALKP-----------------------RFANYLPFKDEDGT-------------
MNME_PASMU      TVLG-KCPKP-----------------------RMADYLPFKDSDGN-------------
MNME_HAES1      QVLG-KTLTP-----------------------RMANYLPFKDSDGT-------------
MNME_HISS2      QVLG-KTLTP-----------------------RMANYLPFKDSDGS-------------
MNME_AERHH      IVLG-KLPRV-----------------------RYAEYLPFRDEQGQ-------------
MNME_AERS4      IVLG-KLPRV-----------------------RYAEYLPFKDEQGQ-------------
MNME_SHEB8      AVLG-HLPKT-----------------------RYADYCDFKSASGQ-------------
MNME_SHEB9      AVLG-HLPKT-----------------------RYADYCDFKSASGQ-------------
MNME_SHEB5      AVLG-HLPKT-----------------------RYADYCDFKSASGQ-------------
MNME_SHEPC      AVLG-HLPKT-----------------------RYADYCDFKNATGQ-------------
MNME_SHESW      AVLG-HLPKT-----------------------RYADYCDFKNATGQ-------------
MNME_SHESA      AVLG-HLPKP-----------------------RYADYCDFKNASGQ-------------
MNME_SHESM      AVLG-HLPKP-----------------------RYADYCDFKNASGQ-------------
MNME_SHESR      AVLG-HLPKP-----------------------RYADYCDFKNASGQ-------------
MNME_SHEON      AVLG-HLPKP-----------------------RYADYCYFKSASGQ-------------
MNME_SHEFN      AIIG-HVPKT-----------------------RYAEYCDFNNADGQ-------------
MNME_SHEDO      AVLG-KVPKT-----------------------RYADYCDFKDADDR-------------
MNME_SHEHH      AVLG-HIPKT-----------------------RYADYCDFKEDSGE-------------
MNME_SHEPA      AVLG-HIPKT-----------------------RYADYCDFKDEAGE-------------
MNME_SHESH      ALLG-HIPKT-----------------------RYADYCDFKDGEGE-------------
MNME_SHEWM      AVLG-HLPKT-----------------------RYADYCDFKDAENA-------------
MNME_SHELP      AVLG-HLPKV-----------------------RYADYCDFKAADGA-------------
MNME_SHEAM      TLLG-HLPKP-----------------------RYADFCDFKAADGS-------------
MNME_VIBCH      TVTG-RTLRP-----------------------RYAEYLPFTDEDGQ-------------
MNME_VIBC3      TVTG-RTLRP-----------------------RYAEYLPFTDEDGQ-------------
MNME_VIBCB      EVTG-KTLKP-----------------------RYAEYLPFQAEDGT-------------
MNME_VIBPA      EVTG-KTLKP-----------------------RYAEYLPFQAEDGT-------------
MNME_VIBVU      EVTG-KTLKA-----------------------RYAEYLPFKAQDGS-------------
MNME_VIBVY      EVTG-KTLKA-----------------------RYAEYLPFKAQDGS-------------
MNME_ALIF1      AVIG-KELKP-----------------------RYAEYAPFKDENGL-------------
MNME_PHOPR      AVAG-RELKT-----------------------RYAEYLPFKNEDGS-------------
MNME_PSYIN      VILG-KVPKL-----------------------RFAEYLSFSDQHNE-------------
MNME_PSEA6      QIIG-HVPLI-----------------------RNAQYVPFKSNTGE-------------
MNME_PSEHT      KVVG-KIPKV-----------------------RYADYVPFKSLAGE-------------
MNME_IDILO      KLLG-HCPKP-----------------------RKAEYLPFYDLQEQ-------------
MNME_COLP3      AILG-KLPEV-----------------------RKAEYLPFLDCTSTDKTQ---------
MNME_CHRSD      RILG-HCPAP-----------------------RHAHYGPFYDADAQ-------------
MNME_MARMS      QIIG-FEPKP-----------------------RYAHYVPFKTTGQE-------------
MNME_MARHV      TMLG-FEPKP-----------------------RYAHYGPFRDRQGE-------------
MNME_HAHCH      EVLG-YDPKP-----------------------RHAHYSPFFNEEGD-------------
MNME_PSEAE      AVSG-RQLKA-----------------------RHAHYGPFLDAGGQ-------------
MNME_PSEAB      AVSG-RQLKA-----------------------RHAHYGPFLDAGGQ-------------
MNME_PSEA7      EVSG-RELKP-----------------------RHAHYGPFLDGGGQ-------------
MNME_PSEPU      LITG-RTLTP-----------------------RHAHYGPFRDDEGL-------------
MNME_PSEP1      LITG-RTLTP-----------------------RHAHYGPFRDDEGL-------------
MNME_PSEPK      LITG-RTLTP-----------------------RHAHYGPFRDDEGL-------------
MNME_PSEPG      LITG-RTLTP-----------------------RHAHYGPFRDDDGL-------------
MNME_PSEPW      LITG-RTLTP-----------------------RHAHYGPFRDQEGL-------------
MNME_PSEE4      AITG-RTLTP-----------------------RHAHYGPFRDADGL-------------
MNME_PSEF5      AISG-RELKP-----------------------RFAHYGPFLSEQEE-------------
MNME_PSEPF      AISG-RELKP-----------------------RFAHYGPFFSDNQQ-------------
MNME_PSE14      AIIG-RTLKP-----------------------RFAHYGPFVDDAGQ-------------
MNME_PSEU2      AIIG-RTLKP-----------------------RFAHYGPFVDGTGQ-------------
MNME_PSESM      AITG-RMPKP-----------------------RFAHYGPFADESGQ-------------
MNME_PSEMY      AICR-RELKP-----------------------RFAHHGPFYGEQEL-------------
MNME_PSEU5      TLSG-REPTP-----------------------RHAHYGPFHADDGE-------------
MNME_SACD2      HILG-ITPKP-----------------------RYAHYGDFCNANGD-------------
MNME_HYDCU      HVLG-KCPKP-----------------------RYAHYGPFLGAEGQ-------------
MNME_LEGPC      CLNGNKALQP-----------------------RLATFCSLYKGNNE-------------
MNME_LEGPH      CLNGNKALQP-----------------------RLATFCSLYKGNNE-------------
MNME_LEGPA      CLNGNKALQP-----------------------RLATFCSLYKGNNE-------------
MNME_LEGPL      CLNGNKALQP-----------------------RLATFCSLYKGNNE-------------
MNME_ALCBS      SIVGERLLSP-----------------------RLAHFCRFRNQDGD-------------
MNME_METCA      ALLG-RPPRP-----------------------RYAEFRHFLDADGR-------------
MNME_NITOC      QVTG-RVPPP-----------------------RYATFCHFRNRYGE-------------
MNME_ALKEH      ALAG-RLPEP-----------------------RRAVLARFCDAGGD-------------
MNME_COXBU      KILG-CVPKP-----------------------RYATFVKFRD-SGS-------------
MNME_COXBN      KILG-CVPKP-----------------------RYATFVKFRD-SGS-------------
MNME_COXBR      KILG-CVPKP-----------------------RYATFVKFRD-SGS-------------
MNME_PSYCK      TLTGKSAFKP-----------------------RMASFCRFYQADGT-------------
MNME_PSYA2      TLTGKSEFKP-----------------------RMASFCRFYQADGT-------------
MNME_PSYWF      ALTGKESFTP-----------------------RLASFCRFYDANNN-------------
MNME_ACIBY      KLTQKNLPEA-----------------------RMAGFRKFYDTDGS-------------
MNME_ACIBT      KLTQKNLPEA-----------------------RMAGFRKFYDADGS-------------
MNME_ACIAD      HLTAKTLPAA-----------------------RMAGFRQFYDAEGL-------------
MNME_DICNV      NITHKKNLVP-----------------------RQAILSHFYDLSGE-------------
MNME_BORBR      RLFG-RPLTP-----------------------RHAHYLPFRAADGE-------------
MNME_BORPA      RLFG-RPLTP-----------------------RHAHYLPFRAADGE-------------
MNME_BORPE      RLFG-RPLTP-----------------------RHAHYLPFRAADGE-------------
MNME_BORPD      RLFG-RELTP-----------------------RHAHYLPFTAETGE-------------
MNME_BORA1      ALLG-RDLTP-----------------------RHAHYLPFLAEDGE-------------
MNME_CUPPJ      AICG-QALKP-----------------------RHATYLPFLDGHGK-------------
MNME_CUPNH      SVCG-QALKP-----------------------RHATYLPFLDGHGK-------------
MNME_CUPMC      AVCG-RALQP-----------------------RHATYLPFLDARGN-------------
MNME_RALSO      AVCG-RLLPP-----------------------RQATYLPFLDADGA-------------
MNME_BURM7      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURMA      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURP6      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURP0      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURMS      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURM9      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURPS      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURP1      ALCG-ARLMP-----------------------RHASYVPFLDGAGE-------------
MNME_BURTA      ALCG-ARLTP-----------------------RHASYVPFLDGAGE-------------
MNME_BURCA      ALCG-QKLAP-----------------------RHASYVPFLDAHGA-------------
MNME_BURCH      ALCG-QKLAP-----------------------RHASYVPFLDAHGA-------------
MNME_BURCC      ALCG-QKLAP-----------------------RHASYVPFLDAHGA-------------
MNME_BURL3      ALCG-QKLAP-----------------------RHASYVPFLDEHGA-------------
MNME_BURCM      ALCG-QRLAP-----------------------RHASYVPFVDEHGA-------------
MNME_BURA4      ALCG-QQLAP-----------------------RHASYVPFVDEHGA-------------
MNME_BURVG      ALCG-QRLAP-----------------------RHASYVPFVDAHGA-------------
MNME_PARXL      ALTG-QTLAA-----------------------RRASYVPFLDASGD-------------
MNME_JANMA      T-KG-AELQP-----------------------RHATFTNFVNADGS-------------
MNME_HERAR      ADKG-SSLQA-----------------------RHATYLDFVNSDGS-------------
MNME_ACISJ      ALCG-RALKP-----------------------REATYLPFRDAAGQ-------------
MNME_ACIAC      ALCG-RALRP-----------------------REATYLPFRDAGGQ-------------
MNME_VEREI      ALCG-RALQP-----------------------RMATYLAFRDARGQ-------------
MNME_RHOFT      ALLG-RQLRA-----------------------REATYLPFLDRSQL-------------
MNME_POLSJ      AICG-RALAP-----------------------RQATYLPFRDAQGQ-------------
MNME_POLNA      ALCG-RKLSP-----------------------RQATYLPFRDAHGQ-------------
MNME_LEPCP      ALVG-RPLRP-----------------------RVASYGPFLDRQGG-------------
MNME_METPP      AVCG-RALQP-----------------------RHAHYGPFLDAQGE-------------
MNME_NEIMA      ALCG-KTPKP-----------------------RVATYADFTDEDGQ-------------
MNME_NEIMB      ALCG-KTPKP-----------------------RTATYADFTDTDGQ-------------
MNME_NEIM0      ALCG-KTPKP-----------------------RVATYADFTDADGQ-------------
MNME_NEIMF      ALCG-KTPKP-----------------------RVATYADFTDADGQ-------------
MNME_NEIG1      ALCG-KTPEP-----------------------RVATYADFTDADGQ-------------
MNME_CHRVO      AISGGKTPKP-----------------------RYATYTDFFDAHGQ-------------
MNME_AZOSB      QLCG-REPQP-----------------------RLATLARFRDADGA-------------
MNME_AROAE      ALTG-REPKP-----------------------RHAAFTHFVDAVGK-------------
MNME_DECAR      ALTE-KTPKP-----------------------RYASLADFKAADGS-------------
MNME_NITEU      GILG-KLPDP-----------------------RHAGLFSFLDQNSQ-------------
MNME_NITEC      TILG-KLPDP-----------------------RHAGLFNFLDQNNQ-------------
MNME_NITMU      KVAG-CVPEP-----------------------RRASLTRFRDENDR-------------
MNME_THIDA      AILG-RLPEP-----------------------RHVTYCRFLDRAGA-------------
MNME_METFK      AVLG-HCPPP-----------------------RHAAYLAFRDAHAL-------------
MNME_POLAQ      TLFH-RSLAP-----------------------RQATLLTFCDADNQ-------------
MNME_FRATF      KLTK-KQLKP-----------------------RYATFCNVYN-DNE-------------
MNME_FRATH      KLTK-KQLKP-----------------------RYATFCNVYN-DNE-------------
MNME_FRATO      KLTK-KQLKP-----------------------RYATFCNVYN-DNE-------------
MNME_FRATT      KLTK-KQLKP-----------------------RYATFCNVYN-DNE-------------
MNME_FRAT1      KLTK-KQLKP-----------------------RYATFCNVYN-DNE-------------
MNME_FRATW      KLTK-KQLKP-----------------------RYATFCNVYN-DNE-------------
MNME_FRATN      KLTK-KQLKP-----------------------RYATFCNVYN-DNE-------------
MNME_FRAP2      KLTK-KRLKP-----------------------RYATFCNIYN-INE-------------
MNME_RUTMC      KMLG-FVPKP-----------------------RYAHYGLFFDQEND-------------
MNME_VESOH      KMLG-FIPKP-----------------------RYAYYGLFFDQEST-------------
MNME_XANAC      AHLGIARMQP-----------------------RHAHYARFRDGHGA-------------
MNME_XANC5      AQLGIARMQP-----------------------RHAHYARFRDGQGA-------------
MNME_XANOM      VQLGVARLQP-----------------------RHAHYARFRDAQGA-------------
MNME_XANOR      VQLGVARLQP-----------------------RHAHYARFRDAQGA-------------
MNME_XANCP      AALGIAGLQS-----------------------RHARYARFRDAQGE-------------
MNME_XANC8      AALGIAGLQS-----------------------RHARYARFRDAQGE-------------
MNME_XANCB      AALGIAGLQS-----------------------RHARYARFRDAQGE-------------
MNME_XYLFA      TGLGMTTLRP-----------------------RYAHYTRFLDVQDE-------------
MNME_XYLFT      TGLGMTTLRP-----------------------RYAHYTRFLDVDDQ-------------
MNME_BLOFL      KLFNKIPKP------------------------RTAEYLTCIDHNGS-------------
MNME_BLOPB      KLLGKIPNP------------------------RKAEYLPFLDTDGS-------------
MNME_BAUCH      ELLGKVPIQ------------------------RKAEYLTFYHQNGN-------------
MNME_WIGBR      IFLKRLPKE------------------------KQAEYIPFYSKNGN-------------
MNME_BUCCC      KFLKISMKE------------------------RFAYFSSFYDVKNN-------------
MNME_BUCAI      KILGKIPLA------------------------RFATYSNFLDENNE-------------
MNME_BUCMP      KVLGSIPKA------------------------RFATYSKFLGKNSV-------------
MNME_BUCAP      AVLGKIPKP------------------------RFATYSKFFDESKK-------------
MNME_BUCBP      KVLNRDYLPI-----------------------RTACYLSFLDLSGK-------------
MNME_CAUVC      ALCGRL-PS-----------------------PRLASVRTLK------------------
MNME_CAUSK      GLAGDL-PK-----------------------PRRAVLRQLT------------------
MNME_MARMM      ALAGLPRPQ-----------------------PRMATLRALR------------------
MNME_RHORT      LLAGR-LPE-----------------------ARRATRAALRSPPSGPGPTGPGP-----
MNME_MAGSA      ALTGKPLPE-----------------------PRRARRVRLR------------------
MNME_PARL1      ALTGRKAGA-----------------------PREAMLCRFRD-----------------
MNME_NITWN      KLAGAIPA------------------------ARTAKRVLLRDS----------------
MNME_NITHX      EIAGAIPV------------------------VRTAKRVLLRDL----------------
MNME_BRASO      MLAGKMPA------------------------PRLVTRALLRDP----------------
MNME_BRASB      TLTGKLPP------------------------PRLATRALLRDD----------------
MNME_BRADU      TLAGKLPA------------------------PRQASRRLLRDG----------------
MNME_RHOP5      ALAGRLPT------------------------PRMAMRALIKDR----------------
MNME_RHOPS      ALTGSLPP------------------------PRTARRVLIRDQ----------------
MNME_RHOP2      ALTGALPP------------------------PRTVRRVRIRDV----------------
MNME_RHOPA      ALTGSLPP------------------------PRRAVRCDLRSR----------------
MNME_RHOPB      RIAGRLPP------------------------PRQAMRALLHDA----------------
MNME_METPB      QLAGGRPE------------------------PRRLSLRRLRDPG---------------
MNME_METRJ      TLGGRLPT------------------------PRRLSLRSLRDPR---------------
MNME_METS4      ALTGHPPPL-----------------------PRRLSLRQLRDPG---------------
MNME_AZOC5      ALAGLVPP------------------------PRVARYVALREPG---------------
MNME_BEII9      ALAGYCPE------------------------PRRATLAILHDPE---------------
MNME_RHIEC      RLAG-SVPA-----------------------DRSASYRTIRTR----------------
MNME_RHIL3      KLVG-SVPA-----------------------ARHVSHRTIRTR----------------
MNME_SINMW      RLCG-PLPP-----------------------ARVATLRTIRTR----------------
MNME_RHIME      RLCG-TLPP-----------------------PRIATLRTIRTR----------------
MNME_AGRFC      ALTGRDLPL-----------------------PRTASLCSIRNR----------------
MNME_BRUC2      TICQ-AIPE-----------------------PRHAALLTFRSR----------------
MNME_BRUSU      TICQ-AIPE-----------------------PRHAALLTFRSR----------------
MNME_BRUA2      TICQ-AIPE-----------------------PRHAALLTFRSR----------------
MNME_BRUAB      TICQ-AIPE-----------------------PRHAALLTFRSR----------------
MNME_BRUME      TICQ-AIPE-----------------------PRHAALLTFRSR----------------
MNME_BRUO2      TIRQ-AIPE-----------------------PRHAALLTFRSR----------------
MNME_BRUSI      TICQ-AIPE-----------------------PRHAALLTFRSR----------------
MNME_OCHA4      TIVG-SIPT-----------------------PRYAAYKLFRSR----------------
MNME_BARHE      TLCG-CLPK-----------------------ARFMHYGNLTAR----------------
MNME_BART1      TLCG-CLPK-----------------------ARFMHYGNLIAR----------------
MNME_BARQU      ALCG-HLPK-----------------------ARLMHYGNLTAR----------------
MNME_BARBK      TLCG-CLPK-----------------------ARFMHHGDLIAR----------------
MNME_CHESB      RMAG-GLSE-----------------------ARFAKLTSIYSA----------------
MNME_RHILO      TIAG-GMVK-----------------------DRVAVLRRFKAP----------------
MNME_HYPNA      SLLASGLPE-----------------------PKRAALTYIYDS----------------
MNME_GRABC      HLC-GTLP--P---------------------QRKSSLRRLRN-----------------
MNME_ACICJ      ALA-GSLP--A---------------------PRRASLRSFRD-----------------
MNME_GLUOX      ALCNGRLP--A---------------------PRRVSLRTLRH-----------------
MNME_ERYLH      ALA-GSVP--D---------------------ARKAALRRLRD-----------------
MNME_NOVAD      SLA-GRLP--S---------------------PRRATLATLADP----------------
MNME_SPHWW      RLT-GSRPRPA---------------------ARRASLRALTNP----------------
MNME_SPHAL      ALA-GRLP--T---------------------PRRASLARLTD-----------------
MNME_ZYMMO      LLT-RKKI-PE---------------------ARRAVLRNLYDP----------------
MNME_RUEST      KLTRRTLPA------------------------RGMIFSKLKDS----------------
MNME_RUEPO      LLAGPDLPS------------------------RGLSVRQLKDS----------------
MNME_ROSDO      TICGSLPDP------------------------RKSAVRVLRAQ----------------
MNME_RHOS4      AFGVPLPSL------------------------RHAALRRL-TW----------------
MNME_RHOS1      AFGVLLPPL------------------------RHAALRRL-TW----------------
MNME_RHOS5      AFGVSLPEV------------------------RRAALRRL-TW----------------
MNME_DINSH      VLAGGLPDA------------------------QRTSLRKLRDS----------------
MNME_JANSC      CLLGSLPDA------------------------GRFALRDVRTP----------------
MNME_PARDP      SLAGPVATP------------------------RMAALRALRDG----------------
MNME_RICAH      LLTGKK-AFK----------------------PRLMYYQQIIAPET--------------
MNME_RICFE      LLTGRA-DFK----------------------PRIMYYQQITVPKTIVNSASFAYKEPRV
MNME_RICRO      LLTGRK-DFK----------------------SRLMYYQQITVPET--------------
MNME_RICRS      LLTGRK-DFK----------------------SRLMYYQQITVPET--------------
MNME_RICCN      LLTGRK-DFK----------------------SRLMYYQQITVPET--------------
MNME_RICM5      LLTGRK-DFK----------------------SRLMYYQQITVPET--------------
MNME_RICCK      LLTGRK-DFK----------------------SRLMYYQQITFPES--------------
MNME_RICPR      LLTGRK-DFK----------------------PRLMYYQQIIVPET--------------
MNME_RICTY      LLTGRK-DFK----------------------PRLMYYQQIISPET--------------
MNME_RICB8      LLTGKS-NFK----------------------PRFMYYQKLTSPES--------------
MNME_RICBR      LLTGKS-NFK----------------------PRFMYYQKLTSPES--------------
MNME_ORITB      RLCGKF-NIV----------------------PRKVYYRTIRCYAT--------------
MNME_ANAMM      LLGVKE-PVR----------------------SRVATCKTLYDKKR--------------
MNME_ANAPZ      LLGVKD-DIS----------------------PRVAHCRLLHDSKG--------------
MNME_EHRCJ      HFGISS-SIK----------------------PRTATFAHLYNSKG--------------
MNME_EHRCR      HFGINS-SIK----------------------PRTATFTPLYDKDG--------------
MNME_EHRRW      HFKISN-AIK----------------------PRVATFTPLYNAAH--------------
MNME_EHRRG      HFKISN-AIK----------------------PRVATFTPLYNAAH--------------
MNME_WOLTR      HFHVNK-DMK----------------------PRFATLVDLYDSSD--------------
MNME_WOLPM      HFHIKK-EIK----------------------PRFATLVDLYDDSS--------------
MNME_NEOSM      LLGLDIKQPR----------------------PRFVYFARLFDEQL--------------
MNME_PELUB      LLTNAA-LPE----------------------TRVATLRKINKINT--------------
MNME_DEIRA      GLFRGKRRPSA---------------------TPGGRFLFGELHA---------------
MNME_DEIGD      GAFRGRRRPSA---------------------TRGGRFLFGQLVAG--------------
MNME_THET8      RVWRGKD-PRR---------------------LKGGRFALGEVVDPK-------------
MNME_THET2      RVWRGKD-PRR---------------------LKGGRFTLGEVVDPK-------------
MNME_HALHL      EVA--GPLPA------------------------PREAGLRRFRDA--------------
MNME_MYXXD      LLA--PGVPAQ---------------------PTPRHAYLASFVDA--------------
MNME_RHOBA      RMKVLDTDEAS----------------------GRRPFRSSKTLSLG-------------
MNME_AQUAE      KFFKTKRE----------------------IKPRYAHFGVLYDDKGEE------------
MNME_MAGMM      PYLYTPKGEKVAE---------------SGFKPRVMRRLNFIDPQAPDVP----------
MNME_KORVE      LMLRLANG----K---------------AELEAQRAHFAELVDPESGER-----------
MNME_SOLUE      RFVT--------S---------------IAWQPWQAHLAKLLD-QQGHE-----------
MNME_CHLTR      RIFSGNIAG---------------------YASHTAHLGTVSHN----------------
MNME_CHLTB      RIFSGNIAG---------------------YASHTAHLGTVSHN----------------
MNME_CHLT2      RIFSGNIAG---------------------YASHTAHLGTVSHN----------------
MNME_CHLTA      RIFSGNIAG---------------------YASHTAHLGTVSHN----------------
MNME_CHLMU      RIFSGNIAG---------------------YASHTAHLGTVVHN----------------
MNME_CHLCV      KIFSGSVPS---------------------FASHTAHLGIVNHK----------------
MNME_CHLFF      KIFSGPVPS---------------------FASHTAHLGTASHH----------------
MNME_CHLAB      KIFSGSVPS---------------------FSSHTAHLGTVSYN----------------
MNME_CHLPN      RIFSGSVAS---------------------FASHTIHLGQVIFE----------------
MNME_PARUW      KIFSGPIFS---------------------YRSHTAHYGQIYNSS---------------
MNME_OPITP      AILGRTPLP---------------------RRIQRVDYRDR------A------------
MNME_BDEBA      KICQFLPAH---------------------PESHKVYFGNLKN--SQT------------
MNME_DESHY      RAFTPHHPQ---------------------RWQEKSNFTLHLGYFRAG------------
MNME_ALKMQ      QVFQSK-QGKK-L---------------KDISPRRITYGHIIDTERN-------------
MNME_ALKOO      KIFKSK-DHKV-L---------------SQYKSRRITYGHIIDPKTE-------------
MNME_CLOD6      EIFKSM-SGKS-I---------------EEYNKRTLIYGNIVDNE---------------
MNME_FINM2      SVFKRA-NDK------------------ADFINRKMTYGHIVDDN---------------
MNME_FUSNN      KIFKPK-NKK--V---------------SELKNYSINYGHIIDNE---------------
MNME_CLOB1      SIFKGK-NDRT-L---------------DDIKPYSMRYGFIIEKESK-------------
MNME_CLOBK      SIFKGK-NDRT-L---------------DDIKPYSMRYGFIIEKESK-------------
MNME_CLOBH      SIFKGK-NDRT-L---------------DDIKPYSMRYGFIIEKESK-------------
MNME_CLOBL      SIFKGK-NDRT-L---------------DDIKPYSMRYGFIIEKESK-------------
MNME_CLOBM      SIFKGK-NDRS-L---------------DDIKPYSMRYGFIIEKESK-------------
MNME_CLOK5      SIFRGK-NHRD-L---------------LDIKPYSMRYGFIIEKDTG-------------
MNME_CLOTE      KLFKAK-NGKD-I---------------LDMKPYTMKYGHIIEQDTK-------------
MNME_CLONN      SIFTGK-NDRK-L---------------DDIRTYSMRYGFIIDKDTK-------------
MNME_CLOAB      KVFKGK-SKKG-I---------------IEMNTYTMRYGNIVELSNG-------------
MNME_CLOPE      KIFRGI-NGKD-L---------------LDIKPYTMRYGHMIDENN--------------
MNME_CLOP1      KIFRGI-NGKD-L---------------LDIKPYTMRYGHMIDENN--------------
MNME_CLOPS      KIFRGI-NGKD-L---------------LDIKPYTMRYGHMIDENN--------------
MNME_CLOB8      KIFTPR-NKYD-I---------------ESMKTYTMKYGNIVDLENK-------------
MNME_LACP7      KIFQTKSKAKR-L---------------SEMDSHTVHYGYIVDEE---------------
MNME_THEP3      KIFKPY-KSKD-I---------------KKVKSHTLHYGHIVDPET--------------
MNME_THEPX      KIFKPY-KSKD-I---------------KKVKSHTLHYGHIVDPET--------------
MNME_CALS4      KIFRPF-RKKD-I---------------KSVKSHTIHYGHIVDPET--------------
MNME_HUNT2      RIFR---GKKD-F---------------KLIRSHTINYGKIVNPEN--------------
MNME_CARHZ      NVFIPR-QSKD-L---------------SKVPSFTLHYGKIVDPAD--------------
MNME_DESRM      KVFRPK-YNKE-W---------------YQKDNYKIIYGHVINPET--------------
MNME_PELTS      KFFLTK--RKD-W---------------DQAGSHRLIYGHVFDRE---------------
MNME_CALS8      KIIKSK----R-F---------------NSIYDIPVRYAALVEVYDN-------------
MNME_SYNWW      RIFKPYRAGIK-L---------------SDKEGYSLSLGWLCDEKM--------------
MNME_NATTJ      QIFRSS---RT-D---------------GNFNNKKMYHGQIVSPE-T-------------
MNME_DESPS      TIFRPH---ND-S---------------CSYRSHQMYYGQIVAAD-G-------------
MNME_MOOTA      KVFKPVKGPD--L---------------TTTRSHTLRLGFIIDPVS--------------
MNME_DESAP      QVFRPVGEKD--W---------------RAGPGFRMYYGHAVDPGT--------------
MNME_ROSS1      RIFVPVRP--------------------GRWKPYQMRYGRVVDQN---------------
MNME_ROSCS      RIFVPVRP--------------------GRWKPYRMRYGHVVDGA---------------
MNME_CHLAA      RIFRPVRP--------------------GRLRSHRVRYGHVIGPD---------------
MNME_SYMTH      RIFRPRRGRP--L---------------GCRRSHTVTYGWVVTPG---------------
MNME_HELMI      AVFRPRYGRG--V---------------DDWASHTLHLGTIIHPDD--------------
MNME_GEOSL      RVFRRGS-----N---------------GDFESHRFYYGSVVDAVT--------------
MNME_GEOMG      RIVRRVNE----N---------------GDFVSHRFYYGTVVDPES--------------
MNME_GEOUR      AIFKRNR-----D---------------GGLQSHRFYYGAIIDPVS--------------
MNME_PELPD      TLFRPVR-----S---------------GGLISHRFYYGTLIDIQT--------------
MNME_PELCD      KFFSPRRF----C---------------ERLDSHFLYYGKFTD-ET--------------
MNME_SYNAS      LLFKSSHS----V---------------TLFKPRYLYHGDLSDPQT--------------
MNME_SYNFM      RLFMRSGS----G---------------SGLESHRLYHGWIKDPVT--------------
MNME_DESVH      ALFRPS--SSR-F---------------GGFRPWTLHHGTITDGCDP-------------
MNME_DESVV      ALFRPS--SSR-F---------------GGFRPWTLHHGTITDGCDP-------------
MNME_DESAG      ALFDST--SPG-F---------------SGFRPRVLHHGHIHDGTPQ-------------
MNME_LAWIP      ELFHSV--SPK-F---------------TDFKPWMLHRGYLVAPTNE-------------
MNME_NOSS1      TLFDAPGKQ--------------------VWESHRILYGYIRHPQTR-------------
MNME_TRIV2      TLFHAPGKQ--------------------VWESHRILYGYIRHPQTR-------------
MNME_TRIEI      TLFHAPGKQ--------------------VWETHHILYGYIRHPHTG-------------
MNME_ACAM1      QLFQTPGKQ--------------------QWESHRVLYGYIQQPLTQ-------------
MNME_SYNY3      TLFDAPGNQ--------------------TWESHRILYGHVRHPQTK-------------
MNME_MICAN      RLFHSPNRQ--------------------KWQSHRLLYGYIRHPQSQ-------------
MNME_SYNP2      QLFQDPGQQ--------------------TWESHRILYGYVRHPQTQ-------------
MNME_SYNE7      QIFQIAGQQ--------------------PWESHRILYGYIRDPESG-------------
MNME_SYNP6      QIFQIAGQQ--------------------PWESHRILYGYIRDPESG-------------
MNME_THEEB      SLFEAPGKQ--------------------PWESHRILYGYVRDPQTK-------------
MNME_SYNJA      AIFTPARRNA-------------------VWESHRLLYGWIHD-EKG-------------
MNME_SYNJB      AIFTPARRNA-------------------VWESHRLLYGWIRD-EKG-------------
MNME_GLOVI      RVFRLRGKQ--------------------AFESHRIHYGHFLD-ADG-------------
MNME_PROM1      NIVDVPGIQ--------------------DWSTHKVLYGHVTEENRK-------------
MNME_PROMT      NIVDVPGIQ--------------------DWSTHKVLYGHVTEENRK-------------
MNME_PROMA      NVVRTPSNK--------------------IWSSHKILYGHVIDKSTK-------------
MNME_PROM3      SVVSIPGQQ--------------------LWVSHRVLYGHVMDESGK-------------
MNME_PROMM      SVVSIPGQQ--------------------LWVSHRVLYGHVMDESGK-------------
MNME_SYNSC      SVVHCPGRQ--------------------EWGSHRVVYGHVIDSEG--------------
MNME_SYNPX      SVVHCPGRQ--------------------VCGSHRVMYGHVIDGEG--------------
MNME_SYNS9      AVVQCPGHQ--------------------EWGSHRILYGHVMAVDGQ-------------
MNME_SYNPW      SVTRIPGQQ--------------------SWESHRVLYGHVLAGESG-------------
MNME_SYNS3      AITVIPGQQ--------------------VWESHRVLYGHVVAAGGV-------------
MNME_SYNR3      QLFQPAGKQ--------------------SWESHRVLYGHVNDPANG-------------
MNME_PROMS      KIVQTKSKY--------------------AWESHRVFRGFIQENKQN-------------
MNME_PROM0      KIVQTKSKY--------------------AWESHRVFRGFIQENKQN-------------
MNME_PROM2      KIVQTKSKY--------------------AWESHRVFHGFIQENKQN-------------
MNME_PROM9      KIVQTKSKY--------------------AWESHRVFHGFILENKQN-------------
MNME_PROM5      NIVETKSKY--------------------AWESHRVFHGYVKDNLEN-------------
MNME_PROMP      NIVETKSKY--------------------AWESHRVFHGFIKDNLEN-------------
MNME_CYACA      TVSLVSSNQ--------------------CWHSHCILYGWIKDNEDQ-------------
MNME_CYAM1      SICVKKNH----------------------WHSHRIIHTYVQDDQNQ-------------
MNME_BACFR      RIFTPAK-SGKLL---------------SEQKPYTLTFGRIYN-----------------
MNME_BACFN      RIFTPAK-SGKLL---------------SEQKPYTLTFGRIYN-----------------
MNME_BACTN      RIFQPAK-AGKLL---------------SEQKPYTLTFGRIYN-----------------
MNME_BACV8      RIFTPA--TGKPL---------------TERAPYTLTFGKICSPKRKINNTLFQQTSEIP
MNME_PARD8      RIFRPKK-AGKSL---------------STQKAYTLTYGSIVG-----------------
MNME_PORGI      PLFLYRG-KAIDL---------------SGAKPRTALYGEIME-----------------
MNME_FLAJ1      SVFKSI--KNKDL---------------TKQKTHTLHLGHIVD-----------------
MNME_FLAPJ      EVFQSV--SGKDI---------------TKQKSHTLHLGHITD-----------------
MNME_GRAFK      PLFKAK--SKKDL---------------AKQPTHTLHLGNVMD-----------------
MNME_CYTH3      SVFPS-----KNI---------------AAVPTHTVHVGNIED-----------------
MNME_SALRD      RCFRGD-----AL---------------TDADSHTAHVGVLTD-----------------
MNME_CHLTE      RVFRKVHGSGK-L---------------AEAAGYTAHFGRLYD-----------------
MNME_CHLPD      RVFRKARDPHQPL---------------SETPGYTAHFGRLYD-----------------
MNME_CHLPM      RVFRKKGGTAFSF---------------KEAEGFSAHFGTLSD-----------------
MNME_PELLD      RAFRKKSGKAFSF---------------EAAEGFTAHVGTLFD-----------------
MNME_CHLCH      KVFHKQGAPDFHL---------------ASSKGFQAHFGTIHD-----------------
MNME_BORAP      KIFSNHS----AL---------------NSAAGNTIHYGYILDN----------------
MNME_BORBU      KIFSNHS----AL---------------NSASGNTIHYGYILDS----------------
MNME_BORBP      KIFSNHS----AL---------------NSAPGNTIHYGYILDN----------------
MNME_TREPA      SFFSRAQ----AL---------------TRARAHTFLHGWILD-----------------
MNME_TREDE      AIFSKPK----KL---------------KEAQGNSILHGWVLDP----------------
MNME_LEPBJ      SFLFSKNGFLSPS----------------DIQPRIAIQCVFQIGDRK-------------
MNME_LEPBL      SFLFSKNGFLSPS----------------DIQPRIAIQCVFQIGDRK-------------
MNME_LEPIN      SFLFSKNKFLSPS----------------EILPRTAIQCVFQIGDRK-------------
MNME_LEPIC      SFLFSKNKFLSPS----------------EILPRTAIQCVFQIGDRK-------------
MNME_LEPBA      AVLEKNQKPLTETF--------------LQNQKRSAIFCDFVENGKP-------------
MNME_LEPBP      AVLEKNQKPLTETF--------------LQNQKRSAIFCDFVENGKP-------------
MNME_UNCTG      KIFKTHSKPE-----------------------QQVKHGYITDGIEK-------------
MNME_SULMW      KIFCSFSKNQ--------------------IETNYIHLGYIKYKKQI-------------
MNME_CARRP      FLIQKIVKKN--------------------IKEKIATFSKLFLDKEC-------------
                                                                            

MNME_THEMA      ---------------------GEDVDEVVVVFYKSP--------KSYTGEDMVEVMCHGG
MNME_THESQ      ---------------------GEDVDEVVVVFYKSP--------KSYTGEDMVEVMCHGG
MNME_THEP1      ---------------------GEDVDEVVVIFYKSP--------KSYTGEDMVEVMCHGG
MNME_FERNB      ---------------------GEIIDEIMFVYFKSP--------RSYTGEDMVEIYCHGG
MNME_THEM4      ---------------------GDILDQVNIVFFKSP--------NSYTGNDLIEIYTHGG
MNME_PSELT      ---------------------GTILDEVMVIFYKSP--------NSYTGEDMIEIMCHGG
MNME_PETMO      ---------------------GEKVDEITWVYHSQP--------HSYTGEDMLEIFCHGG
MNME_AYWBP      -------------------KDQTILDEVLISVFKTP--------NSFTGENVVEINAHGG
MNME_ONYPE      -------------------KNQTILDEVLISVFKTP--------NSFTGENVVEINAHGG
MNME_ACHLI      -------------------EDGSILDEVMISVFIAP--------KSFTKEDVVEISTHGG
MNME_BACAN      -------------------DTNQVIEEVMVSIMRAP--------RTFTRENIVEINCHGG
MNME_BACHK      -------------------DTNQVIEEVMVSIMRAP--------RTFTRENIVEINCHGG
MNME_BACCZ      -------------------DTNQVIEEVMVSIMRAP--------RTFTRENIVEINCHGG
MNME_BACAH      -------------------DTNQVIEEVMVSIMRAP--------RTFTRENIVEINCHGG
MNME_BACC1      -------------------DTNQVIEEVMVSIMRAP--------RTFTRENIVEINCHGG
MNME_BACCR      -------------------DTNQVIEEVMVSIMRAP--------RTFTRENIVEINCHGG
MNME_BACMK      -------------------DTNQVIEEVMVSIMRAP--------RTFTRENIVEINCHGG
MNME_BACCN      -------------------DTNQVIEEVMVSIMRAP--------KTFTREDIVEVNCHGG
MNME_BACSU      -------------------PSDRVVEEVMVSVLKAP--------RTFTREDVIEINCHGG
MNME_BACVZ      -------------------TTGRIIEEVMVSVLRAP--------RTFTREDVIEINCHGG
MNME_BACP2      -------------------RTDQVIEEVMVSVLRAP--------KTFTREDVIEINCHGG
MNME_BACLD      -------------------ETEKVVEEVMVSVLKAP--------KTFTREDIVEINCHGG
MNME_GEOKA      -------------------KSGRVVEEVMVSVMRAP--------KTFTREDVVEINCHGG
MNME_GEOTN      -------------------KSGRIVEEVMVSVMRAP--------KTFTREDVVEINCHGG
MNME_LYSSC      -------------------KTNEVVEEVMLSLMRGP--------KTFTREDVVEINCHGG
MNME_OCEIH      -------------------GTNEVAEEVMVSIMRGP--------KTFTREDVVEINCHGG
MNME_BACSK      -------------------ASEEAIEEAMVTVMRAP--------RTYTREDIVEINCHGG
MNME_BACHD      -------------------KTDEIIDEVMVSVLRAP--------RTFTREDVIEINCHGG
MNME_EXIS2      -------------------TTEQVVDEVMVSVMRAP--------KTFTREDVVELNCHGG
MNME_STAAC      -------------------ESKEVIEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAE      -------------------ESKEVIEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAT      -------------------ESKEVIEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAA3      -------------------ESKEVIEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAA2      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAA9      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAR      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAW      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAN      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAA8      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAA1      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAM      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAS      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAAB      -------------------ESKEVVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAES      -------------------ETNETVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAEQ      -------------------ETNETVEEVMVSVLRAP--------KTFTREDIIEINCHGG
MNME_STAHJ      -------------------ETNEVVEEVMISVLRAP--------RTFTREDIIEINCHGG
MNME_STAS1      -------------------ESNEVVEEVMVSVLRAP--------KTFTREDIVEINCHGG
MNME_LISMO      --------------------DGEVIEEVMVTVMRAP--------RTFTREDVVEINAHGG
MNME_LISMF      --------------------DGEVIEEVMVTVMRAP--------RTFTREDVVEINAHGG
MNME_LISIN      --------------------DGEVIEEVMVTVMRAP--------RTFTREDVVEINAHGG
MNME_LISW6      --------------------DGEVIEEVMVTVMRAP--------RTFTREDVVEINAHGG
MNME_ENTFA      -------------------QNDQLIDEVMLSVMRAP--------KTFTREDVVEINCHGG
MNME_LACP3      -------------------ESGELIDEVMVSVMLAP--------KTFTREDVVEINCHGG
MNME_LACSS      -------------------KTDAVVDEVMVSVMRAP--------KTFTREDVIEINCHGG
MNME_LACS1      -------------------KTNEELDEVMVSVMLAP--------RTFTREDVIEINCHGG
MNME_LACPL      -------------------DTHQEVDEVMATVMRAP--------KTYTREDVVEINCHGG
MNME_LACBA      -------------------ETGDEVDEVMVTVMRAP--------KTYTKEDIIEINCHGG
MNME_PEDPA      -------------------ENGNEVDEVMVSVMRAP--------HTYTKEDIVEINCHGG
MNME_LACLM      --------------------EERLVDEVMVSVMRAP--------KTFTREDIVEINTHGG
MNME_LACLS      --------------------EERLVDEVMVSVMRAP--------KTFTREDIVEINTHGG
MNME_LACLA      --------------------EKRLVDEVMVSVMRAP--------KTFTREDIVEINTHGG
MNME_STRA1      -------------------DKNEILDEVMLGVMLAP--------KTFTREDVIEINTHGG
MNME_STRA5      -------------------DKNEILDEVMLGVMLAP--------KTFTREDVIEINTHGG
MNME_STRA3      -------------------DKNEILDEVMLGVMLAP--------KTFTREDVIEINTHGG
MNME_STRAG      -------------------DKNEILDEVMLGVMLAP--------KTFTREDVIEINTHGG
MNME_STRTD      --------------------NNEIIDEVMVSVMRAP--------KTFTREDVVEINTHGG
MNME_STRT1      --------------------NNEIIDEVMVSVMRAP--------KTFTREDVVEINTHGG
MNME_STRT2      --------------------NNEIIDEVMVSVMRAP--------KTFTREDVVEVNTHGG
MNME_STRMU      --------------------NGAIIDEVMVSVMRAP--------KTFTREDVIEINTHGG
MNME_STRP8      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRPD      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRP6      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRP3      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRPG      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRP1      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRPC      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRPM      -------------------KTGTIIDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRPF      -------------------NTGTIVDEVMVSVMLAP--------KTFTRENVVEINTHGG
MNME_STRGC      -------------------QNQEVLDEVMIGAMRSP--------KTFTREDIIEINTHGG
MNME_STRSV      -------------------QNQEILDEVMLGAMRSP--------KTFTREDIIEINTHGG
MNME_STRR6      -------------------LTGKVMDEVMVGAMKSP--------KTFTREDIIEINTHGG
MNME_STRP2      -------------------LTGKVMDEVMVGAMKSP--------KTFTREDIIEINTHGG
MNME_STRPI      -------------------LTGKVMDEVMVGAMKSP--------KTFTREDIIEINTHGG
MNME_STRPN      -------------------LTGKVMDEVMVGAMKSP--------KTFTREDIIEINTHGG
MNME_STRSY      -------------------ATGQVLDEVMIGAMRSP--------KTFTREDVIEINTHGG
MNME_STRS2      -------------------ATGQVLDEVMIGAMRSP--------KTFTREDVIEINTHGG
MNME_LACGA      -------------------KTKEVVDETMVSVLRAP--------KTFTREDMVEINCHGG
MNME_LACJO      -------------------KTKDVVDETMVSVLRAP--------KTFTREDMVEINCHGG
MNME_LACAC      -------------------DTGKTIDESMVTVLRAP--------KTFTCEDIVEINCHGG
MNME_LACH4      -------------------DTDKTIDESMVTVLRAP--------KTFTREDIVEINCHGG
MNME_LACDB      -------------------ATGQVIDEVMASVMLAP--------KTFTKEDIVEINCHGG
MNME_LACDA      -------------------ATGQVIDEVMASVMLAP--------KTFTKEDIVEINCHGG
MNME_MYCGE      --------------------NNKRIDDVLLFKFVSP--------NSYTGEDLIEISCHGN
MNME_MYCPN      --------------------NQKKVDDVLLFKFVAP--------NSYTGEDLIEISCHGS
MNME_MYCGA      --------------------NDQIIDDVLLMKFVAP--------KSFTGEDSIEINCHGG
MNME_UREPA      --------------------DNQILDEVLINTFVAP--------KTFTGEDLVEINCHGG
MNME_UREP2      --------------------DNQILDEVLINTFVAP--------KTFTGEDLVEINCHGG
MNME_MYCPE      --------------------NDLIIDEVIILKYVAP--------KSFTGEDLIEINCHGG
MNME_MYCMS      --------------------EDELIDEVVLSCFVAP--------NSFTGENVVEIACHGG
MNME_MYCCT      --------------------EDELIDEVVLSCFVAP--------NSFTGENVVEIACHGG
MNME_MESFL      --------------------GQELVDEVVITSFVSP--------ASFTGENVVEIACHGG
MNME_MYCPU      --------------------DQEIIDEVLVMWFKGP--------NNFVGEDTVEINAHGG
MNME_MYCMO      --------------------ERKIVDEVLVAWFEGT--------NNFTGENSVEIFCHGG
MNME_MYCAP      -------------------NGNEVIDEVLCMWFLGT--------NNFVGEDTVEINCHGG
MNME_MYCS5      ---------------------SEIVDEVLVSWFLGEPQGDITVYNNYVGEPLIEINAHGG
MNME_MYCHJ      ---------------------NQKIDQVLVLWFAGN--------KNFVGEDTVEINAHGG
MNME_MYCH2      ---------------------NQKIDQVLVLWFAGN--------KNFVGEDTVEINAHGG
MNME_MYCH7      ---------------------NQKIDQVLVLWFAGN--------KNFVGEDTVEINAHGG
MNME_CAMJE      --------------------NNEIIDEAIMIYFKAP--------YSFTGEDIVEFQTHGG
MNME_CAMJJ      --------------------NNEIIDEAIMIYFKAP--------YSFTGEDIVEFQTHGG
MNME_CAMJR      --------------------NNEIIDEAIMIYFKAP--------YSFTGEDIVEFQIHGG
MNME_CAMJ8      --------------------NNEIIDEAIMIYFKAP--------YSFTGEDIVEFQTHGG
MNME_CAMJD      --------------------NNEIIDEAIMIYFKAP--------YSFTGEDIVEFQTHGG
MNME_CAMC5      --------------------DKEFLDEAIMIYFKAP--------ASFTGEDVVEFHTHGG
MNME_CAMC1      --------------------DDEILDEGIVIYFKAP--------ASFTGEDIVEFQTHGG
MNME_CAMHC      --------------------DGNFMDESVVIYYKSP--------NSFTGEDIVEFQIHGG
MNME_CAMFF      --------------------NMVFLDEAIVIYYKAP--------FSFTGEDVVEFQTHGG
MNME_SULDN      --------------------HGELIDEAIVIYFKAP--------FSFTAEDVVEIQCHGG
MNME_ARCB4      --------------------KNEIIDEALVIYFKSP--------FSFTGEDVVEFQCHGG
MNME_NITSB      --------------------QSEPIDQAILIYFQAP--------KSFTGEDVVEFQCHGG
MNME_SULNB      --------------------QNDLIDQAIMIYFKAP--------FSFTGEEIVEFQCHGG
MNME_HELHP      --------------------QQMPIDEALVLYFPKP--------YSYTTQDVCEVQCHGG
MNME_WOLSU      --------------------EDEMMDEAILIYFKAP--------HSYTAEEVVEIQCHGG
MNME_HELPY      --------------------NGVLLDKALVIYFKAP--------YSFTGEDVCEIQCHGS
MNME_HELPJ      --------------------DGVLLDKALVIYFKAP--------YSFTGEDVCEIQCHGS
MNME_HELPH      --------------------DGVLLDKALVIYFKAP--------YSFTGEDVCEIQCHGS
MNME_HELAH      --------------------NNILLDKALAIYFKAP--------YSFTGEDVCEIQCHGS
MNME_ECOLI      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECOLC      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SHIBS      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECODH      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SHIFL      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SHIF8      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SHIDS      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECO57      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECOUT      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECOL5      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECOK1      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECOL6      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECOSM      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECO24      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ECOHS      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SHISS      -----------------------VLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SALCH      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SALPB      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SALTY      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SALPA      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SALTI      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_SALAR      -----------------------TLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_CITK8      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_ENT38      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_KLEP7      -----------------------PLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_CROS8      -----------------------ALDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_YERPA      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_YERPN      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_YERPP      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_YERPE      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_YERPS      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_YERP3      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_YERPY      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_YERE8      -----------------------TLDQGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_SERP5      -----------------------TLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_PECAS      -----------------------TLDQGIALWFPGP--------NSFTGEDVLELQGHGG
MNME_PHOLL      -----------------------ILDQGIAIYFPGP--------NSFTGEDVLELQGHGG
MNME_SODGM      -----------------------TLDQGIALFFPGP--------HSFTGEDVLELQGHGG
MNME_ACTP2      -----------------------VLDQGIALFFKAP--------NSFTGEDVLELQGHGG
MNME_ACTPJ      -----------------------VLDQGIALFFKAP--------NSFTGEDVLELQGHGG
MNME_HAEDU      -----------------------ILDQGIALFFKAP--------NSFTGEDVLELQGHGG
MNME_HAEI8      -----------------------ILDQGIALYFKSP--------NSFTGEDVLELQGHGG
MNME_HAEIE      -----------------------ILDQGIALYFKSP--------NSFTGEDVLELQGHGG
MNME_HAEIN      -----------------------ILDQGIALYFKSP--------NSFTGEDVLELQGHGG
MNME_HAEIG      -----------------------ILDQGIALYFKSP--------NSFTGEDVLELQGHGG
MNME_MANSM      -----------------------ILDQGIALYFKSP--------NSFTGEDVVEFQGHGG
MNME_ACTSZ      -----------------------TLDQGIALFFQSP--------NSFTGEDILELQGHGG
MNME_PASMU      -----------------------VLDQGIALYFKAP--------HSFTGEDVLELQGHGG
MNME_HAES1      -----------------------VLDQGIALYFKAP--------NSFTGEDVLELQGHGG
MNME_HISS2      -----------------------VLDQGIALYFKAP--------NSFTGENVLELQGHGG
MNME_AERHH      -----------------------PLDQGIALLFKAP--------NSFTGEDVLELQGHGG
MNME_AERS4      -----------------------PLDQGIALLFKAP--------NSFTGEDVLELQGHGG
MNME_SHEB8      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHEB9      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHEB5      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHEPC      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHESW      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHESA      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHESM      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHESR      -----------------------VIDQGIALYFKGP--------NSFTGEDVLELQGHGG
MNME_SHEON      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHEFN      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHEDO      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHEHH      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHEPA      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_SHESH      -----------------------VIDQGIALYFQGP--------NSFTGEDVLELQGHGG
MNME_SHEWM      -----------------------VIDQGIALYFQGP--------NSFTGEDVLELQGHGG
MNME_SHELP      -----------------------VIDQGIALYFKGP--------NSFTGEDVLELQGHGG
MNME_SHEAM      -----------------------VIDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_VIBCH      -----------------------QLDQGIALFFPNP--------HSFTGEDVLELQGHGG
MNME_VIBC3      -----------------------QLDQGIALFFPNP--------HSFTGEDVLELQGHGG
MNME_VIBCB      -----------------------VLDQGIALYFPNP--------HSFTGEDVLELQGHGG
MNME_VIBPA      -----------------------VLDQGIALYFPNP--------HSFTGEDVLELQGHGG
MNME_VIBVU      -----------------------ELDQGIALFFPNP--------HSFTGEDVLELQGHGG
MNME_VIBVY      -----------------------ELDQGIALFFPNP--------HSFTGEDVLELQGHGG
MNME_ALIF1      -----------------------ELDQGIALYFPNP--------HSFTGEDVLELQGHGG
MNME_PHOPR      -----------------------ALDQGIALFFKGP--------NSFTGEDVLELQGHGG
MNME_PSYIN      -----------------------VLDQGIALFFKAP--------NSFTGEDVLELQGHGG
MNME_PSEA6      -----------------------PLDQGIALFFKAP--------HSFTGEDVLELQGHGG
MNME_PSEHT      -----------------------QLDQGIAIYFAGP--------NSFTGEDVLELQGHGG
MNME_IDILO      -----------------------LLDEGIALFFPGP--------NSFTGEDVLELQGHGG
MNME_COLP3      -----------------------VLDQGIALYFKAP--------NSFTGEDVIEFQGHGG
MNME_CHRSD      -----------------------VLDEGIALFFPGP--------HSFTGEDVLELQGHGG
MNME_MARMS      -----------------------QLDEGIALYFPGP--------NSFTGEDVFELQGHGG
MNME_MARHV      -----------------------LIDEGIGLYFPNP--------HSFTGEDVFELQGHGG
MNME_HAHCH      -----------------------TLDSGIALLFIAP--------NSFTGEDVVEFQGHGG
MNME_PSEAE      -----------------------VIDEGLSLYFPGP--------NSFTGEDVLELQGHGG
MNME_PSEAB      -----------------------VIDEGLSLYFPGP--------NSFTGEDVLELQGHGG
MNME_PSEA7      -----------------------VIDEGLSLYFPGP--------NSFTGEDVLELQGHGG
MNME_PSEPU      -----------------------VLDEGIALFFPGP--------NSFTGEDVLELQGHGG
MNME_PSEP1      -----------------------VLDEGIALFFPGP--------NSFTGEDVLELQGHGG
MNME_PSEPK      -----------------------VLDEGIALFFPGP--------NSFTGEDVLELQGHGG
MNME_PSEPG      -----------------------VLDEGIALFFPGP--------NSFTGEDVLELQGHGG
MNME_PSEPW      -----------------------VLDEGIALFFPGP--------NSFTGEDVLELQGHGG
MNME_PSEE4      -----------------------VLDEGIALFFPGP--------NSFTGEDVLELQGHGG
MNME_PSEF5      -----------------------VLDEGIVLYFPGP--------NSFTGEDVLELQGHGG
MNME_PSEPF      -----------------------VLDEGLALYFPGP--------NSFTGEDVLELQGHGG
MNME_PSE14      -----------------------VLDEGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_PSEU2      -----------------------VLDEGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_PSESM      -----------------------VLDEGIALYFPGP--------NSFTGEDVLELQGHGG
MNME_PSEMY      -----------------------PLDEGLAIYFPGP--------NSFTGEDVLELQGHGG
MNME_PSEU5      -----------------------VIDEGLLLFFPGP--------HSFTGEDVLELHGHGG
MNME_SACD2      -----------------------ILDQGIALYFPNP--------HSFTGEDVLELQGHGG
MNME_HYDCU      -----------------------VLDQGIALFFPNP--------HSFTGENVLELQGHGG
MNME_LEGPC      -----------------------VLDQGLVLYFKGP--------HSFTGEDVIEIQAHGS
MNME_LEGPH      -----------------------VLDQGLVLYFKGP--------HSFTGEDVIEIQAHGS
MNME_LEGPA      -----------------------VLDQGLVLYFKGP--------HSFTGEDIIEIQAHGS
MNME_LEGPL      -----------------------VLDQGLVLYFKGP--------HSFTGEDVIEIQAHGS
MNME_ALCBS      -----------------------VLDEGLVISFPAP--------HSFTGEDVVELQGHGG
MNME_METCA      -----------------------AIDSGIALYFPAP--------RSFTGENVLELHGHGG
MNME_NITOC      -----------------------ILDQGLILYFPGP--------HSFTGEDVLELQGHGG
MNME_ALKEH      -----------------------TLDEGLMLYFPAP--------RSFTGEDVLELQGHGG
MNME_COXBU      -----------------------VIDEGIALYFPKP--------NSFTGEDVLELHGHGG
MNME_COXBN      -----------------------VIDEGIALYFPKP--------NSFTGEDVLELHGHGG
MNME_COXBR      -----------------------VIDEGIALYFPKP--------NSFTGEDVLELHGHGG
MNME_PSYCK      -----------------------VIDEGLVLYFKGP--------HSFTGEDVIELQGHGG
MNME_PSYA2      -----------------------VVDEGLVLYFKGP--------HSFTGEDVIELQGHGG
MNME_PSYWF      -----------------------VLDEGLVLYFKAP--------HSFTGEDVIELQGHGG
MNME_ACIBY      -----------------------IMDEGIVLCFPNP--------HSFTGEDVVELQGHGG
MNME_ACIBT      -----------------------IMDEGIVLCFPNP--------HSFTGEDVVELQGHGG
MNME_ACIAD      -----------------------VMDEGLVLYFPNP--------NSFTGEDVVELQGHGG
MNME_DICNV      -----------------------QIDQGIVLYFPAP--------HSFTGEDVVELQGHGG
MNME_BORBR      -----------------------VIDEGLAIYFRAP--------HSYTGEDVLELQGHGG
MNME_BORPA      -----------------------VIDEGLAIYFRAP--------HSYTGEDVLELQGHGG
MNME_BORPE      -----------------------VIDEGLAIYFRAP--------HSYTGEDVLELQGHGG
MNME_BORPD      -----------------------HLDEGIALYFRAP--------QSYTGEDVLELQGHGG
MNME_BORA1      -----------------------RIDEGIAIYFQGP--------HSYTGEDVLELQGHGG
MNME_CUPPJ      -----------------------VIDHGLALYFPGP--------NSYTGEEVLELQGHGG
MNME_CUPNH      -----------------------VIDHGLALYFPAP--------NSYTGEEVLELQGHGG
MNME_CUPMC      -----------------------VIDHGLALYFPAP--------NSYTGEEVLELQGHGG
MNME_RALSO      -----------------------AIDRGIALWFPAP--------HSYTGEDVLELQGHGG
MNME_BURM7      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURMA      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURP6      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURP0      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURMS      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURM9      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURPS      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURP1      -----------------------PLDRGIALYFPAP--------HSYTGEHVIELQGHGG
MNME_BURTA      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_BURCA      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_BURCH      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_BURCC      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_BURL3      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_BURCM      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_BURA4      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_BURVG      -----------------------PLDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_PARXL      -----------------------ALDRGIALYFPAP--------HSYTGEHVLELQGHGG
MNME_JANMA      -----------------------VIDQGLAIYFKAP--------HSYTGEDVLELQGHGG
MNME_HERAR      -----------------------VIDQGLAIYFKAP--------HSYTGEDVLELQGHGG
MNME_ACISJ      -----------------------AIDQGLALYFPAP--------HSYTGEDVLELQAHGG
MNME_ACIAC      -----------------------AIDQGLALYFPAP--------HSYTGEDVLELQAHGG
MNME_VEREI      -----------------------PIDQGLALYFPGP--------HSYTGEDVLELQAHGG
MNME_RHOFT      -----------------------AIDQGIALYFPAP--------HSFTGEDVLELQAHGG
MNME_POLSJ      -----------------------VIDQGLAIHFPAP--------HSYTGEDVLELQAHGG
MNME_POLNA      -----------------------IIDKGLAIFFPAP--------HSYTGEDVLELQAHGG
MNME_LEPCP      -----------------------AIDRGLALHFPAP--------HSYTGEDVLELQAHGG
MNME_METPP      -----------------------AIDQGLALHFPAP--------HSYTGEEVLELQAHGG
MNME_NEIMA      -----------------------AIDSGLLLFFAAP--------ASFTGEDVIELQGHGG
MNME_NEIMB      -----------------------AIDSGLLLFFAAP--------ASFTGEDVIELQGHGG
MNME_NEIM0      -----------------------AIDSGLLLFFAAP--------ASFTGEDVIELQGHGG
MNME_NEIMF      -----------------------AIDSGLLLFFAAP--------ASFTGEDVIELQGHGG
MNME_NEIG1      -----------------------AIDSGLLLFFAAP--------ASFTGEDVIELQGHGG
MNME_CHRVO      -----------------------ALDNGLLLFFPGP--------NSFTGEDVIELQGHGG
MNME_AZOSB      -----------------------TIDEGILLYFPAP--------ASFTGEDVLELQGHGG
MNME_AROAE      -----------------------PIDEGILLYFPAP--------HSFTGEDVIELQGHGG
MNME_DECAR      -----------------------TIDTGLLLYFPNP--------QSFTGEDVLELQGHGG
MNME_NITEU      -----------------------IIDQGIALYFPSP--------HSYTGEEVLELQGHGG
MNME_NITEC      -----------------------VIDQGIVLYFPSP--------NSYTGEDVLELHGHGG
MNME_NITMU      -----------------------VIDQGIALYFPAP--------QSYTGEEVLELQGHGG
MNME_THIDA      -----------------------PLDEGIALYFAAP--------HSFTGEHVLELQGHGG
MNME_METFK      -----------------------LIDRGIAIYYPGP--------HSYTGEDVLELQAHGG
MNME_POLAQ      -----------------------PIDQLLAIYFVGP--------ASFTGEDVLELQCHGG
MNME_FRATF      -----------------------IIDHGIVIFFKAP--------LSYTGEDVVEIQAHGN
MNME_FRATH      -----------------------IIDHGIVIFFKAP--------LSYTGEDVVEIQAHGN
MNME_FRATO      -----------------------IIDHGIVIFFKAP--------LSYTGEDVVEIQAHGN
MNME_FRATT      -----------------------IIDHGIIIFFKAP--------LSYTGEDVVEIQAHGN
MNME_FRAT1      -----------------------IIDHGIIIFFKAP--------LSYTGEDVVEIQAHGN
MNME_FRATW      -----------------------IIDHGIVIFFKAP--------LSYTGEDVVEIQAHGN
MNME_FRATN      -----------------------IIDHGIVIFFKAP--------LSYTGEDVVEIQAHGN
MNME_FRAP2      -----------------------IIDHGIVIFFNSP--------NSYTGEDVVEIQAHGN
MNME_RUTMC      -----------------------EIDKGIALFFPKP--------HSFTGEDILEFQGHGG
MNME_VESOH      -----------------------EIDKGIALFFPKP--------YSFTGEDVLEFQGHGG
MNME_XANAC      -----------------------VIDDGIALWFNAP--------HSFTGEDVVELQGHGS
MNME_XANC5      -----------------------VIDDGIALWFNAP--------HSFTGEDVVELQGHGS
MNME_XANOM      -----------------------VIDDGIALWFNAP--------HSFTGEDVVELQGHGS
MNME_XANOR      -----------------------VIDDGIALWFNAP--------HSFTGEDVVELQGHGS
MNME_XANCP      -----------------------VIDDGIAVWFPAP--------HSFTGEEVVELQGHGS
MNME_XANC8      -----------------------VIDDGIAVWFPAP--------HSFTGEEVVELQGHGS
MNME_XANCB      -----------------------VIDDGIAVWFPAP--------HSFTGEEVVELQGHGS
MNME_XYLFA      -----------------------VIDDGLALWFPAP--------HSFTGEDVLELQGHGS
MNME_XYLFT      -----------------------VIDDGLAIWFPAP--------HSFTGEDVLELQGHGS
MNME_BLOFL      -----------------------IMEKVITLFFPEP--------HSFTGENILEIHGHGG
MNME_BLOPB      -----------------------ILERVIALFFPEP--------NSFTGENILEIHGHGG
MNME_BAUCH      -----------------------IIDKGIALFFPGP--------NSFTGEDILELHGHGG
MNME_WIGBR      -----------------------TLDQGIALFFKSP--------KSLTGEDVLEFQAHGS
MNME_BUCCC      -----------------------LLDQGIALFFLAP--------KSFTGENILEFHSHGN
MNME_BUCAI      -----------------------ILDKGISLWFPAP--------HSLTGEDVLELQGHGS
MNME_BUCMP      -----------------------VLDQGISLWFPAP--------FSFTGEDVLELQGHGS
MNME_BUCAP      -----------------------VLDEGISLWFPAP--------FSLTGEDVLELQGHGN
MNME_BUCBP      -----------------------IIDQGIVLWFPGP--------SSFTGEDVLELQGHGN
MNME_CAUVC      ------------------HNG-VALDAALVLRFEKP--------ASYTGEDSVEFHVHGG
MNME_CAUSK      ------------------RDG-VALDDALVLWFQGP--------ASYTGEDAAEFHVHGG
MNME_MARMM      ------------------DSGGSVMDRGLVLWFPGP--------GSFTGEDSAEFHVHGG
MNME_RHORT      ------------------EEGGEVLDDALVLWFPAP--------ASFTGEDVAELHIHGG
MNME_MAGSA      ------------------DGAGEVLDDGLVLWFPAP--------HSFTGEDVAELHLHGG
MNME_PARL1      ------------------PETHAALDRGLAIFFPAP--------ASFTGEDVVELHIHGG
MNME_NITWN      --------------------VGEAIDDAVILWFPAP--------ASATGEDIAEFHVHGS
MNME_NITHX      --------------------LGEAIDDAIVLWFAGP--------ASATGEDVAEFHVHGS
MNME_BRASO      --------------------QGEPIDDAVVLWFPAP--------ASATGENVVELHIHGS
MNME_BRASB      --------------------RGDPIDDAVVLWFPGP--------ASATGEDVAELHVHGS
MNME_BRADU      --------------------TGQPIDDAVVLWFPGP--------ASATGEDVAEFHAHGG
MNME_RHOP5      --------------------DGEPIDDAVVLWFPGP--------ASATGEDVAEFHIHGG
MNME_RHOPS      --------------------NQDLIDDGVALWFAGP--------ASATGEDVAEFHIHGG
MNME_RHOP2      --------------------NHELIDDAVVLWFAAP--------ASATGEDVAEFHIHGG
MNME_RHOPA      --------------------DGDLIDDGVALWFPTP--------ASATGEDVAELHIHGS
MNME_RHOPB      --------------------SAQPIDDAIVLWFPAP--------RSATGEDVAEFHIHGG
MNME_METPB      --------------------TGNILDQALVAWLPGP--------ATATGEDMAELHLHGG
MNME_METRJ      --------------------DGTELDRALVAWFPGP--------DTYSGEDMAELHLHGG
MNME_METS4      --------------------TGEVLDRALVVWLPGP--------ATFTGEDSAELHLHGG
MNME_AZOC5      --------------------TGDLLDRGLILFFPGP--------RSATGEDTLELHLHGG
MNME_BEII9      --------------------NGEALDEALVLWFPGP--------KSFTGEDCAEFHVHGG
MNME_RHIEC      --------------------NNEPIDNGLVLFFPGP--------HSFTGEDVAELQIHGS
MNME_RHIL3      --------------------NNQPIDSGLVLFFPAP--------NSFTGEDVAELQIHGS
MNME_SINMW      --------------------NSDILDSGLVLYFPGP--------ASFTGEDCCELQVHGG
MNME_RHIME      --------------------NGETLDSGLVLYFPTP--------ASFTGEDCCELQVHGG
MNME_AGRFC      --------------------NNEIIDQSLVIVFPAP--------NSFTGENCVEIHSHGS
MNME_BRUC2      --------------------NGDAIDRGLILFFPAP--------HSFTGEDCAEFHLHGG
MNME_BRUSU      --------------------NGDAIDRGLTLFFPAP--------HSFTGEDCAEFHLHGG
MNME_BRUA2      --------------------NGDAIDRGLTLFFPAP--------HSFTGEDCAEFHLHGG
MNME_BRUAB      --------------------NGDAIDRGLTLFFPAP--------HSFTGEDCAEFHLHGG
MNME_BRUME      --------------------NGDAIDRGLTLFFPAP--------HSFTGEDCAEFHLHGG
MNME_BRUO2      --------------------NGDAIDRGLTLFFPAP--------HSFTGEDCAEFHLHGG
MNME_BRUSI      --------------------NGDAIDRGLTLFFPAP--------HTFTGEDCAEFHLHGG
MNME_OCHA4      --------------------NGDPIDRGLALFFPGP--------NSFTGEDCAEFHLHGG
MNME_BARHE      --------------------DGSFLDSALTVFFPAP--------HSFTGEDCAEFHLHGG
MNME_BART1      --------------------DGSFLDSALTVFFPAP--------HSFTGEDCAEFHLHGG
MNME_BARQU      --------------------DGSFLDSALTVFFPAP--------HSFTGEDCAEFHLHGS
MNME_BARBK      --------------------DGSFLDSALTVFFPRP--------HSFTGEDCAEFHLHGG
MNME_CHESB      --------------------EREVLDRALCLFFPAP--------ASFTGEDCAELHLHGG
MNME_RHILO      --------------------DGTVLDSGLVIFFPGP--------ASFTGEDVAEFHVHGG
MNME_HYPNA      --------------------DGALIDQGIALYANAP--------HSYTGEDTLELYLHGG
MNME_GRABC      -------------------RSGEILDQGIILWFAGP--------GSFTGEDCAELHLHGG
MNME_ACICJ      -------------------GRRGIIDRGLLLWFPGP--------ASVTGEDYAEFHLHGG
MNME_GLUOX      --------------------NGEVLDHAVALWLPGP--------NSYTGEDGFELHLHAG
MNME_ERYLH      -------------------GEGKTLDDALVLWLPGP--------DNATGEDCVELHCHGG
MNME_NOVAD      -------------------RDGTHLDRTMVLWLPGP--------ATATGEDCAELHLHGG
MNME_SPHWW      -------------------DGGALLDRALLLWLPGP--------GTATGEDMAELHLHGG
MNME_SPHAL      -------------------TDGGALDHALILWFPGP--------ATATGEDLAELHLHGG
MNME_ZYMMO      -------------------DSGEQLDQSLLLWLPAP--------KTVTGEDLLELHVHGG
MNME_RUEST      --------------------AGEILDEALVLSFTSP--------DSFTGENIVEFQLHGS
MNME_RUEPO      --------------------QGARLDDGVVLTFAAP--------ASFTGEDVAEFQIHGS
MNME_ROSDO      --------------------DGSVIDQALVLAFKAP--------HSFTGEDVVEFHVHGS
MNME_RHOS4      --------------------NGEVLDEALVLLFGAG--------ASFTGETSAELHLHGS
MNME_RHOS1      --------------------NDEVLDEALVLLFGAG--------ASFTGETSAELHLHGS
MNME_RHOS5      --------------------NGEVLDEALILLFAEG--------ASFTGERSAEIHLHGS
MNME_DINSH      --------------------DGSVIDEALVLAFESP--------NSFTGEDCVEFQTHGS
MNME_JANSC      --------------------LGELLDRGLVLVFKAP--------ASFTGEDTVELQLHGS
MNME_PARDP      --------------------DD-LIDRALVIWFAEG--------HSFTGEEVAELHLHGA
MNME_RICAH      ---------------------KELIDNAMVVYFKLP--------NSFTGEDVVEIHTHGS
MNME_RICFE      EPITNRRATSDIVSEGGSIDYKELIDNAMVVYFKSP--------NSFTGEDVVEIHTHGS
MNME_RICRO      ---------------------KELIDNVMVVYFKSP--------GSFTGEDVVEIHTHGS
MNME_RICRS      ---------------------KELIDNVMVVYFKSP--------GSFTGEDVVEIHTHGS
MNME_RICCN      ---------------------KELIDNVMVVYFKSP--------GSFTGEDVVEIHTHGS
MNME_RICM5      ---------------------KELIDNVMVVYFKSP--------GSFTGEDVVEIHTHGS
MNME_RICCK      ---------------------GELIDNAMVVYFKSP--------GSFTGEDVAEIYTHGS
MNME_RICPR      ---------------------NELIDNAMVVYFKLP--------NSFTGEDVVEIHTHGS
MNME_RICTY      ---------------------NELIDNAMVVYFKLP--------NSFTGEDVVEIHTHGS
MNME_RICB8      ---------------------NDLIDNAMVVYFKAP--------NSFTGEDVVEIHTHGS
MNME_RICBR      ---------------------NDLIDNAMVVYFKAP--------NSFTGEDVVEIHTHGS
MNME_ORITB      ---------------------SQVIDKALIVYFKGE--------QSFTGEDVVEIHTHGS
MNME_ANAMM      ----------------------QPIDQAVVLYFPGP--------GSFTGEDVVELQVHGS
MNME_ANAPZ      ----------------------RLIDQAVVLYFPKP--------GSFTGEDVVELQVHGS
MNME_EHRCJ      ----------------------EIIDEVIIVYFVAP--------SSFTGEDVVEFHTHGS
MNME_EHRCR      ----------------------EVIDEAIVVYFVAP--------NSFTGEDVVEFHTHGS
MNME_EHRRW      ----------------------EVIDEVIVVYFSAP--------NSFTGEDVVELHTHGS
MNME_EHRRG      ----------------------EVIDEVIVVYFSAP--------NSFTGEDVVELHTHGS
MNME_WOLTR      ----------------------QLIDNGIAIYFPAP--------NSFTGEDVIELQVHGG
MNME_WOLPM      ----------------------QLIDNGIIIYFPAP--------NSFTGEDVIELQVHGS
MNME_NEOSM      -----------------------LIDEVLVVYFASP--------ASFTGEDVVELHSHGS
MNME_PELUB      ---------------------SELIDEGIILWFPGP--------ESYTGEDMAEFHIHGS
MNME_DEIRA      --------------------DEELLDEGLCLVFRGP--------RSYTGEDVAEVQTHGS
MNME_DEIGD      --------------------DGEVLDEGLCLVFRGP--------HSYTGEDVAELQTHGS
MNME_THET8      --------------------TGEAIDQAILLVFRAP--------RSYTGEDLVEFQTHGS
MNME_THET2      --------------------TGEAIDQALLLVFRAP--------RSYTGEDLVEFQTHGS
MNME_HALHL      --------------------RGETLDHGLVLVFPGP--------GSYTGEDVVELQGHGS
MNME_MYXXD      --------------------EGRSLDEGLFLYFRGP--------QSFTGEDVVELQAHGS
MNME_RHOBA      --------------------EPLGAIEVDVMVWPTQ--------RSYTGQPSAELHLIGS
MNME_AQUAE      ------------------------LDEGVLIYYKAP--------HSYTGEDMVELNLHGN
MNME_MAGMM      ------------------------LDHMLVVHFPNP--------HSFSGEDMVELHGHGA
MNME_KORVE      ------------------------LDEVVVAYFAKP--------HSYTTDDIVEISCHGS
MNME_SOLUE      ------------------------IDQVIVTFFERP--------RSYTAEDLVEITCHGS
MNME_CHLTR      ---------------------AVCIDQALVLVMRAP--------RSFTGEDIVEFQCHGG
MNME_CHLTB      ---------------------AVCIDQALVLVMRAP--------RSFTGEDIVEFQCHGG
MNME_CHLT2      ---------------------AVCIDQALVLVMRAP--------RSFTGEDIVEFQCHGG
MNME_CHLTA      ---------------------AVYIDQALVLVMRAP--------RSFTGEDIVEFQCHGG
MNME_CHLMU      ---------------------EVCIDQALVLIMRTP--------RSFTGEDIVEFQCHGG
MNME_CHLCV      ---------------------DRQIDQVLLLIMRAP--------RSFTGEDVIELQCHGG
MNME_CHLFF      ---------------------GRQIDQVLLLIMRAP--------RSFTGEDVVELQCHGG
MNME_CHLAB      ---------------------GQQIDQTLLLIMRAP--------RSFTGEDVVELQCHGG
MNME_CHLPN      ---------------------ETLIDQALLLLMRSP--------RSFTGEDVVEFQCHGG
MNME_PARUW      ---------------------GEHVDDVLVLIMLGK--------RSYTGENTVEIHCHGG
MNME_OPITP      ---------------------GHILDEVLCVFFPQP--------RSYTGEDLLEISTHGN
MNME_BDEBA      ---------------------GDEIDEVLATYFKEG--------RSFTGEEVIEISCHGS
MNME_DESHY      ---------------------AKVLDEVLIGRMSAP--------GSYTGEDVYEINCHGG
MNME_ALKMQ      ----------------------ERIDEVLVSYMKGP--------HTYTTEDVVEINCHGG
MNME_ALKOO      ----------------------KVVDEVLVSYMKGP--------NTYTREDIVEINCHGG
MNME_CLOD6      ----------------------NIIDEVLLAYMKGP--------NSYTGEDVIEINCHGG
MNME_FINM2      ----------------------EIVDEVLVCYMKAP--------HTYTREDVVEIYTHGG
MNME_FUSNN      ----------------------HIVDEVLVSIMKAP--------NTYTREDIIEINCHGG
MNME_CLOB1      ----------------------EMIDEVLVSYMKGP--------RSFTAEDTLEINCHGG
MNME_CLOBK      ----------------------EMIDEVLVSYMKGP--------RSFTAEDTLEINCHGG
MNME_CLOBH      ----------------------EMIDEVLVSYMKGP--------RSFTAEDTLEINCHGG
MNME_CLOBL      ----------------------EMIDEVLVSYMKGP--------RSFTAEDTLEINCHGG
MNME_CLOBM      ----------------------EIIDEVLVSYMKGP--------RSFTAEDTLEINCHGG
MNME_CLOK5      ----------------------EILDEVLVSFMKGP--------KSYTAEDIVEINCHGG
MNME_CLOTE      ----------------------NILDEVLISYMKAP--------RSFTAEDTVEINCHGG
MNME_CLONN      ----------------------EKLDEVIVSYMKGP--------RSFTAEDVVEINCHGG
MNME_CLOAB      ----------------------DIIDEVIVSFMKGP--------KSFTGENVVEVNCHGG
MNME_CLOPE      ----------------------EIIDEVIVSFMKGP--------RSFTAEDTVEINCHGG
MNME_CLOP1      ----------------------EIIDEVIVSFMKGP--------RSFTAEDTVEINCHGG
MNME_CLOPS      ----------------------EIIDEVIVSFMKGP--------RSFTAEDTVEINCHGG
MNME_CLOB8      ---------------------KEIIDEVILSYMKAP--------RSYTGENVVEINCHGG
MNME_LACP7      ----------------------EIIDEVMVIIMRAP--------RSYTMEDSIEIDCHGG
MNME_THEP3      ---------------------EEVYDEVLVSIMKKP--------NTYTREDIVEINCHGG
MNME_THEPX      ---------------------EEVYDEVLVSIMEKP--------NTYTREDIVEINCHGG
MNME_CALS4      ---------------------GEVYDEVLVTVMRKP--------NTYTREDVVEINCHGG
MNME_HUNT2      ---------------------GAVLDEVLLSKMEKP--------KTFTREDVVEINCHGG
MNME_CARHZ      ---------------------GKIVDEVLVSVMRAP--------KSYTGEDVVEINCHGG
MNME_DESRM      ---------------------GEIIDEVLLSIMRGP--------KSFTAEDVIEISCHGG
MNME_PELTS      ---------------------GNIVDEVLLSFMRAP--------RTYTREDVVEINCHGG
MNME_CALS8      ---------------------DEFIDQAILIKFKAP--------HSYTGEDVVEIQSHGG
MNME_SYNWW      ----------------------EIIDEVLLGLMRAP--------RSYTGEDVVEINCHGG
MNME_NATTJ      ---------------------NRILDEVLVVFMNKP--------YTYTCEDVVEIHCHGG
MNME_DESPS      ---------------------HQ-LDEVLVVYMRAP--------KTYTCEDIVEIHCHGN
MNME_MOOTA      ---------------------GESLDEVLVSVMRAP--------HSYTAEDVVEINCHGG
MNME_DESAP      ---------------------GETVDEVLVSVMRAP--------KSYTREDVVEINGHGG
MNME_ROSS1      ---------------------GAVVDEALAVFMRGP--------RSFTAEDTAEISVHGG
MNME_ROSCS      ---------------------GVRVDEALAVFMRGP--------RSFTAEDTVEISVHGG
MNME_CHLAA      ---------------------GEVIDEALLTLMAAP--------HSFTREDVVEISCHGG
MNME_SYMTH      ---------------------GDRIDEALALVMRGP--------HSYTGEDVVELQCHGG
MNME_HELMI      ---------------------HRVIDEALVAWMVAP--------RTFTTEDVVEFHCHGG
MNME_GEOSL      ---------------------GEAVDEAMAVLMVRP--------RSYTREDVLEIQCHGG
MNME_GEOMG      ---------------------RDTVDEVMAVLMRAP--------RSFTREDVLEIQCHGG
MNME_GEOUR      ---------------------ADCLDEVMVVFMKGP--------HSYTREDVLEIQCHGG
MNME_PELPD      ---------------------GAVVDEVMAVIMRAP--------HSYTREDVLELHCHGG
MNME_PELCD      ---------------------GKIVDEVMAVIMRKP--------RSYTREDVVEIHCHGG
MNME_SYNAS      ---------------------GQVIDEVLVSLMKAP--------RSYTGEDTLEIYCHGG
MNME_SYNFM      ---------------------GQSLDEVLVGTMAAP--------HTYTREDVVEINCHSG
MNME_DESVH      ------------------------LDDVLAVHMPGP--------RTFTGEDVSEIHCHGG
MNME_DESVV      ------------------------LDDVLAVHMPGP--------RTFTGEDVSEIHCHGG
MNME_DESAG      ---------------------RRILDDVLAVHMPAP--------RTFTGEDVVEINCHGG
MNME_LAWIP      -----------------------FLDDILAVYMPAP--------YTFTGEDVVELHCHGG
MNME_NOSS1      ----------------------QIVDEALLLLMKAP--------RSYTREDVVEFHCHGG
MNME_TRIV2      ----------------------QIVDEALLLLMKAP--------RSYTREDVVEFHCHGG
MNME_TRIEI      ----------------------QLVDETLLLIMKAP--------RSYTREDVVEFHCHGG
MNME_ACAM1      ----------------------QIIDEGLLLLMLAP--------RSYTREDVVEFHCHGG
MNME_SYNY3      ----------------------AAIDEALLLLMLAP--------RSYTKEDVVEFQCHGG
MNME_MICAN      ----------------------AIIDEALLLLMLAP--------RSFTREDVVEFHCHGG
MNME_SYNP2      ----------------------TIVDEALLLLMLAP--------RSFTAEDVVEFHCHGG
MNME_SYNE7      ----------------------RLVDEALLLPMLAP--------RSYTREDVVELHCHGG
MNME_SYNP6      ----------------------RLVDEALLLPMLAP--------RSYTREDVVELHCHGG
MNME_THEEB      ----------------------ERVDEALLLLMLAP--------RSYTREDVVEFHCHGG
MNME_SYNJA      ----------------------RRLDEALAVWMQAP--------RSYTREDVVELHCHGG
MNME_SYNJB      ----------------------QILDEALAVWMQAP--------RSYTREDVAELHCHGG
MNME_GLOVI      ----------------------GILDECLVLYMQAP--------RSFTREDVVEFHCHGG
MNME_PROM1      ----------------------KYIDEVLILVMKGP--------RSFTGEDVVEIHCHGG
MNME_PROMT      ----------------------KYIDEVLILVMKGP--------RSFTGEDVVEIHCHGG
MNME_PROMA      ----------------------KNIDEVLILIMDGP--------RSFTGEDVVEIHCHGG
MNME_PROM3      ----------------------ERIDEVLVLLMKGP--------RSFTGEDVVEIHCHGG
MNME_PROMM      ----------------------ERIDEVLVLLMKGP--------RSFTGEDVVEIHCHGG
MNME_SYNSC      ----------------------RRLDEVLLLLMRGP--------RSFTGEDVVEIHCHGG
MNME_SYNPX      ----------------------RRLDEVLLLLMRGP--------RSFTGEDVVEIHCHGG
MNME_SYNS9      ----------------------RRLDEVLLLLMRAP--------RSFTGEDVVEIHCHGG
MNME_SYNPW      ----------------------ERIDEVLVLLMLAP--------RSFTGEDVVEIHCHGG
MNME_SYNS3      ----------------------ERLDEVLVLVMLAP--------RSFTGEDVVEIHCHGG
MNME_SYNR3      ----------------------DVVDEVLLLLMRAP--------RSFTRETVVEFHGHGG
MNME_PROMS      ----------------------KFIDEVLILVMKSP--------NSFTGEDVVELHCHGG
MNME_PROM0      ----------------------KFIDEVLILVMKSP--------NSFTGEDVVELHCHGG
MNME_PROM2      ----------------------KFIDEVLISVMKSP--------NSFTGEDVVELHCHGG
MNME_PROM9      ----------------------KFIDEVLILVMKSP--------NSFTGEDVVELHCHGG
MNME_PROM5      ----------------------KYIDEILISVMHSP--------NSFTGEDVVELHCHGG
MNME_PROMP      ----------------------KFIDEILITVMHSP--------NSFTGEDIVELHCHGG
MNME_CYACA      ----------------------SFVDEVLILLMMAP--------RSYTAENVVEIHCHAS
MNME_CYAM1      -----------------------LIDEVLVLPMLAP--------RSYTRQDVVEIHAHGG
MNME_BACFR      --------------------GEEMIDEVLVSLFRAP--------HSYTGEDSTEITCHGS
MNME_BACFN      --------------------GEEMIDEVLVSLFRAP--------HSYTGEDSTEITCHGS
MNME_BACTN      --------------------GEEVIDEVLVSLFRAP--------HSYTGEDSTEITCHGS
MNME_BACV8      QEKSETLQKTSSIT----SSAEEVIDEVLISLFRAP--------HSYTGEDSTEIMCHGS
MNME_PARD8      -------------------NNDETIDEVIAAVFRAP--------HSFTGEDTVEITCHGS
MNME_PORGI      --------------------ADELIDEVILTCFHGP--------HSFTAEHTVEIACHGS
MNME_FLAJ1      --------------------NGKTLDEVLVSVFKGP--------NSYTGEDTIEISCHGS
MNME_FLAPJ      --------------------GTKVLDQVLLSIFKGT--------NSYTGENTIEISCHGS
MNME_GRAFK      --------------------GERTIDEVLASVFRAP--------KSYTGEETVELSCHGS
MNME_CYTH3      --------------------EGRILDEVVVTVFKGP--------KSFTKEDVVEISCHGS
MNME_SALRD      -------------------EAGTDIDQVVATVFRAP--------NSATGEHVVEVSCHGG
MNME_CHLTE      --------------------GEEMVDEVIALVFRAP--------RSFTAEQMVEFTCHGG
MNME_CHLPD      --------------------GLTLIDEVIALVFRSP--------SSFTAEDMVEFTCHGG
MNME_CHLPM      --------------------SRGMVDEVIALVFRAP--------SSFTMEDMVEFTCHGG
MNME_PELLD      --------------------GEGMVDEVVALVFRAP--------SSFTMEDMVEFTCHGG
MNME_CHLCH      --------------------AQGVVDEVIALVFRSP--------RSFTMEDMVEFSCHGG
MNME_BORAP      -------------------ENNCKVDEVVVCLYRAP--------KSFTGQDAVEVIAHGS
MNME_BORBU      -------------------ENGCKVDEVVVCLYRAP--------KSFTGQDAIEVMAHGS
MNME_BORBP      -------------------ENNCKVDEVVVCLYRAP--------KSFTGQDSIEVIAHGS
MNME_TREPA      --------------------GKTRVDEVVLLVYRAP--------HSFTGEHAVEIICHGG
MNME_TREDE      -------------------ESKKEVDEVTVCVYREP--------KSFTGEDSVEFICHGG
MNME_LEPBJ      ------------------------IDQILFFYFKTP--------NSYTGEDLCEFHFHGN
MNME_LEPBL      ------------------------IDQILFFYFKTP--------NSYTGEDLCEFHFHGN
MNME_LEPIN      ------------------------IDQILFFYFKSP--------NSYTGEDLCEFHFHGN
MNME_LEPIC      ------------------------IDQILFFYFKSP--------NSYTGEDLCEFHFHGN
MNME_LEPBA      ------------------------LDQIVFFYFPAP--------NSYTGEDLAEFHLHGN
MNME_LEPBP      ------------------------LDQIVFFYFPAP--------NSYTGEDLAEFHLHGN
MNME_UNCTG      ------------------------KDEVLCTFFKAP--------HTYTGENLVEIAAHGN
MNME_SULMW      ------------------------IDKVLIFLFKKP--------KSYTGEDIVEISCHGS
MNME_CARRP      ------------------------VDYAMIIFFKKP--------NTFTGEDIIEFHIHNN
                                                             .   :   *.     

MNME_THEMA      PLVVKKLLDLFLKS--------------GARMAEPGEFTKRAFLNGKMDLTSAEAVRDLI
MNME_THESQ      PLVVKKLLDLFLKS--------------GARMAEPGEFTKRAFLNGKMDLTSAEAVRDLI
MNME_THEP1      PLVVKKLLDLFLKS--------------GARMAEPGEFTKRAFLNGKMDLTSAEAVRDLI
MNME_FERNB      ILVTNKIIDTLLKL--------------GARLAENGEFTRRAFLNGKIDLIKAESILQII
MNME_THEM4      ILVTQNVLDAILKS--------------GARIAKRGEFTKRGFLNGKISLVQAEAIYQII
MNME_PSELT      IAVTQSILDTLISH--------------GARPAEPGEFTRRAFLNGKIDLTKAEAVKQII
MNME_PETMO      KLITYAVLNTIIKY--------------GARQALPGEFTKRAVLNGKMDLIKAEAVNNVI
MNME_AYWBP      ILITQMVLERILSL--------------DIRLAFPGEFSQRAYLNGKMDLIQAESIMDLI
MNME_ONYPE      ILITQMVLERVLSL--------------DIRLAFPGEFSQRAYLNGKMDLIQAESIMDLI
MNME_ACHLI      ILITQKVLERILET--------------GIELAQPGEFSKRAFLNGRIDLVQAEAIMDII
MNME_BACAN      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACHK      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACCZ      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACAH      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACC1      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACCR      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACMK      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACCN      LVSVNKVLQLILAQ--------------GVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACSU      IVTVNQVLQLALRE--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACVZ      IVTVNQVLQLALRE--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACP2      IVTVNKVLQLALRE--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_BACLD      LVTVNQVLQLVLRE--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_GEOKA      FVSVNRVLQLVLAN--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDLI
MNME_GEOTN      FVSVNRVLQLVLAN--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDLI
MNME_LYSSC      LVSVNRVLQLALTN--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_OCEIH      MVAVNRVLEIVLAK--------------GVRLAEPGEFTKRAFLHGRIDLSQAEAVMDLI
MNME_BACSK      LVSVNRVLQAVLAK--------------GARLAEPGEFTKRAFLNGRIDLSQAEGVIDLI
MNME_BACHD      LVSVNRVLQLVLNH--------------GARLAEPGEFTKRAFLNGRIDLSQAEGVIDLI
MNME_EXIS2      IVAVNRVLELILEQP-------------DVRLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_STAAC      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAE      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAT      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAA3      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAA2      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAA9      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAR      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAW      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAN      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAA8      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAA1      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAM      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAS      ILTINRVLELTMTY--------------GARMAEPGEFTKRAFLNGRIDLSQAEAVMDFI
MNME_STAAB      ILTINRVLELTMTY--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDFV
MNME_STAES      ILTINRILELTMTY--------------GARMAEPGEYTKRAFLNGRIDLSQAEAVMDFI
MNME_STAEQ      ILTINRILELTMTY--------------GARMAEPGEYTKRAFLNGRIDLSQAEAVMDFI
MNME_STAHJ      ILTINRILELTMTH--------------GARMAEPGEYTKRAFLNGRIDLSQAEAVMDFI
MNME_STAS1      ILTINRILELTMTY--------------GARMADPGEYTKRAFLNGRIDLSQAEAVMDFI
MNME_LISMO      IVSVNRVLQLLLRN--------------GANLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_LISMF      IVSVNRVLQLLLRN--------------GANLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_LISIN      IVSVNRVLQLLLRN--------------GANLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_LISW6      IVSVNRVLQLLLRN--------------GANLAEPGEFTKRAFLNGRIDLSQAEAVMDLI
MNME_ENTFA      IVVVNQLLQLLLRE--------------GARMAEPGEFTKRAFLNGRMDLSQAEAVMDLI
MNME_LACP3      IVATNRILQLLLGE--------------GARMAEPGEFTKRAFLNGRIDLTEAESVMDLI
MNME_LACSS      IVATNRILQLLMSY--------------GARMAEPGEFTKRAFLNGRIDLTQAESVMDLI
MNME_LACS1      IVPTNQILQLLLSN--------------GARLAEPGEFTKRAFLHGRIDLTQAESVMDLI
MNME_LACPL      LVATNEILQLILSH--------------GARMAEPGEFTKRAFLNGRLDLSQAEAVMDLI
MNME_LACBA      IVATNRILQLCLSY--------------GARLAEPGEYTKRAFLNGRIDLTQAESVMDLI
MNME_PEDPA      IVATNRILQIILGL--------------DARLAKPGEFTERAFLNGRIDLSQAEAVMDLI
MNME_LACLM      IAVTQEILQLLLRN--------------GARLAEPGEFTKRAFLNGRIDLAQAESVMDLI
MNME_LACLS      IAVTQEILQLLLRN--------------GARLAEPGEFTKRAFLNGRIDLAQAESVMDLI
MNME_LACLA      IAVTQEILQLLLRN--------------GARLAEPGEFTKRAFLNGRIDLAQAESVMDLI
MNME_STRA1      IAVTNEILQLILRH--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDLI
MNME_STRA5      IAVTNEILQLILRH--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDLI
MNME_STRA3      IAVTNEILQLILRH--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDLI
MNME_STRAG      IAVTNEILQLILAT--------------MDHNAEPGEFTKRAFLNGRVDLTQAEAVMDLI
MNME_STRTD      VAVTNEILQLLIRS--------------GARMAEPGEFTKRAFLNGRIDLTQAEAVMDLI
MNME_STRT1      VAVTNEILQLLIRS--------------GARMAEPGEFTKRAFLNGRIDLTQAEAVMDLI
MNME_STRT2      VAVTNEILQLLIRS--------------GARMAEPGEFTKRAFLNGRIDLTQAEAVMDLI
MNME_STRMU      VAVTNEILQLVLRS--------------GARMADPGEFTKRAFLNGRVDLAQAEAVMDLI
MNME_STRP8      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRPD      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRP6      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRP3      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRPG      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRP1      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRPC      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRPM      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRPF      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRGC      IAVTNEILQLAIRE--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRSV      IAVTNEILQLAIRE--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRR6      IAVTNEILQLAIRE--------------GARLAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRP2      IAVTNEILQLAIRE--------------GARLAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRPI      IAVTNEILQLAIRE--------------GARLAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRPN      IAVTNEILQLAIRE--------------GARLAEPGEFTKRAFLNGRVDLTQAEAVMDII
MNME_STRSY      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDVI
MNME_STRS2      IAVTNEILQLLIRQ--------------GARMAEPGEFTKRAFLNGRVDLTQAEAVMDVI
MNME_LACGA      MIVTNDILQLLLAN--------------GARMADPGEFTKRAFMNGRIDLTQAESVMDIV
MNME_LACJO      MIVTNDILQLLLAN--------------GARMADPGEFTKRAFMNGRIDLTQAESVMDIV
MNME_LACAC      IVVTNHILQLLLKH--------------GARMADPGEFTKRAFVNGRIDLTQAESVMDIV
MNME_LACH4      IVVTNHILQLLLSH--------------GARMADPGEFTKRAFVNGRIDLTQAESVMDIV
MNME_LACDB      IVVTNDILQLLLAN--------------GARMADPGEFTKRAFVNGRIDLTQAESVMDII
MNME_LACDA      IVVTNDILQLLLAN--------------GARMADPGEFTKRAFVNGRIDLTQAESVMDII
MNME_MYCGE      MLIVNEICALLLKKG--------------GVYAKPGEFTQRSFLNGKMSLQQASAVNKLI
MNME_MYCPN      MVIVNEIIGLLLKHG--------------AVQAQPGEFTQRGYLNGKMSLNQAASVNNLV
MNME_MYCGA      LFVINKIMALLNKHG--------------AHLARRGEFSKRSYINKKIDLNQATAIHDLI
MNME_UREPA      IVVANLIIKTLIKYG--------------CQPAQRGEFSRRALLNKKMDLSKIEAINNLV
MNME_UREP2      IVVANLIIKTLIKYG--------------CQPAQRGEFSRRALLNKKMDLSKIEAINNLV
MNME_MYCPE      VLITNKILDLILESG--------------ARLAENGEFTKRAFLNNKLTLRQANSINNLI
MNME_MYCMS      ILNTNKIINILIQSG--------------ARMALRGEFSQRSFLNGKIDLIQAEGINNLI
MNME_MYCCT      ILNTNKIINILIQSG--------------ARMALRGEFSQRSFLNGKIDLIQAEGINNLI
MNME_MESFL      ILNTQRIINLIIKNG--------------ARMANKGEFSQRAFLNNKIDLIQAEGINDLI
MNME_MYCPU      IVVSTLILETIVANG--------------ARLAEPGEFSKRAFLNGKLDLVKAEAINDLI
MNME_MYCMO      IVVTNLVLQLLIANG--------------ARLAERGEFSRRSFLNKKMDFVKAEAINDLI
MNME_MYCAP      VVITNSILELLLANG--------------ARLAEPGEFSRRSFLNGKMDLIKAEAINDLI
MNME_MYCS5      MIVTNKILELLISNG--------------ARLAEPGEFTRRAFLNGKLDLSKADAIHNLI
MNME_MYCHJ      VLNTNLILELILKTK-------------LARLANPGEFSLRAFLNGKIDLVKAQAINDLI
MNME_MYCH2      VLNTNLILELILKTK-------------LARLANPGEFSLRAFLNGKIDLVKAQAINDLI
MNME_MYCH7      VLNTNLILELILKTK-------------LARLANPGEFSLRAFLNGKIDLVKAQAINDLI
MNME_CAMJE      FSVSEVLLEELVSL--------------GARLALAGEFSKRACLNGKMTPLKALNIQDLI
MNME_CAMJJ      FSVSEVLLEELVSL--------------GARLALAGEFSKRACLNGKMTPLKALNIQDLI
MNME_CAMJR      FSVSEVLLEELVSL--------------GARLALAGEFSKRACLNGKMTPLKALNIQDLI
MNME_CAMJ8      FSVSEVLLEELVSL--------------GARLALAGEFSKRACLNGKMTPLKALNIQDLI
MNME_CAMJD      FSVSEVLLEELVSL--------------GARFALAGEFSKRACLNGKMTPLKALNIQDLI
MNME_CAMC5      FVVADMILNELVKL--------------GVRLAEPGEFSKRAFLNDKLDLAKAEAIQGLI
MNME_CAMC1      VMVSERILNELIRA--------------GARLAMPGEFSKRAFLNGKMDLAKAEAMQGLI
MNME_CAMHC      FTLENLIMDELITN--------------GARIAMPGEFSKRAFLNDKMDLSKAEAIQSII
MNME_CAMFF      VVVANLIIDELLRL--------------GARVANPGEFSKRAFLNGKMDLVKAESIQSLI
MNME_SULDN      FIVAQSILKTTLLH--------------GARLATAGEFSKRAFFNGRIDLSKAEAIAQLI
MNME_ARCB4      VAISNMIVDEVLNA--------------GARLANPGEFSKRAFFNNKIDLTKAEAISKII
MNME_NITSB      VVVANMILQELLKA--------------GARLANPGEFSKRAFFNGKIDLSEAEAIAKMI
MNME_SULNB      MIVAQEILDTILSY--------------GIRLAEPGEFSKRAFFNGKIDLTEAEAISKLI
MNME_HELHP      IVSARAIVQLCLKL--------------GARMAQAGEFAKRAFLGGRLDLAQVQAVAGLI
MNME_WOLSU      TLIARKIIQEALAL--------------GARVARAGEFTYRAFLNGRIDLSQAEAIGKLI
MNME_HELPY      PLLAQNILQACLNL--------------GARLAKAGEFSKKAFLNHKMDLSEIEASVQLI
MNME_HELPJ      PLLAQNILQACLNL--------------GARLAKAGEFSKKAFLNHKMDLSEIEASVQLI
MNME_HELPH      PLLAQNILQACLNL--------------GARLAKAGEFSKKAFLNHKMDLSEIEASVQLI
MNME_HELAH      PLLTQNILQACLNL--------------GARLAQAGEFSKKAFLNHKMDLSEIEASIRLI
MNME_ECOLI      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECOLC      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SHIBS      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECODH      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SHIFL      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SHIF8      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SHIDS      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECO57      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECOUT      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECOL5      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECOK1      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECOL6      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECOSM      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ECO24      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLYDKLDLAQAEAIADLI
MNME_ECOHS      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SHISS      PVILDLLLKRILTIP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SALCH      PVILDLLLKRILTLP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SALPB      PVILDLLLKRILTLP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SALTY      PVILDLLLKRILTLP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SALPA      PVILDLLLKRILTLP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SALTI      PVILDLLLKRILTLP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SALAR      PVILDLLLKRILTIP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_CITK8      PVILDLLLKRILTLP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ENT38      PVILDLLLKRILTLP-------------GLRIAKPGEFSERAFLNDKLDLAQAEAIADLI
MNME_KLEP7      PVILDLLLKRILTLP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_CROS8      PVILDLLLKRILTLP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERPA      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERPN      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERPP      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERPE      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERPS      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERP3      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERPY      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_YERE8      PVILDLLLKRILALP-------------GLRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SERP5      PVILDLLLKRVLALP-------------GMRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PECAS      PVILDLLLQRILTLP-------------NVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PHOLL      PVILDLLLKRILTLS-------------GVRIANPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SODGM      PVILDLLLQRIVAMP-------------GVRIARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_ACTP2      QVILDILLKRILTIK-------------GIRIARAGEFSEQAFLNDKLDLAQAEAIADLI
MNME_ACTPJ      QVILDILLKRILTIK-------------GIRIARAGEFSEQAFLNDKLDLAQAEAIADLI
MNME_HAEDU      QVILDLLLKRILTIN-------------GIRIARTGEFSEQAFLNDKLDLAQAEAIADLI
MNME_HAEI8      QVVLDLLLKRILQID-------------GIRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_HAEIE      QVVLDLLLKRILQID-------------GIRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_HAEIN      QVVLDLLLKRILQID-------------GIRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_HAEIG      QVVLDLLLKRILQID-------------GIRLARPGEFSEQAFLNDKFDLAQAEAIADLI
MNME_MANSM      QVVLDLLLKRILQVK-------------GVRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_ACTSZ      QVVLDLLLKRILQVN-------------GVRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_PASMU      QVVLDLLLKRILQLE-------------GLRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_HAES1      QIVMDLLLKRILQID-------------GIRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_HISS2      QIVMDLLLKRILQID-------------GIRLARPGEFSEQAFLNDKLDLAQAEAIADLI
MNME_AERHH      PVIMDMLVRRILQIK-------------GLRPARPGEFSERAFMNDKLDLAQAEAIADLI
MNME_AERS4      PVIMDMLVRRILQIK-------------GLRPARPGEFSERAFMNDKLDLAQAEAIADLI
MNME_SHEB8      QIVLDMLIKRVMEVG-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEB9      QIVLDMLIKRVMEVG-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEB5      QIVLDMLIKRVMEVG-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEPC      QIVLDMLIKRVLEVE-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHESW      QIVLDMLIKRVLEVE-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHESA      QIVLDMLIKRVLEVE-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHESM      QIVLDMLIKRVLEVE-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHESR      QIVLDMLIKRVLEVE-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEON      QIVLDMLIKRVLEVE-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEFN      QIVLDMLIKRVMEID-------------GIRIARPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEDO      QIVLDMLIKRVMQVS-------------GVRIAKPGEFSEQAFLNDKLDLTQAEAIADLI
MNME_SHEHH      QIVLDMLIKRVMEVD-------------GLRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEPA      QIVLDMLIKRVMEVD-------------GLRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHESH      QIVLDMLIKRVMEVE-------------GIRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEWM      QIVLDMLIKRVMEVD-------------GVRIAKPGEFSEQAFMNDKMDLTQAEAIADLI
MNME_SHELP      QVVLDMLIKRVMDVD-------------GVRIAKPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_SHEAM      QVVMDMLIRAVLKVK-------------GVRIARPGEFSEQAFMNDKLDLTQAEAIADLI
MNME_VIBCH      PVVMDMLIRRILQIK-------------GVRPARPGEFSERAFLNDKMDLTQAEAIADLI
MNME_VIBC3      PVVMDMLIRRILQIK-------------GVRPARPGEFSERAFLNDKMDLTQAEAIADLI
MNME_VIBCB      PVVMDMLIKRILGID-------------GVRAARPGEFSERAFLNDKMDLTQAEAIADLI
MNME_VIBPA      PVVMDMLIKRILGIA-------------GVRAARPGEFSERAFLNDKMDLTQAEAIADLI
MNME_VIBVU      PVVMDMLIKRILTIS-------------GVRPARPGEFSERAFLNDKMDLTQAEAIADLI
MNME_VIBVY      PVVMDMLIKRILTIS-------------GVRPARPGEFSERAFLNDKMDLTQAEAIADLI
MNME_ALIF1      PVVMDMLIKRILKID-------------GIRTARPGEFSERAFLNDKMDLAQAEAIADLI
MNME_PHOPR      PVLMDMMIRRILKLE-------------GIRPARPGEFSERAFMNDKLDLAQAEAIADLI
MNME_PSYIN      PVVMDMLIKAILSIK-------------NLRGANPGEFSERAFMNDKLDLAQAEGIADLI
MNME_PSEA6      QVVLDMLIKATLHVP-------------NVRLARPGEFSERAYLNDKLDLAQAEAIADLI
MNME_PSEHT      PVVLDMLLKEISKIE-------------GVRLAKPGEFSERAFMNDKLDLTQAEAIADLI
MNME_IDILO      PVIIDMIIRAILEIP-------------GIRPARPGEFSERAFLNDKLDLTQAEAIADLI
MNME_COLP3      PVILDMLLKVILAQP-------------KVIMAKPGEFSEQAFLNDKLDLTQAEAIADLI
MNME_CHRSD      PVIMDLLLARCVAL--------------GARLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_MARMS      PVIMDMLLSHCVAL--------------GARLARPGEFSERAFMNDKMDLTQAEAIADLI
MNME_MARHV      TVILDILLREVCSL--------------GARLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_HAHCH      PVVLDILVKRIVSL--------------GARLARPGEFSERAFMNDKLDLVQAEAIADLI
MNME_PSEAE      PVVLDLLVQRCLEL--------------GARQARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEAB      PVVLDLLVQRCLEL--------------GARQARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEA7      PVVLDLLVQRCLEL--------------GARQARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEPU      PVVLDMLLQRCVQV--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEP1      PVVLDMLLQRCVQV--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEPK      PVVLDMLLQRCVQV--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEPG      PVVLDMLLQRCVQV--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEPW      PVVLDMLLQRCVQV--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEE4      PVVMDMLLQRCLQL--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEF5      PIVLDMLLQRCLEL--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEPF      PIVLDMLLKRCLEL--------------GCRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSE14      PIVLDMLLQRCLQL--------------GSRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEU2      PIVLDMLLQRCLQL--------------GSRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSESM      PIVLDMLLQRCLQL--------------GSRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEMY      PVVLDLLLRRCLEL--------------GARLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_PSEU5      PVVLDMLLQRCVDL--------------GVRLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_SACD2      PVILDMLLDAVVQA--------------GARLARPGEFSERAFLNDKLDLAQAEAIADLI
MNME_HYDCU      PVILQWLLERVVQL--------------GARLAEPGEFSKQAFLNDKLDLAQAEAIADLI
MNME_LEGPC      PVVLDLLIKESIAA--------------GARLARPGEFSERAFLNDKIDLIQAEAIADLI
MNME_LEGPH      PVVLDLLIKESIAA--------------GARLARPGEFSERAFLNDKIDLIQAEAIADLI
MNME_LEGPA      PVVLDLLIKESIAA--------------GARLARPGEFSERAFLNDKIDLIQAEAIADLI
MNME_LEGPL      PVVLDLLIKESIAA--------------GARLARPGEFSERAFLNDKIDLIQAEAIADLI
MNME_ALCBS      PVILDMLVATCIEA--------------GARQARAGEFSQRAFLNDKMDLTQAEAIADLI
MNME_METCA      PVVLDLLLRRTLQL--------------GCRLARPGEFSERAYLNGKLDLAQAEAIADLI
MNME_NITOC      PAIMDWLLSSVLQL--------------GVRLARPGEFSERAFLNNKIDLAQAEAIADLI
MNME_ALKEH      EVVVDRLLRRLHAL--------------GAHPARPGEFSERAFLNGRMDLTQAEAIADLI
MNME_COXBU      PVVMDRLLNTVLKA--------------GARQARPGEFSERAFLNNKIDLAQAEAVADLI
MNME_COXBN      PVVMDRLLNTVLKA--------------GARQARPGEFSERAFLNNKIDLAQAEAVADLI
MNME_COXBR      PVVMDRLLNTVLKA--------------GARQARPGEFSERAFLNNKIDLAQAEAVADLI
MNME_PSYCK      MILQNQLLARVFEL--------------GAKQASAGEFSYRAFDNDKLDLVQAEAIADAI
MNME_PSYA2      MILQNQLLARVFEL--------------GAKQAGAGEFSYRAFDNDKLDLVQAEAIADAI
MNME_PSYWF      MILQNQLLARVFEL--------------GAHQAQAGEFSYRAFDNDKLDLLQAEAIADAI
MNME_ACIBY      PVIQNALLGRLFEL--------------GAIAAKAGEFSMRAFENGKMDLVQAEAIADLI
MNME_ACIBT      PVIQNALLGRLFEL--------------GAIAAKAGEFSMRAFENGKMDLVQAEAIADLI
MNME_ACIAD      PVIQNALLERLFEL--------------GAKAAKAGEFSMRAFENGKLDLVQAEAIADLI
MNME_DICNV      IAVAHALLSATLDF--------------GARLAHAGEFTQRAFLNDKLDLAQAEAVADLI
MNME_BORBR      PAVLRRILARCLQAGHDL----------GLRPAEPGEFTRRAFLNERLDLAQAEAVADLI
MNME_BORPA      PAVLRRILARCLQAGHDL----------GLRPAEPGEFTRRAFLNERLDLAQAEAVADLI
MNME_BORPE      PAVLRRILARCLQAGHDL----------GLRPAEPGEFTRRAFLNERLDLAQAEAVADLI
MNME_BORPD      PAVLRRILERCLQAGADL----------GVRLAEPGEFTRRAFLNDRMDLAQAEAVADLI
MNME_BORA1      PAVLKRLLARCLEAGRSL----------GMRLAEPGEFTRRAFLNDRMDLAQAEAVADLI
MNME_CUPPJ      PVVMQMLLTRCLQAGHGI----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_CUPNH      PVVMQMLLTRCLQAGDGI----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_CUPMC      PVVMQMLLSRCLEAGKDI----------GLRVAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_RALSO      PVVMQLLLSRCLRAGHGI----------GLRVAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURM7      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURMA      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURP6      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURP0      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURMS      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURM9      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURPS      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURP1      PIVLQLLLQRCLDAGRAH----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURTA      PIVLQLVLQRCLDAGRAY----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURCA      PIVMQLLLQRCLDAGRGF----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURCH      PIVMQLLLQRCLDAGRGF----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURCC      PIVMQLLLQRCLDAGRGF----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURL3      PIVMQLLLQRCLDAGRGF----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURCM      PIVMQLLLQRCLDAGRGF----------GLRLAQPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURA4      PIVMQLLLQRCLDAGRGF----------GLRLAQPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_BURVG      PIVMQLLLQRCLDAGRGF----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_PARXL      PVVLQLVLQRCIDAGRAF----------GLRLAEPGEFTRRAFLNDKLDLAQAEAVADLI
MNME_JANMA      PIVLQMLLTRCLEAGTDI----------GLRMAQPGEFTHRAFLNDKLDLAQAEGVIDLI
MNME_HERAR      PVVLQMLLTRCLEAGADI----------GLRMAEPGEFTHRAFLNDKLDLAQAEGVIDLI
MNME_ACISJ      PVVLQLLLARCLEAA--------QGLLPRLRLAEPGEFTERAFLNDKIDLAQAEAIADLI
MNME_ACIAC      PVVLQLLLARCLQAAGEADRATGRPRLPGLRLARPGEFTERAFLNDKIDLAQAEAIADLI
MNME_VEREI      PVVLQLLLARCLEAGAGADPATGRPCLPGLRLAQPGEFTERAFLNDKIDLAQAEAIADLI
MNME_RHOFT      PVVLQLLLARCLEAGAELDPVSQMPRLVGLRPALPGEFSERAFLNDKIDLAQAEAIADLI
MNME_POLSJ      PVVLQLLLARCLEAGAALNPAIGQPWLAQLRVAQPGEFTERAFLNDKIDLAQAEAIADLI
MNME_POLNA      PVVLQLLLARCLEAGAALDPATGQPVLAQLRVAEPGEFTERAFLNDKIDLAQAEAIADLI
MNME_LEPCP      PVVLQLLLARCLEAAGEIGTD-GRPRLPGLRLAQPGEFTERAYLNDKLDLAQAEAVADLI
MNME_METPP      PVLLQLLLARCLEAAAQPDARSGLPRLRGLRVAEPGEFTERAFLNDKLDLAQAEAVADLI
MNME_NEIMA      PVVMDMLLNRCLELGA--------------RLAEPGEFTKRAFLNDKLDLAQAEGVADLI
MNME_NEIMB      PVVMDMLLNRCLELGA--------------RLAEPGEFTKRAFLNDKLDLAQAEGVADLI
MNME_NEIM0      PVVMDMLLNRCLELGA--------------RLAEPGEFTKRAFLNDKLDLAQAEGVADLI
MNME_NEIMF      PVVMDMLLNRCLELGA--------------RLAEPGEFTKRAFLNDKLDLAQAEGVADLI
MNME_NEIG1      PVVMEMLLNRCLELGA--------------RLAEPGEFTKRAFLNDKLDLAQAEGVADLI
MNME_CHRVO      PVVLKMLLARCVELGA--------------RLAEPGEFTKRAFLNDKLDLAQAESVADLI
MNME_AZOSB      PVVMQMLLARCLALGA--------------RLAEPGEFTRRAFLNGKLDLAQAEAVADLI
MNME_AROAE      PVVLQLVLARCLELGA--------------RLAEPGEFSRRAFLNGKMDLAQAEAVADLI
MNME_DECAR      PVVMQMLLARCLDLGA--------------RLAEPGEFSRRAFLNGKMDLAQAEAVADLI
MNME_NITEU      PAVMNLLLDRCLQLGA--------------RLAEPGEFTLRAFLNDKLDLAQAEGVADLI
MNME_NITEC      PAVMNLLLTRCLQLGA--------------RLAEPGEFTLRAFLNEKLDLAQAEGVADLI
MNME_NITMU      PAVMNLLLASCLSAGA--------------RLAQPGEFTLRAFLNNKLDLAQAESVADLI
MNME_THIDA      PVVLDLILQRCLELGA--------------RLAEPGEFSRRAFLNGKLDLAQAEAVADLI
MNME_METFK      PALMQILLKRCLELGA--------------RQAEPGEFTRRAYLNDKLDLAQAEAVADVI
MNME_POLAQ      PQLLELVMKRCLELGKAL----------GLVIAEPGEFTLRAYLNNKVDLAQAEAIADLI
MNME_FRATF      PFILNLIIKAALNC--------------GARMAKAGEFTERAFLNNKLDLAQAEAVADII
MNME_FRATH      PFILNLIIKAALNC--------------GARMAKAGEFTERAFLNNKLDLAQAEAVADII
MNME_FRATO      PFILNLIIKAALNC--------------GARIAKAGEFTERAFLNNKLDLAQAEAVADII
MNME_FRATT      PFILNLIIKAALNC--------------GARMAKAGEFTERAFLNNKLDLAQAEAVADII
MNME_FRAT1      PFILNLIIKAALNC--------------GARMAKAGEFTERAFLNNKLDLAQAEAVADII
MNME_FRATW      PFILNLIIKAALNC--------------GARMAKAGEFTERAFLNNKLDLAQAEAVADII
MNME_FRATN      PFILNLIIKAALNC--------------GARMAKAGEFTERAFLNNKLDLTQAEAVADII
MNME_FRAP2      PFILNLIIKATLEY--------------GARMANAGEFTERAFLNNKLDLTQAEAVADII
MNME_RUTMC      MSVMCCLLESVISM--------------GAKPADPGEFSKRAFLNGKMNLVQAEAVADMI
MNME_VESOH      MIGMRLLLESAISM--------------GAKLAESGEFSKRSFLNGKMDLVQAEAISDMI
MNME_XANAC      PVLLRQLVARCIEL--------------GARQARAGEFSERAFLNGKLDLAQAEAIADLI
MNME_XANC5      PVLLRQLVARCIEL--------------GARQARAGEFSERAFLNGKLDLAQAEAIADLI
MNME_XANOM      PVLLRQLVARCIEL--------------GARQARAGEFSERAFLNGKLDLAQAEAIADVI
MNME_XANOR      PVLLRQLVARCIEL--------------GARQARAGEFSERAFLNGKLDLAQAEAIADVI
MNME_XANCP      PVLLRQLVARCIAL--------------GARQARAGEFSERAFLNGKLDLAQAEAIADLI
MNME_XANC8      PVLLRQLVARCIAL--------------GARQARAGEFSERAFLNGKLDLAQAEAIADLI
MNME_XANCB      PVLLRQLVARCIAL--------------GARQARAGEFSERAFLNGKLDLAQAEAIADLI
MNME_XYLFA      PLLLRQLLTRCLDL--------------GARQAHPGEFSERAFLNGKLDLIQAEAIADMI
MNME_XYLFT      PLLLRQLLTRCLDL--------------GARQARPGEFSERAFLNGKLDLIQAEAIADMI
MNME_BLOFL      QMILDLLLDRILNISSR------------IRLANPGEFTERAFLNEKIDLIQAESIADII
MNME_BLOPB      QIILDILLERILKTSSD------------IRIAHPGEFTKRAFLNNKIDLVQAEAIADII
MNME_BAUCH      PVVLDLLLQRIITLPG-------------VRIARPGEFSERAFLNEKIDLAQAEAIADLI
MNME_WIGBR      PVALNFLLQEILSIKG-------------MRLAKPGEFLERAFINGKIDLIQAEAISDLI
MNME_BUCCC      PIILDLLIKNILTIKN-------------VRIANPGEFSKRAFLNNKIDLVQAEAINDII
MNME_BUCAI      PLIMDLLIRRILSINNI-------------RMAKPGEFSERAFLNGKMDLIQAESIDDLI
MNME_BUCMP      PLIMDLLIKRITSIENV-------------RMAKPGEFSERAFLNGKIDLIQAEAIDDLI
MNME_BUCAP      PFIMDLLIKRILCLKNIK-----------IRIAQPGEFCQRAFLNGKIDLIQAEAIDDLI
MNME_BUCBP      PIIIDLLITTILSIPGI-------------RLANPGEFSERAFLNGKIDLAQAESISDLI
MNME_CAUVC      RAVVEALLAALSEL--------------GARLAEAGEFTRRAFENGKLDLAQAEGVADLI
MNME_CAUSK      RAVVEAVLEALAAE--------------GLRLAEPGEFTRRAFENGKLDLTQAEGVADLI
MNME_MARMM      PAVIDAVLSALDEA--------------GAHPAEAGEFTRRAFENEKIDLTEAEGLADLI
MNME_RHORT      RAVLAAVLGALGDLP-------------GLRPAEAGEFSRRAFLNGRLDLTAAEALADLV
MNME_MAGSA      RAVAAALTARLGEL--------------GLRPAEPGEFSRRAFLNGKLDLTRAEAIADLV
MNME_PARL1      RAVIAAMLRALGQLP-------------GLRAAQPGEFTRRAFENGKLDLTEVEGLADLI
MNME_NITWN      RAVVNALIAALSSID-------------DARAAEPGEFTRRAFENGKIDLTEAEGLDDLI
MNME_NITHX      RAVLNALFAALSSID-------------HVRPAEPGEFTRRAFENGKIDLTEAEGLDDLI
MNME_BRASO      RAVIATLFGVLSETP-------------ELRPAEPGEFTRRAFENGKLDLTEAEGLDDLI
MNME_BRASB      RAVITTLVSLLSAMP-------------QMRAADRGEFTRRAFENGKIDLTEAEGLDDLI
MNME_BRADU      RAVLAALLAAISVIP-------------NMRAAEPGEFTRRAFENGKLDLTEAEGLDDLI
MNME_RHOP5      RAVLAALMATLSSFE-------------NVRAAEPGEFTRRAFEHGKIDLTEAEGLDDLI
MNME_RHOPS      RAVLAALVRALSAFD-------------GVRPAEPGEFTRRAFENGKLDLTEAEGLDDLI
MNME_RHOP2      RAVLAALVKALASFD-------------DVRPAEPGEFTRRAFENGKLDLTEAEGLDDLI
MNME_RHOPA      RAVAAALIKTLSAFE-------------GVRPAEPGEFTRRGFENGKLDLTEAEGLDDLI
MNME_RHOPB      RAVLSAVIAAIGTNE-------------NLRAAEPGEFTRRAFENGKLDLTEAEGLDDLI
MNME_METPB      LAVRAAVLRALGRVP-------------GCRPAEAGAFSRRAFLNGRIDLTEAEGIADLI
MNME_METRJ      AAVRMRVLATLARLP-------------GCRAAEPGAFTRRAVLNGRMDLAEAEAVADLI
MNME_METS4      AAVRAAVLRVLGRLP-------------GLAPAEPGAFTRRAFLNGRMDLTAVEGLADLI
MNME_AZOC5      PAVVTAVLRTLVKLP-------------GFRPAAAGEFTRRAHANGKMDLAEVEGLADLI
MNME_BEII9      RAVMAGLLAALGRFE-------------QVRPAEPGEFTRRALLNGKLDLAEVEGLADMI
MNME_RHIEC      KAVLAALFFELGDIP-------------GVRMANEGEFSRRAFENGKLDLVEVEGLADLI
MNME_RHIL3      RAVLAALFHALGDIP-------------GVRMAVEGEFSRRAFENGKLDLVEVEGLADLI
MNME_SINMW      RAVVSAILDELAAMD-------------GLRHAEAGEFARRAFQNGKLDLVEVEGLADLI
MNME_RHIME      RAVVSAILDELAATG-------------GLRHAEAGEFARRAFQNGKLDLVEVEGLADLI
MNME_AGRFC      RAVMASIFAELDNLG-------------GLRPADAGEFSRRAFENGKMDLLEVEGLADLL
MNME_BRUC2      KAVVEKMLAVLGELP-------------GCRIAEAGEFTRRAFANGKMDLTIAEGLADLI
MNME_BRUSU      KAVVEKMLAVLGELP-------------GCRIAEAGEFTRRAFANGKMDLTIAEGLADLI
MNME_BRUA2      KAVVEKMLAVLGELP-------------GCRIAEAGEFTRRAFANGKMDLTIAEGLADLI
MNME_BRUAB      KAVVEKMLAVLGELP-------------GCRIAEAGEFTRRAFANGKMDLTIAEGLADLI
MNME_BRUME      KAVVEKMLAVLGELP-------------GCRIAEAGEFTRRAFANGKMDLTIAEGLADLI
MNME_BRUO2      KAVVEKMLAVLGELP-------------GCRIAEAGEFTRRAFANGKMDLTIAEGLADLI
MNME_BRUSI      KAVVEKMLAVLGELP-------------GCRIAEAGEFTRRAFANGKMDLTIAEGLADLI
MNME_OCHA4      KAVVEKLLSEMGELH-------------GCRIAEAGEFTRRAFSNGKMDLTIAEGLADLI
MNME_BARHE      KAVVNRFLDELSTFK-------------GCRIAEPGEFSRRAFMEGKLDLVQAEGLADLI
MNME_BART1      KAVVNRFLDELSTFS-------------GCRIAEAGEFSRRAFMEGKLDLVQAEGLADLI
MNME_BARQU      KAVVNRFLDELSTFD-------------GCRSAEAGEFSRRAFMEGKLDLIQAESLADLI
MNME_BARBK      KAVVNRFLDELSTFT-------------GCRLAEAGEFSRRAFIEGKIDLVQAEGLADLI
MNME_CHESB      RAVVAAVLNELAAFP-------------GLRMAEAGEFTKRAFLNGKMNLTEAEALSDLI
MNME_RHILO      RAVVARMLEIISGFD-------------GVRHAEPGEFTRRAFLNGKVDLVETEALADLV
MNME_HYPNA      PAVIDHALRGLTAIA-------------GVRLAEPGEFTRRAFENGKLDLTEAEGVADII
MNME_GRABC      NAVIEGMADALVDL--------------GLRPAEAGEFTRRAFLNGKLDLTEAEAVADLI
MNME_ACICJ      RAVRAAITAALLDL--------------GARPAEPGEFSRRAFLNSRLDLLEAEGIADLI
MNME_GLUOX      PAIIARIADALTDL--------------GARPAEPGEFTRRAVQKGRLDLLQAEAIADLV
MNME_ERYLH      RAVIAAIERTLGTMP-------------GLRRAEPGEFTRRAFANGRIDLAEAEGLADLL
MNME_NOVAD      RAVIAAVEAALSSLP-------------GLRRARPGEFTRRAFANGRIDLAEAEGLADLL
MNME_SPHWW      RAVTAAVLAALGRLP-------------GLRPATAGEFTRRAFETGRIDLNEAEALADLL
MNME_SPHAL      RAVVAAVEAALAAMP-------------GLRRAEAGEFTRRAFANGRIDLAEAEGLADLL
MNME_ZYMMO      RAVIDAVLKTLEKLP-------------DLRPAEAGEFTRRAFENGVISLHEAEGLGDLL
MNME_RUEST      IAVVSAVMSAIEETG-------------VARLADPGEFTRRALDNGKLDLTQVEGLADLI
MNME_RUEPO      LATTEAVLRCLGDLD-------------GLRLAEPGEFTRRALENGKMSLPQVEGLADLI
MNME_ROSDO      IAVVRTVLDALSDQD-------------VARLAEAGEFTRRALENGKLDLSQVEGLADLI
MNME_RHOS4      PAAVSSVLRVLSGLP-------------GLRAAEAGEFTRRALENGRLDLAQVEGLADLI
MNME_RHOS1      PAAVSSVLRVLSGLP-------------GLRAAEAGEFTRRALENGRLDLAQVEGLADLI
MNME_RHOS5      AAAVSSVLQALSELP-------------GLRLADAGEFTRRALDNGRLDLAQVEGLADLL
MNME_DINSH      PAIIAALMNELSALP-------------GLRLAQPGEFTRRALENNRMDLAQVEGLADLI
MNME_JANSC      VAVVRAVEGAIRSTG-------------LARLADAGEFTQRALLNDMLDLTQVEGLGRLI
MNME_PARDP      PVIASRLSQALLAR--------------GLRRAEAGEFTKRAFLNGRIDLAEAEGLADLL
MNME_RICAH      KAISIMMINTLLNIS-------------DIRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICFE      KAISIMLINALLNIA-------------DIRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICRO      KAISIMLTNALLNIA-------------GIRLAEAGEFTKRAFLNNKLDLTAAEGIADLI
MNME_RICRS      KAISIMLTNALLNIA-------------GIRLAEAGEFTKRAFLNNKLDLTAAEGIADLI
MNME_RICCN      KAISIMLTNALLNIA-------------GIRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICM5      KAISIILTNALLNIA-------------GIRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICCK      KAISIMLINALLNIP-------------NIRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICPR      KAISIMLINTLLNIA-------------DIRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICTY      KAISIMLINTLLNID-------------DIRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICB8      KAISIMLTNALLNIP-------------GVRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_RICBR      KAISIMLTNALLNIP-------------GVRLAEAGEFTKRAFLNNKFDLTAAEGIADLI
MNME_ORITB      VAVAKMLTRSILECD-------------GIRLAEPGEFAKRAFLNGKMDLTMAEGLVDLI
MNME_ANAMM      LAVIRLLFEELQTV---------------FRIAEPGEFSLRAFLNGKIDLTRAEGIADLV
MNME_ANAPZ      RAVIRLLYEELQTF---------------IRIAEPGEFSLRAYLNGKIDLTRAEGIADLI
MNME_EHRCJ      LAVIKMILAELGKI---------------FVPAGPGEFSLRAFLNNKVDLTRAEAIVDLI
MNME_EHRCR      FAVIKMILAELGKI---------------FVPAGPGEFSLRAFLNNKVDLTRAEAIVDLI
MNME_EHRRW      IAVIRMILCELGKI---------------FIPAGPGEFSLRAFLNNKVDLTRAEAIVDLI
MNME_EHRRG      IAVIRMILCELGKI---------------FIPAGPGEFSLRAFLNNKVDLTRAEAIVDLI
MNME_WOLTR      KAVIKIVLEELSRI---------------FVMAKPGEFLLRAFLNGKFDLTQIEGIADLI
MNME_WOLPM      KAVIKIILEELSKV---------------FVMAKPGEFSLRAFLNGKFDLTQIEGIADLI
MNME_NEOSM      IAVLRYISEKLSTL---------------FKPAEPGEFTRRAVLNNRMDLTKAEGIIDII
MNME_PELUB      KAVIDALHHSISKIK-------------NCRLADPGEFTKLAFQNGKINLLKAESIADLI
MNME_DEIRA      PAVLSRVL-ARTLDL-------------GARLARPGEFTLRAYLAGRLDLTQAEAVLGLV
MNME_DEIGD      PAVLARVL-SRVLEL-------------GARPARPGEFTLRAYLAGRLDLAQAEAVLELV
MNME_THET8      PAVLRRVM-EVLVAE-------------GARPAGRGEFTFRAYLNGKMDLAQAEAVLALI
MNME_THET2      LAVLRRVM-EVLVAE-------------GARPAGRGEFTFRAYMNGKLDLAQAEAVLALI
MNME_HALHL      PAAVTAVL-EALCAA-------------GARPAGPGEFSERAFLNGRLDLTQAEAVASLI
MNME_MYXXD      PRLLRLLLTRALEDA-------------RVRHAAPGEFTRRAFLNGRLDLTRAEAVADLV
MNME_RHOBA      APLLQSSL-DAAIRA-------------GARAARPGEFTMRSFLAGRLDLTQAEAVLGVI
MNME_AQUAE      PRILKRALELFVNAG--------------ARLAEPGEFTKRAFLNGKLDLTQAEAVAELI
MNME_MAGMM      PVVVKRIMEVLVAHG--------------VRPADPGEFSKRAFFNNKMDLVQAEALMGLI
MNME_KORVE      PVLLARVVELALAKG--------------VRMADPGEFTMRAFLNGRIDLTQAEAVRDLI
MNME_SOLUE      PVVLRHAVERALEAG--------------ARLARPGEFTLRAFLNGRIDLPRAEAVRDLI
MNME_CHLTR      YFACSQIVNALLAE--------------GARAALPGEFSQRAFLNGKIDLIQAEAIQQLI
MNME_CHLTB      YFACSQIVNALLAE--------------GARAALPGEFSQRAFLNGKIDLIQAEAIQQLI
MNME_CHLT2      YFACSQIVNALLAE--------------GARAALPGEFSQRAFLNGKIDLIQAEAIQQLI
MNME_CHLTA      YFACSQIVNTLLAE--------------GARAALPGEFSQRAFLNGKIDLIQAEAIQQLI
MNME_CHLMU      YFACSQILNALLAE--------------GARAALPGEFSQRAFLNGKIDLIQAEAIQQLI
MNME_CHLCV      YFSCSQILEALVSE--------------GARPALPGEFSQRAFLNGKIDLIQAEAIQNII
MNME_CHLFF      YFSCSQILEALVSE--------------GARPALPGEFSQRAFLNGKIDLIQAEAIQNLI
MNME_CHLAB      YFSCSQILAALIAE--------------GARPALPGEFSQRAFLNGKIDLIQAEAIQNII
MNME_CHLPN      FFACSQILDALIAL--------------GARPALPGEFSQRAFLNGKIDLVQAEAIQNLI
MNME_PARUW      SLITRKVLEVVLAA--------------GARAALPGEFTFKAYMNGKIDLAQAEAVQELI
MNME_OPITP      PFIAQRVLQDLFAR--------------GCRPAGPGEFTQRAFLNGRLDLSQAEAVMDLI
MNME_BDEBA      PLICQTILNQLVNL--------------GARPADRGEFTFRAFMNGKLDLVQAESVLSLI
MNME_DESHY      LYIAERIMRECIGL--------------GARLAEAGEFTKRAFLNGKLDLIQAEAIVDLI
MNME_ALKMQ      MIPVKRILELILRK--------------GARAADAGEFTKRAFLNGRIDLAQAEAVMDLV
MNME_ALKOO      MIPVKNILELVLRV--------------GARMAEPGEFTKRAFLNGRIDLAQAEAIMDLI
MNME_CLOD6      FISVKKILELILSK--------------DVRLAEAGEFTKRAFLNGRIDLSQAEAVIDVI
MNME_FINM2      VVAVRKVLEVLLNN--------------GARLAEAGEFTKRAFLNGRIDLSQAEAIIDMI
MNME_FUSNN      YLVTEKVLEVVLKN--------------GARIAEIGEFTKRAFLNGRIDLTQAEAVIDVI
MNME_CLOB1      VIPTKKILKELIKS--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_CLOBK      VIPTKKILKELIKS--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_CLOBH      VIPTKKILKELIKS--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_CLOBL      VIPTKKILKELIKS--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_CLOBM      VIPTKKILKELIKS--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_CLOK5      VLATRKVMEEVIKA--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_CLOTE      VTPTKKIFQEVIKA--------------GVRVAEPGEFTKRAFLNGRIDLTQAEAVIDII
MNME_CLONN      VVVTKRILEEVVAA--------------GARLASPGEFTKRAFLNGRIDLSQAEAVIDLI
MNME_CLOAB      MYPTKRVLEEIIRA--------------GARLAEPGEFTKRAFLNGRLDLSQAEAVMDII
MNME_CLOPE      IVATNKVLQNVIKA--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDII
MNME_CLOP1      IVATNKVLQNVIKA--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDII
MNME_CLOPS      IVATNKVLQNVIKA--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDII
MNME_CLOB8      VISTNSVLDQVIKA--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVMDII
MNME_LACP7      ITVTKKVLEAVLKA--------------GARIAEPGEFTKRAFLNGRIDLSQAEAVIDVI
MNME_THEP3      IVVTSKILELVLKQ--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_THEPX      IVVTSKILELVLKQ--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_CALS4      IVVSSKILELVLKH--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_HUNT2      MVVLKNILELCIKE--------------GARLAEPGEFTKRAFLNGRIDLSQAEAVIDLI
MNME_CARHZ      IVAVEKVLELILKQ--------------GIRLAEPGEFTKRAFLNGRIDLSQAEAVIDII
MNME_DESRM      IIPLRKVLEVILRN--------------GARHAEPGEFSKRSFLNGRLDLAQAESIIDII
MNME_PELTS      IVPLRKVLELALAN--------------GARLAEPGEFSKRAFLNGRLDLAQAESVIDII
MNME_CALS8      MVVLRRILEVVIKN--------------GARHAMPGEFTKRAFLNGRLDLSQAEAIIDII
MNME_SYNWW      TLPARRCLEAVMWQ--------------GVRLAQPGEFTRRAFLNGRLDVSQAEAVIEVI
MNME_NATTJ      MVPVKEILQLLFSY--------------GIRPAEPGEFTKRAFLNGRLDLTQAEGVMDLI
MNME_DESPS      FLVLQNVLELVIEK--------------GASLAEPGEFTKRAFFNGRIDLTKAEAVIDVL
MNME_MOOTA      ALATSRVLQLVLRT--------------GARLAEPGEFTRRAFLNGRLDLAQAEAVLEII
MNME_DESAP      VLPLQRILKIVLDC--------------GARLAGPGEFTRRAFLNGRLDLVQAEAVLDVI
MNME_ROSS1      PLVVERVLQQALAA--------------GARAAAPGEFTMRAFLNGRIDLAQAEATLDII
MNME_ROSCS      PLVVERVLQQALAA--------------GARAANPGEFTMRAFLNGRIDLTQAEATLDII
MNME_CHLAA      ALPVQLTLEAALAA--------------GARLANPGEFTLRAFLNGRIDLSQAEATLDVI
MNME_SYMTH      QLAVRRVLEQALQA--------------GARLAEPGEFTRRAFLNGRLDLSQAEAVVDLI
MNME_HELMI      SVPVRETLGAVLRA--------------GARLAEPGEFTRRAFLGGRLDLAQAEAIIEVI
MNME_GEOSL      YLVTRRVLELVLAA--------------GARLAEPGEFTRRAFLNGRIDLVQAEAVIDVI
MNME_GEOMG      YLVTRRVLDAVLQC--------------GARPAEPGEFTRRAFLNGRIDLVQAEAVIDVI
MNME_GEOUR      YLVVQRILDLVLQQ--------------GTRLAGPGEFTKRAFLNGRIDLVQAEAIIDVI
MNME_PELPD      MLVVERILSLVLRA--------------GARLAEPGEFTRRAFLNGRIDLVQAESVMDII
MNME_PELCD      GLLVRSIIDVFLAA--------------GARLARPGEFTLRAFLNGRIDLTQAEAVIDLI
MNME_SYNAS      ILVLESVLLAVLRS--------------GARLADPGEFTRRAFLNDRIDLTQAEAVGDVI
MNME_SYNFM      FAVLNRILELVLRE--------------GARLADPGEFTRRAFLNGRIDLSQAEAVIEVI
MNME_DESVH      SGVLAAVLEACVRH--------------GARYAERGEFTRRAFLNGRMDLTQAEAVAEMI
MNME_DESVV      SGVLAAVLEACVRH--------------GARYAERGEFTRRAFLNGRMDLTQAEAVAEMI
MNME_DESAG      PAILAAVLDAVLRQ--------------GARPAAHGEFTRRAFLNGRMDLTQAEAVAEMI
MNME_LAWIP      HFLLLTILETVLCK--------------NIRLAKPGEFSQRAFLNGRMDLTQAEAVAELI
MNME_NOSS1      IIAVQQVLQLCLES--------------GARLAQPGEFTLRAFLNGRLDLTQAESIADLV
MNME_TRIV2      IMAVQQVLQLCLEG--------------GARLAQPGEFTLRAFLNGRLDLTQAESIADLV
MNME_TRIEI      IIAIQQVLQLCIEA--------------GAELAQPGEFTLRAFLNGRLDLTQAESIAELV
MNME_ACAM1      MIAVQQVLEACLQA--------------GAELAQPGEFTLRAFLNGRLDLTQAEGVADLV
MNME_SYNY3      IMPVQQVLQLCLQQ--------------GARLAQPGEFSFRAFLNGRLDLTQAESISELV
MNME_MICAN      IMPVQQVLQLCLEN--------------GARLAQAGEFSLRAFLNGRIDLTQAESVVDLV
MNME_SYNP2      IIPVQQVLQLCLGA--------------GARLATPGEFTLRAFLNGRIDLTQAESVAELV
MNME_SYNE7      LMPVQQTLQLCIRA--------------GARLAEPGEFTLRAFLNGRLDLSQAESIADLI
MNME_SYNP6      LMPVQQTLQLCIRA--------------GARLAEPGEFTLRAFLNGRLDLSQAESIADLI
MNME_THEEB      LIPVQRVLQLCVAA--------------GARLADPGEFTLRAFLNGRLDLTQAESVAELV
MNME_SYNJA      IMVVQATLQQCLRQ--------------GARLAQPGEFSLRAFLNGRIDLTQAESVADLV
MNME_SYNJB      IMVVQATLQQCLRQ--------------GARLAQPGEFSLRAFLNGRIDLTQAESVADLV
MNME_GLOVI      IAVIQQILRRCVEL--------------GARLARPGEFTLRAFLNGRIDLTEAEAVAELV
MNME_PROM1      IIPVQKILERILAF-------------PSVRRAEPGEFSQRAVLNGRLSLTQAESISELV
MNME_PROMT      IIPVQKILERILAF-------------PSVRRAEPGEFSQRAVLNGRLSLTQAESISELV
MNME_PROMA      LIVVQQVLDAILKQ-------------PKTRRAFPGEFSQRAVLNGRLDITQAEAINDLI
MNME_PROM3      LMAVQRVLERVLAQ-------------PHVRRALPGEFSQRAVLNGRLDLTQAEAISELV
MNME_PROMM      LMAVQRVLERVLAQ-------------PHVRRALPGEFSQRAVLNGRLDLTQAEAISELV
MNME_SYNSC      VIAVQRVLEKVLRQ-------------PGVRRAQPGEFSQRAVLNGRLDLTRAEAVSELV
MNME_SYNPX      VVAVQQVLERVLAH-------------PGVRRALPGEFSQRAVLNGRLDLTRAEAVSELV
MNME_SYNS9      VMAVQQVLERVLEH-------------PGVRRALPGEFSQRAVLNGRLDLTQAEAVSELV
MNME_SYNPW      VIAVQRVLARVLDQ-------------PGVRRALPGEFSQRAVLNGRLDLTRAEAISDLV
MNME_SYNS3      VIAVQQVLARVLEQ-------------PGVRRALPGEFSQRAVLNGRLDLTRAEAIGDLV
MNME_SYNR3      LVAVQRLLELVLA--------------AGARRALPGEFSQRAFLNGRLDLTRAEAISELV
MNME_PROMS      IIIVNKVLKILLSNN------------SRVRLANPGEFSQRAFLNGKIDLTQAESINQLI
MNME_PROM0      IIIVNKVLKILLSSN------------SRVRIANPGEFSQRAFLNGKIDLTQAESINQLI
MNME_PROM2      IIIVNKVLKILLSSN------------SRVRLANPGEFSQRAFLNGKIDLTQAESINQLI
MNME_PROM9      IILVNKVLQRLLSSN------------SRVRLANPGEFSQRAFLNGKIDLTQAESINQLI
MNME_PROM5      VIVVNKVMDTLLSNN------------NKVRIANPGEFSQRAFLNGKIDLTQAESINQLI
MNME_PROMP      VIVVNKVIETLLSNN------------TGVRIANPGEFSQRAFLNGKIDLTQAESINQLI
MNME_CYACA      IVLANEILRILVKQ--------------GVRLAKPGEFTMRAFLNGRIGLSQVESVLKVI
MNME_CYAM1      VVVAQTILQLLINR--------------GARLAKPGEFTLRAFINGRLTLTQAESVLELI
MNME_BACFR      SYILQQVMQLLIKNG--------------CRMAQPGEYTQRAFLNGKMDLSQAEAVADLI
MNME_BACFN      SYILQQVMQLLIKNG--------------CRMAQPGEYTQRAFLNGKMDLSQAEAVADLI
MNME_BACTN      SYILQQVMQLLIKNG--------------CRMAQPGEYTQRAFLNGKMDLSQAEAVADLI
MNME_BACV8      SYILQQVIQLLIYNG--------------CRAALPGEYTQRAFLNGKMDLSQAEAVADLI
MNME_PARD8      TYIQQQILQSLISSG--------------CRIAQPGEYTQRAFMNGKMDLSQAEAVADLI
MNME_PORGI      IYIRRRILEALINQG--------------CRLAQPGEFTRRAYLNGRMDLSSAEAVADII
MNME_FLAJ1      TYIQQQIIQLLLRKG--------------CRMADAGEFTLRAFLNGKLDLSQAEAVADLI
MNME_FLAPJ      TYIQQQIIQLLLRKG--------------CRMAQAGEFTLRSFLNGKMDLSQAEAVADLI
MNME_GRAFK      PYIQQEIIQLLIRKS--------------CRSAEAGEFTLRAFLNAKMDLSQAEAVADLI
MNME_CYTH3      TFIVKELLQLLLRKG--------------ARHAKPGEFTMRAFLNGRFDLAQAEAVADLI
MNME_SALRD      DLAPKMALQSLLDHG--------------ARMAEPGEFTERAFLNGKMDLAQAEAVADLI
MNME_CHLTE      PVVVGRVLRLMLDNG--------------CRLAEPGEFTRRAFLNGRIDLLQAEAIGEMI
MNME_CHLPD      PVVTRHVLQLLLDNG--------------CRLAEPGEFTRRAFLNGKIDLLQAEAIGEMI
MNME_CHLPM      PVVVRHLLQALLDSG--------------CRLAEPGEFTRRAFLSGRIDLLQAEAIGEMI
MNME_PELLD      PVVVRRVLAALLDGG--------------CRLAEPGEFTRRAFLNGRIDLLQAEAIGEMI
MNME_CHLCH      PVVVQHLLKALIDAG--------------CRLAEPGEFTRRAFLNGRIDLLQAEAIGEMI
MNME_BORAP      VIGIKKIIDLFLKSG--------------FRMAEPGEFTFRSFLAKKIDLTKAEAINEII
MNME_BORBU      VIGIKKIIDLFLKSG--------------FRMAEPGEFTLRAFLAKKIDLTKAEAIHEII
MNME_BORBP      VIGIKKIIDLFLKSG--------------FRMAEPGEFTLRSFLAKKIALTKAEALHEII
MNME_TREPA      VRTVQAVYRLCLAQG--------------FRAAQRGEFSFRSFFHGKRDLTRIEAIQSLV
MNME_TREDE      TAVVLKIYRLLIENG--------------FRAAEGGEFTFRAFANGKADLTRAEAVNEII
MNME_LEPBJ      PILLREALDAIFRAG--------------ARPAKQGEFSRRAFLNGKLDLTGVEAIGRLI
MNME_LEPBL      PILLREALDAIFRAG--------------ARPAKQGEFSRRAFLNGKLDLTGVEAIGRLI
MNME_LEPIN      PILLREALDAIFRAG--------------ARPAKQGEFSRRAFLNEKLDLTEVEAIGRLI
MNME_LEPIC      PILLREALDAIFRAG--------------ARPAKQGEFSRRAFLNEKLDLTEVEAIGRLI
MNME_LEPBA      PLLLKRALHVLFEKG--------------ARPAQKGEFTKRAYMNGKINLSGAEAISRLI
MNME_LEPBP      PLLLKRALHVLFEKG--------------ARPAQKGEFTKRAYMNGKINLSGAEAISRLI
MNME_UNCTG      PVIINEILNLLYKN--------------GARPAGPGEFTYRAFLNDKMNLAEAEAVCALI
MNME_SULMW      IYIQNKLLSIIIDQG--------------ARLANPGEFTLRAFLNGKIDLCQAESILDIV
MNME_CARRP      ETIVKKIINYLLLNK--------------ARFAKAGEFLERRYLNGKISLIECELINNKI
                                                *  * :                     :

MNME_THEMA      EAKSETS-LKLSLRNLKGGLRDFVDSLRRELIEVLAEIRVELDYPDEIE-----------
MNME_THESQ      EAKSETS-LKLSLRNLKGGLRDFVDSLRRELIEVLAEIRVELDYPDEIE-----------
MNME_THEP1      EAKSETS-LKLSLRNLKGGLKDFVESLRRELIEVLAEIRVELDYPDEIE-----------
MNME_FERNB      EAKSEKS-LKLALDNLKGKLSNEIEYLRSSLINVLSKIEVSIDYGDDID-----------
MNME_THEM4      EAKSEVS-LKMSLQNLKGKLGEEIEYYRGEILNVLSEIEVTFDYPDDIE-----------
MNME_PSELT      EASSRKT-VKLVAANLAGRLSEIVHKLRETLLGTLAKIEVEFDYPDEIL-----------
MNME_PETMO      TSETEIS-LKASFNQLKNAVSEKIKDIKNSLLNISAQIEVEMDYPDDIE-----------
MNME_AYWBP      HATNENA-IKIANSGLQKYTSQLVTSLRDQILNLIAQIEVNIDYPEYDD--------IPQ
MNME_ONYPE      HATNENA-IKIAHSGLQKYTSQLVTSLRDQILNLIAQIEVNIDYPEYDD--------IPQ
MNME_ACHLI      HATNENA-IKVANKALNKATSSMIDNLKSKVLTLIAQIEVNIDYPEYDD--------AII
MNME_BACAN      RAKTDRA-MNVAINQMEGRLSKLIGRLRQDILETLAHVEVNIDYPEYDD--------VEE
MNME_BACHK      RAKTDRA-MNVAINQMEGRLSKLIGRLRQDILETLAHVEVNIDYPEYDD--------VEE
MNME_BACCZ      RAKTDRA-MNVAINQMEGRLSKLIGRLRQDILETLAHVEVNIDYPEYDD--------VEE
MNME_BACAH      RAKTDRA-MNVAINQMEGRLSKLIGRLRQDILETLAHVEVNIDYPEYDD--------VEE
MNME_BACC1      RAKTDRA-MNVAINQMEGRLSKLIGRLRQDILETLAHVEVNIDYPEYDD--------VEE
MNME_BACCR      RAKTDRA-MNVAINQMEGRLSKLIGLLRQEILETLAHVEVNIDYPEYDD--------VEE
MNME_BACMK      RAKTDRA-MNVAINQMEGRLSKLIGHLRQEILETLAHIEVNIDYPEYDD--------VEE
MNME_BACCN      RAKTDRA-MNVAINQMEGRLSKLIGRLRQEILETLAHVEVNIDYPEYDD--------VEE
MNME_BACSU      RAKTDRA-MNVAMNQMEGRLSALVRRLRSEILETLAHVEVNIDYPEYDD--------VEE
MNME_BACVZ      RAKTDRA-MNVAMNQMEGRLSALVRRLRDELLETLAHVEVNIDYPEYDD--------VEE
MNME_BACP2      RAKTDRA-MNVAITQMEGRLSGLVQRLRGEILETLAHIEVNIDYPEYDD--------VEE
MNME_BACLD      RAKTDRA-MNVAMNQMEGRLSSLIKRLRAEILETLAHVEVNIDYPEYDD--------VEE
MNME_GEOKA      RAKTDRA-MNVALQQMEGRLSKLIRELRQTILETLAHVEVNIDYPEYDD--------VEE
MNME_GEOTN      RAKTDRA-MNVALQQMEGRLSKLIRELRQTILETLAHVEVNIDYPEYDD--------VEE
MNME_LYSSC      RAKTDRA-MNVALGQMDGKLSRLIGDLRQALLETLAQVEVNIDYPEYDD--------VEE
MNME_OCEIH      RAKTDKA-MSVALKQMDGRLSKLIQKLRQELLETVAHVEVNIDYPEYDD--------VEE
MNME_BACSK      RSKTDRA-MNVALRQVEGRLSKKIGKLRQALLETIASIEVNIDYPEYD---------AET
MNME_BACHD      RAKTDRA-MNVALKQVEGRLSTKISSLRQALLETVAHVEVNIDYPEYD---------AET
MNME_EXIS2      RAKTDRA-MTVAVGQIEGRLSKLVQDLREQLLQTIASIEVNIDYPEYD---------AEE
MNME_STAAC      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAE      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAT      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAA3      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAA2      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAA9      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAR      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAW      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAN      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAA8      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAA1      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAM      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAS      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAAB      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAES      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAEQ      RSKTDRA-SKVAMNQIEGRLSDLIKKQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAHJ      RSKTDRA-SKVAMNQIEGRLSDLIKRQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_STAS1      RSKTDRA-SKVAMNQIEGRLSDMIKRQRQSILEILAQVEVNIDYPEYDD--------VED
MNME_LISMO      RAKTDRA-MGVAIRQMDGNLSRLIRNLRQEILDALAQVEVNIDYPEYDD--------VEE
MNME_LISMF      RAKTDRA-MGVAIRQMDGNLSRLIRNLRQEILDALAQVEVNIDYPEYDD--------VEE
MNME_LISIN      RAKTDRA-MGVAIRQMDGNLSRLIRNLRQEILDALAQVEVNIDYPEYDD--------VEE
MNME_LISW6      RAKTDRA-MGVAIRQMDGNLSRLIRNLRQEILDALAQVEVNIDYPEYDD--------VEE
MNME_ENTFA      RAKTDKA-MNVALNQLDGNLSTLIRSLRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_LACP3      RAKTDRA-MQVAVNQLDGNLHTLIKRLRQEILEVLAQVEVNIDYPEYD---------TDE
MNME_LACSS      RAKTDRA-MQVAVDQLDGSLTHLIKNLRQEILEVLAQVEVNIDYPEYD---------TDE
MNME_LACS1      RAKTDRS-MKVALNQLDGNLSHLIRNLRQDILDVLAQVEVNIDYPEYDD--------VET
MNME_LACPL      RAKTDKS-MKVALNQLDGDLSKLIRHLRQDILDVLAQVEVNIDYPEYDA--------VET
MNME_LACBA      RAKTDKS-MKVALDQLDGDLSKLIRNLRQDILDALAQVEVNIDYPEYDD--------VET
MNME_PEDPA      RAKTDQS-MKVALDQLDGNLSHLITNLRQNILDVLAQVEVNIDYPEYDD--------VET
MNME_LACLM      RAKTDKA-ANIAVKQLDGSLSKMINNIRQEILESLAQVEVNIDYPEYDD--------VET
MNME_LACLS      RAKTDKA-ANIAVKQLDGSLSKMINNIRQDILESLAQVEVNIDYPEYDD--------VET
MNME_LACLA      RAKTDKA-ANIAVKQLDGSLSKMINNIRQEILESLAQVEVNIDYPEYDD--------VET
MNME_STRA1      RAKTDKA-MDIAVKQLDGSLKTLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRA5      RAKTDKA-MDIAVKQLDGSLKTLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRA3      RAKTDKA-MDIAVKQLDGSLKTLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRAG      RAKTIKQWIYVSLKQLDGSLKTLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRTD      RAKTDKA-MTVAVSQLDGSLKNLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRT1      RAKTDKA-MTVAVSQLDGSLKNLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRT2      RAKTDKA-MTVAVSQLDGSLKNLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRMU      RAKTDKA-MAVAVQQLDGSLSNLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRP8      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRPD      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRP6      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRP3      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRPG      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRP1      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRPC      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRPM      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRPF      RAKTDKA-MTIAVKQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRGC      RAKTDKA-MNNAVKQLDGSLSNLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRSV      RAKTDKA-MNNAVKQLDGSLSNLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRR6      RAKTDKA-MNIAVKQLDGSLSDLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRP2      RAKTDKA-MNIAVKQLDGSLSDLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRPI      RAKTDKA-MNIAVKQLDGSLSDLINNIRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRPN      RAKTDKA-MNIAVKQLDGSLSDLINNTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRSY      RAKTDKA-MHNAVRQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_STRS2      RAKTDKA-MHNAVRQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDD--------VEE
MNME_LACGA      RAKTDKS-RQVAMTQLAGGLLDKIKTMRQELLDTMAHEEVNIDYPEYD---------MDD
MNME_LACJO      RAKTDKS-RQVAMTQLAGGLLDKIRTMRQELLDTMAHEEVNIDYPEYD---------MDD
MNME_LACAC      RAKTDKA-RQVAVSQLEGGLLHKIRTMRQEILDTLANVEVNIDYPEYD---------ADT
MNME_LACH4      RAKTDKA-RQVAVGQLAGGLLHKIQAMRQEILDTLANVEVNIDYPEYD---------ADT
MNME_LACDB      RAKTDKA-RQVAVKQLSGGLLTEIRALRQEILDVLANVEVNIDYPEYD---------EEE
MNME_LACDA      RAKTDKA-RQVAVKQLSGGLLTEIRALRQEILDVLANVEVNIDYPEYD---------EEE
MNME_MYCGE      LSPNLLV-KDIVLNNLAGEMDQQLEQIAQQVNQLVMQMEVNIDYPEYLD---------EQ
MNME_MYCPN      LSPNTTL-KDVALNALAGQVDARLEPLVEKLGQLVMQMEVNLDYPEYTD---------EQ
MNME_MYCGA      FAKNNLS-HSASIKALSGEFSKDIKNIQQEIFRLIGLVEIAIDYPEYED---------EK
MNME_UREPA      NAKNELS-VKGVIGALLGRVSQSIAEFRHELFMIIGQIEVNIDYPEYDDV--------EQ
MNME_UREP2      NAKNELS-VKGVIGALLGRVSQSIAEFRHELFMIIGQIEVNIDYPEYDDV--------EQ
MNME_MYCPE      FSKTDIA-TNLSSNGIINSNNDFFLDIKEKIFYLIGKIEVNIDYPEYEDV--------EQ
MNME_MYCMS      HAKNELA-LKIGVANMSGSNNKAIIELKDNLLDIISRIQVSIDYPDYDDV--------EG
MNME_MYCCT      HAKNDLA-LKIGVANMSGSNNKAIIELKDNLLDIISRIQVSIDYPDYDDV--------EG
MNME_MESFL      FAKNELA-LKIGVNNMSGAHNQSIINLKGNLLDIISRIQVSIDYPDYDDV--------EG
MNME_MYCPU      HSKTVQQ-AKINIKKFDRKTSMFINDLINKLVFIIGTCEVNIDYPEYDD--------IEE
MNME_MYCMO      HAKTIRQ-AQISVNKFDGKISKDIESYIDTLLYLIATCETNIDYPEYDD--------VEN
MNME_MYCAP      HASTVSQ-TKLAIKKFDGKTSMYIQDLKDELAYLIGEMEVSIDYPEYD---------FDN
MNME_MYCS5      MSKTRLQ-ARNEASKLKGSASKVIKDLLKELSLLIGSIEVGIDYPEYIDDYEE--DLKAN
MNME_MYCHJ      HAEVKVQ-HQAALNQFLGKSSNFIKNLIEKIEEIIGIIEVNIDYPEYDD--------VEI
MNME_MYCH2      HAEVKVQ-HQAALNQFLGKSSNFIKNLIEKIEEIIGIIEVNIDYPEYDD--------VEI
MNME_MYCH7      HAEVKVQ-HQAALNQFLGKSSNFIKNLIEKIEEIIGIIEVNIDYPEYDD--------VEI
MNME_CAMJE      LSKSALA-AKIIARNMQGNLGELLEKIRTDLVKTLAFVETSIDYADDDL---------PS
MNME_CAMJJ      LSKSALA-AKIIARNMQGNLGELLEKIRTDLVKTLAFVETSIDYADDDL---------PS
MNME_CAMJR      LSKSALA-AKIIARNMQGNLGELLEKIRTDLVKTLAFVETSIDYADDDL---------PS
MNME_CAMJ8      LSKSALA-AKIIARNMQGNLGELLEKIRTDLVKTLAFVETSIDYADDDL---------PS
MNME_CAMJD      LSKSALA-AKIIARNMQGNLGELLEKIRTDLVKTLAFVETSIDYADDDL---------PS
MNME_CAMC5      NSRSEAA-AKILARQMRGDLSRYVEQMRNELVKTLAFVETSIDYADDDL---------PD
MNME_CAMC1      TSKSEIA-AKILTRQMQGDLSKFVGEIRGEVVKTLAFVETMIDYADDDL---------PA
MNME_CAMHC      LSRSKSA-AKILARNLHGELKNFVIDLRKEIVKTMAFVETCIDYADDDL---------PN
MNME_CAMFF      NARSEGA-AKILARTMNGELSVFVNSLRDELIKILAYTETCIDYADDDL---------PS
MNME_SULDN      EAKSEDA-AKILAQQMKGSLKEYVEKIRDDLIHILAYSEVSIDYAEEDL---------PE
MNME_ARCB4      EARSADA-VKLLARQLKGELTNFVDEIREDLLFMLAYTEVSIDYAEEDL---------PT
MNME_NITSB      EAKSEDA-AKILAKQIKGELKNYIENLREKLIRILAYVEVNIDYAEEDL---------PK
MNME_SULNB      EAKSVDA-AKILAKQMKGELKYFVDESRDALLRSLAYSEVMIDYAEEDI---------PD
MNME_HELHP      QSQSLEA-NKILMRQLKGDLGTFVNRTRENLLEILAFSEVHIDYSEEVE---------ES
MNME_WOLSU      EAKSDES-YKVLLKQLKGELGRYVEGVRGSLVEILAYAEVSIDYAEEDL---------PS
MNME_HELPY      LCEDESV-LNALARQLKGELKIFIEEARGNLLKLLASSEVLIDYSEEDI---------PS
MNME_HELPJ      LCEDESV-LNALARQLKGELKIFIEEARNNLLKLLASSEVLIDYSEEDI---------PS
MNME_HELPH      LCEDESV-LNALARQLKGELKIFIEEARSDLLKLLASSEVLIDYSEEDI---------PS
MNME_HELAH      LCEDESV-LNALARQLKGELKIFIEEARNNLLKLLASSEVLIDYSEEDI---------PS
MNME_ECOLI      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECOLC      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SHIBS      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECODH      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SHIFL      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SHIF8      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SHIDS      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECO57      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECOUT      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECOL5      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECOK1      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECOL6      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECOSM      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECO24      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ECOHS      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SHISS      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SALCH      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SALPB      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SALTY      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SALPA      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SALTI      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SALAR      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_CITK8      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_ENT38      DASSEQA-ARSALNSLQGAFSTRVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_KLEP7      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_CROS8      DASSEQA-ARSALNSLQGAFSARVNHLVEALTHLRIFVEAAIDFP-DEEIDFL-------
MNME_YERPA      DASSEQA-ARSAVNSLQGAFSARIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_YERPN      DASSEQA-ARSAVNSLQGAFSARIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_YERPP      DASSEQA-ARSAVNSLQGAFSARIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_YERPE      DASSEQA-ARSAVNSLQGAFSARIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_YERPS      DASSEQA-ARSAVNSLQGAFSARIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_YERP3      DASSEQA-ARSAVNSLQGAFSARIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_YERPY      DASSEQA-ARSAVNSLQGAFSARIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_YERE8      DASSEQA-ARSAVNSLQGAFSVRIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SERP5      DASSEQA-ARSAMNSLQGAFSTRIHQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_PECAS      DASSEQA-ARSALNSLQGVFSTRINQLVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_PHOLL      DASSEQA-ARSAMNSLQGAFSTQVHQMVEALTHLRIYVEAAIDFP-DEEIDFL-------
MNME_SODGM      DASSAQA-ARSAINSLQGAFSGRIHELVKALTNLRIYVEAAIDFP-DEEIDFL-------
MNME_ACTP2      DATSEQA-ARSALKSLQGEFSNKINQLVDSVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_ACTPJ      DATSEQA-ARSALKSLQGEFSNKINQLVDSVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_HAEDU      DATSEQA-ARSALKSLQGEFSNKINQLVDQVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_HAEI8      DATSEQA-ARSALKSLQGEFSKKVNELVDSVIYLRTYVEASIDFP-DEEIDFL-------
MNME_HAEIE      DATSEQA-ARSALKSLQGEFSKKVNELVDSVIYLRTYVEASIDFP-DEEIDFL-------
MNME_HAEIN      DATSEQA-VRSALKSLQGEFSKKVNELVDSVIYLRTYVEASIDFP-DEEIDFL-------
MNME_HAEIG      DATSEQA-ARSALKSLQGEFSKKVNELVDSVIYLRTYVEASIDFP-DEEIDFL-------
MNME_MANSM      NASSEQA-ARSALKSLQGEFSKKINQLVDSVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_ACTSZ      DASSEQA-ARSALKSLQGEFSNKVNQLVDGVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_PASMU      DASSEQA-ARSALKSLQGEFSNKVNQLVDSVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_HAES1      EASSEQA-ARSALKSLQGEFSNKINELVDSVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_HISS2      EASSEQA-ARSALKSLQGEFSNKINELVDSVIYLRTYVEAAIDFP-DEEIDFL-------
MNME_AERHH      EASSEQA-ARSAMHSLQGQFSGKIQQLVESLTRLRIYVEAAIDFP-DEEIDFL-------
MNME_AERS4      EASSEQA-ARSAMHSLQGQFSSKIQQLVESLIRLRIYVEAAIDFP-DEEIDFL-------
MNME_SHEB8      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEB9      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEB5      DATCEQA-AKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEPC      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHESW      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHESA      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTHLRLYVEAAIDFP-DEEVDFL-------
MNME_SHESM      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTHLRLYVEAAIDFP-DEEVDFL-------
MNME_SHESR      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTHLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEON      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTHLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEFN      DATSEQA-AKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEDO      DATSEQA-AKSALQSLQGEFSKEVHELVEQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEHH      DATSEQA-AKSALNSLQGEFSTQVHDLVEKVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEPA      DATSEQA-AKSALNSLQGEFSTQIHDLVEKVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHESH      DATSEQA-AKSALNSLQGEFSTQVHELVDRVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEWM      DATSEQA-AKSALNSLQGEFSVQIHELVEQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHELP      DATSEQA-AKSALNSLQGEFSTQVHELVDQVTNLRLYVEAAIDFP-DEEVDFL-------
MNME_SHEAM      DATSEQA-AKSALHSLQGEFSTQVHTLVDKITNLRLYVEAAIDFP-DEEVDFL-------
MNME_VIBCH      DASSEQA-AKSALQSLQGEFSKRIHTLVESLIHLRIYVEAAIDFP-EEEIDFL-------
MNME_VIBC3      DASSEQA-AKSALQSLQGEFSKRIHTLVESLIHLRIYVEAAIDFP-EEEIDFL-------
MNME_VIBCB      DASSEEA-AKSALQSLQGQFSQRIQTLVESLIHLRIYVEAAIDFP-EEEIDFL-------
MNME_VIBPA      DASSEEA-AKSALQSLQGQFSQRIQTLVESLIHLRIYVEAAIDFP-EEEIDFL-------
MNME_VIBVU      DASSEEA-AKSALQSLQGQFSKRIHTLVESLIHLRIYVEAAIDFP-EEEIDFL-------
MNME_VIBVY      DASSEEA-AKSALQSLQGQFSKRIHTLVESLIHLRIYVEAAIDFP-EEEIDFL-------
MNME_ALIF1      DASSEEA-AKSALNSLQGVFSNKINTLVESLIYLRIYVEAAIDFP-EEEIDFL-------
MNME_PHOPR      DASSEEA-AKSAFRSLQGAFSTKVNELVEAVIHLRIYVEAAIDFP-EEEIDFL-------
MNME_PSYIN      EATSEQA-AKSALHSLQGEFSEKIEQLVESLIYLRIYVEASIDFP-EEEVDFL-------
MNME_PSEA6      DASSEQA-ARGALRSLQGEFSTQINSLVELLTHLRIYVEAAIDFP-DEEIDFL-------
MNME_PSEHT      NATSEQA-AKSALQSLQGEFSKHIETLVEKVIHLRMYVEAAIDFP-DEEIDFL-------
MNME_IDILO      DTNSEQA-AKAALQSLKGEFSHKIDQLVDAVIHLRIYVEAAIDFP-DEEIDFL-------
MNME_COLP3      NSSSEQA-ARSALHSLQGDFSKLVNEMVESIIHLRMYVEAAIDFP-EEEIDFL-------
MNME_CHRSD      DASSRAA-AENALRSLQGEFSTRVSALVDKLIELRMFVEAAIDFP-EEEIDFL-------
MNME_MARMS      DSTSEQA-AKCALRSLQGAFSKRVDELVEALIHLRIYVEAAIDFP-EEEIDFI-------
MNME_MARHV      ESSSEQA-ARCAVRSMQGVFSKRVDNLVEAITHLRIYVEAAIDFP-EEEIDFL-------
MNME_HAHCH      EATSEQA-AHSAMRSLQGQFSKEIENLIESLIQLRIYVEAAIDFP-EEEIDFL-------
MNME_PSEAE      EASSEQA-ARNALRSLQGEFSRRVHALTEQLISLRIYVEAAIDFP-EEEIDFL-------
MNME_PSEAB      EASSEQA-ARNALRSLQGEFSRRVHALTEQLISLRIYVEAAIDFP-EEEIDFL-------
MNME_PSEA7      EASSEQA-ARNALRSLQGEFSRRVHALTEQLISLRIYVEAAIDFP-EEEIDFL-------
MNME_PSEPU      EASSSQA-ARNALRSLQGEFSRRVHSLTEALIALRIYVEAAIDFP-EEEIDFL-------
MNME_PSEP1      EASSSQA-ARNALRSLQGEFSRRVHSLTEALIALRIYVEAAIDFP-EEEIDFL-------
MNME_PSEPK      EASSSQA-ARNALRSLQGEFSRRVHSLTEALIALRIYVEAAIDFP-EEEIDFL-------
MNME_PSEPG      EASSSQA-ARNALRSLQGEFSKRVHSLTEALIALRIYVEAAIDFP-EEEIDFL-------
MNME_PSEPW      EASSSQA-ARNALRSLQGEFSKRVHSLTEALIALRIYVEAAIDFP-EEEIDFL-------
MNME_PSEE4      EASSTQA-ARNALRSLQGAFSKRVHGLTEALIALRIYVEAAIDFP-EEEIDFL-------
MNME_PSEF5      EASSAQA-ARNALRSLQGAFSQRVYNLTEQLIALRIYVEAAIDFP-EEEIDFL-------
MNME_PSEPF      EASSAQA-ARNALRSLQGAFSQRVHNLTEQLIGLRIYVEAAIDFP-EEEIDFL-------
MNME_PSE14      EASSAQA-ARNALRSLQGAFSRRVDNLTEKLISLRIYVEAAIDFP-EEEIDFL-------
MNME_PSEU2      EASSAQA-ARNALRSLQGAFSRRVDNLTEKLISLRIYVEAAIDFP-EEEIDFL-------
MNME_PSESM      EASSAQA-ARNALRSLQGVFSQRVDNLTEKLISLRIYVEAAIDFP-EEEIDFL-------
MNME_PSEMY      EASSEQA-ARNALRSLQGEFSKRVHALTESLIQLRIYVEAAIDFP-EEEIDFL-------
MNME_PSEU5      EASSAQA-ARNAVRSLQGEFSRRVHQLTERLIQLRIYVEAAIDFP-EEEIDFL-------
MNME_SACD2      EASSQQA-AKQALNSLKGEFSNKIHELVEQLIHLRMYVESAIDFP-EEEIDFL-------
MNME_HYDCU      DASSQQA-ARSALRSLQGDFSNQVNELVEQLIQLRIYVEAAIDFP-EEEIDFL-------
MNME_LEGPC      QASSDTA-ARMALKSLQGDFSKKINQLNEELIYLRMYVEAAIDFP-EEEIDFL-------
MNME_LEGPH      QASSDTA-ARMALKSLQGDFSKKINQLNEELIYLRMYVEAAIDFP-EEEIDFL-------
MNME_LEGPA      QASSDTA-ARMALKSLQGDFSKKINQLNEELIYLRMYVEAAIDFP-EEEIDFL-------
MNME_LEGPL      QASSDTA-ARMALKSLQGDFSKKINQLNEELIYLRMYVEAAIDFP-EEEIDFL-------
MNME_ALCBS      DAGTAAS-ARAALHSLQGVFSAEVNQLVEALIGLRIYVEAAIDFP-EEEIDFL-------
MNME_METCA      DSSTEES-ARSAQRSLQGEFSAHIHHLQECLVRLRTYVEAAIDFS-DEDIDLL-------
MNME_NITOC      ESASEQA-ARSALRSLHGEFSAQIQTLREQLTELRCVVEANIDFS-DEDIDFI-------
MNME_ALKEH      AADSEAS-AQAALRSLEGAFGDAVRELVARVTRLRVQVEAAIDFS-DEEIDFL-------
MNME_COXBU      NASSEQA-ARSAMRSLQGEFSKRIHQLVDALIQLRMYIEASIDFP-EEEIDFL-------
MNME_COXBN      NASSEQA-ARSAMRSLQGEFSKRIHQLVDALIQLRMYIEASIDFP-EEEIDFL-------
MNME_COXBR      NASSEQA-ARSAMRSLQGEFSKRIHQLVDALIQLRMYIEASIDFP-EEEIDFL-------
MNME_PSYCK      DATSAAA-ASSAIRSLSGEFSQKINQLLEQLIHLRLHVEAAIDFPDEEDVDFL-------
MNME_PSYA2      DATSAAA-ASSAIRSLSGEFSKKINQLLEQLIHLRLHVEAAIDFPDEEDVDFL-------
MNME_PSYWF      DATSAAA-ASSAIRSLTGAFSNKINEVLEALIELRLYVEASIDFPDEEDVDFL-------
MNME_ACIBY      DATSQAA-ARSAVRSLQGAFSTKINTVLEKLIHLRLHVEAAIDFP-EEEIDFL-------
MNME_ACIBT      DATSQAA-ARSAVRSLQGAFSTKINTVLEKLIYLRLHVEAAIDFP-EEEIDFL-------
MNME_ACIAD      DATSQAA-ARSAVRSLQGAFSLRINQVLEKLIHLRLHVEAAIDFP-EEEIDFL-------
MNME_DICNV      HARSQDA-LRAANRSLQGVFSQKIDALADELLRLRVYVEASLDFS-EDEIDFL-------
MNME_BORBR      DASSEAA-ARGAMTSLSGEFSQRVNDLSDRIIHLRMLVEATLDFP-EEEIDFL-------
MNME_BORPA      DASSEAA-ARGAMASLSGEFSQRVNDLSDRIIHLRMLVEATLDFP-EEEIDFL-------
MNME_BORPE      DASSEAA-ARGAMASLSGEFSQRVNDLSDRIIHLRMLVEATLDFP-EEEIDFL-------
MNME_BORPD      DASSVAA-ARGAMASLSGEFSARVNALSDRIVHLRMLVEATLDFP-EEEIDFL-------
MNME_BORA1      EASSEAA-ARGAMASLSGEFSQRINDLSGRIVHLRMLVEATLDFP-EEEIDFL-------
MNME_CUPPJ      EASTEAA-ARSAARSMEGEFSHAIHTLVEKVIHLRMLVEATLDFP-EEEIDFL-------
MNME_CUPNH      EASTEAA-ARSAARSMEGEFSNAIRQLVDKVIHLRMLVEATLDFP-EEEIDFL-------
MNME_CUPMC      EASTEAA-ARSAARSMEGEFSKAIHALVEKVIHLRMLVEATLDFP-EEEIDFL-------
MNME_RALSO      EASTEAA-ARSAARSLDGVFSQTVHALVERVIHLRMLVEATLDFP-EEEIDFL-------
MNME_BURM7      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURMA      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURP6      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURP0      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURMS      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURM9      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURPS      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURP1      EASSEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURTA      EASTEAA-ARSAGRSLDGAFSRDIHALVDDVIALRMLVEATLDFP-EEEIDFL-------
MNME_BURCA      EASTEAA-ARSAGRSLDGAFSRQIHALVDDVITLRMLVEATLDFP-EEEIDFL-------
MNME_BURCH      EASTEAA-ARSAGRSLDGAFSRQIHALVDDVITLRMLVEATLDFP-EEEIDFL-------
MNME_BURCC      EASTEAA-ARSAGRSLDGAFSRQIHALVDDVITLRMLVEATLDFP-EEEIDFL-------
MNME_BURL3      EASTEAA-ARSAGRSLDGAFSRQIHALVDDVITLRMLVEATLDFP-EEEIDFL-------
MNME_BURCM      EASTEAA-ARSAGRSLDGAFSRQIHALVEDVITLRMLVEATLDFP-EEEIDFL-------
MNME_BURA4      EASTEAA-ARSAGRSLDGAFSRQIHALVEDVITLRMLVEATLDFP-EEEIDFL-------
MNME_BURVG      EASTEAA-ARSAGRSLDSAFSRQIHALVEDVITLRMLVEATLDFP-EEEIDFL-------
MNME_PARXL      EASTEAA-ARSAGRSLDGAFSRDIHALVEDVITLRMLVEATLDFP-EEEIDFL-------
MNME_JANMA      EASTEAA-AKSASQSLSGAFSKTIQDLVDKITNLRMLVEATLDFP-EEEIDFL-------
MNME_HERAR      EASTEAA-AKSATQSLSGAFSKTIQELVDKITNLRMLVEATLDFP-EEEIDFL-------
MNME_ACISJ      DASTEAA-ARGASRSLSGDFSREIHTLRDALVHLRMLVEATLDFP-EEEIDFL-------
MNME_ACIAC      DASTEAA-ARSASRSLAGAFSDEIHRLRDALVHLRMLVEATLDFP-EEEIDFL-------
MNME_VEREI      DASTEAA-ARSASRSLSGAFSAGIHGLCDALIALRTLVEASLDFP-EEETDFL-------
MNME_RHOFT      DASTEAA-ARSASRSLSGAFSQEIHILREALIHLRMLVEATLDFP-EEEIDFL-------
MNME_POLSJ      DASTETA-ARSAARSMSGEFSLAVNTLLEQLIHLRMLVEATLDFP-EEDIDFL-------
MNME_POLNA      DASTETA-ARSAARSMSGEFSQAVNTLLEQLIHLRMLVEATLDFP-EEDIDFL-------
MNME_LEPCP      DASTEAA-ARSAARSLSGDFSRQITHLRDGLIELRALVEATLDFP-EEEIDFL-------
MNME_METPP      DASTEAA-ARSAGRALAGAFSQQVDTLRDRLIELRMLVEATLDFP-EEEIDFL-------
MNME_NEIMA      DASSRSA-ARLALRSLKGDFSRRIHGLVEDLITLRMLVEATLDFP-EEDIDFL-------
MNME_NEIMB      DASSRSA-ARLALRSLKGDFSRRIHGLVEDLITLRMLVEATLDFP-EEDIDFL-------
MNME_NEIM0      DASSRSA-ARLALRSLKGDFSRRIHGLVEDLITLRMLVEATLDFP-EEDIDFL-------
MNME_NEIMF      DASSRSA-ARLALRSLKGDFSRRIHGLVEDLITLRMLVEATLDFP-EEDIDFL-------
MNME_NEIG1      DASGRSA-ARLALRSLKGDFSRRIHGLVEGLITLRMLVEAALDFP-EEDIDFL-------
MNME_CHRVO      DASSETA-ARSALKSLKGAFSREVHGLVDELINLRMLVEATLDFP-EEEIDFL-------
MNME_AZOSB      EASTAAA-ARSALRSLSGQFSEEVLRIRDALIDLRMLVEATIDFP-EEEVEFL-------
MNME_AROAE      EASTVVA-ARSAVRSLSGVFSDEMHRLTDALIDLRMLVEATLDFP-DEDVEFL-------
MNME_DECAR      DAATASA-ARSAVRSLQGEFSRAIGELNDELINLRMLVEATLDFP-EEDIDFL-------
MNME_NITEU      AASTANA-ARCAVRSLHGEFSSTIHQLVSALIDLRVLVEATLDFP-EEEIDFL-------
MNME_NITEC      EASTANA-ARCAVRSLHGEFSSAIHQLVSALIDLRVLVEATLDFP-EEEIDFL-------
MNME_NITMU      DASTEEA-ARCAIRSLQGEFSNAIHTSVQALTDLRMLVEASLDFS-EEEIEFI-------
MNME_THIDA      DAASAEA-ARSALRSLSGEFSARIDELVEQLVRLRTLVEATLDFP-DEEIDFL-------
MNME_METFK      NAATEAA-ARSAVRSLSGEFSARIHSLQQKLVDLRLYVEACLDFP-EEDIDFI-------
MNME_POLAQ      DAQSEAA-VRGAARSLQGSFSEDINGLIEEITQLRILVESTLDFP-EEEIEFL-------
MNME_FRATF      NASSEIA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_FRATH      NASSEIA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_FRATO      NASSEIA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_FRATT      NASSEIA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_FRAT1      NASSEIA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_FRATW      NASSEIA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_FRATN      NASSEIA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_FRAP2      NASSETA-AKSAAKSLQGDFSKEINNLLEKLIYLRMYVEASIDFP-EEEINFL-------
MNME_RUTMC      NANSKRA-SKSAFRSLSGEFSNQVNALTKSIVELRVFVEATIDFS-DEEIDFL-------
MNME_VESOH      NANSKRA-SKSAFRSLSGDFSNQINGLTKSIIELRVFVEATIDFS-DEEIDFL-------
MNME_XANAC      AAGDLRA-ARAARRALDGVFSQRVDALAETLTRLRIHVEAAIDFA-DEPLDTL-------
MNME_XANC5      AAGDLRA-ARAARRALDGVFSRRVDAVADTLTRLRIHVEAAIDFA-DEPLDTL-------
MNME_XANOM      AAGDLRA-ARAARRALDGVFSRRVDAVAHTLTRLRIHVEAAIDFA-DEPLDTL-------
MNME_XANOR      AAGDLRA-ARAARRALDGVFSRRVDAVAHTLTRLRIHVEAAIDFA-DEPLDTL-------
MNME_XANCP      AAGDLRA-ARAARRSLDGVFSRRVDAVSESLTRLRIHVEAAIDFA-DEPLDTL-------
MNME_XANC8      AAGDLRA-ARAARRSLDGVFSRRVDAVSESLTRLRIHVEAAIDFA-DEPLDTL-------
MNME_XANCB      AAGDLRA-ARAARRSLDGVFSRRVDAVSESLTRLRIHVEAAIDFA-DEPLDTL-------
MNME_XYLFA      GAADLRA-ARAARRSLDGVFSRRCEALAQQLIRLRIHVEATIDFA-EESLDTL-------
MNME_XYLFT      GAADLRA-ARAARRSLDGVFSRRCEALAQQLVRLRIHVEATIDFA-DESLDTL-------
MNME_BLOFL      NATSYQA-AKSACNSLQGHFSNQIRIILNKITNFRTYIESTLDFSDQ-EISDI-------
MNME_BLOPB      DATSYQA-AKSASNSLQGIFSRKIYIILEQLTNLRMYAESSIDFSED-EISII-------
MNME_BAUCH      DANSAQA-ARAAISSLQGVFSTTINDLVEKLTSLRVDIEAKINFPEENETNVS-------
MNME_WIGBR      NSCSIQA-AKSALISIRGYFSKKINNLILSIKKLRMKIEVDIDFSEE-NFNKI-------
MNME_BUCCC      NAESHLS-VKAALSSLRGTFSKKINKILFNLKDIYSEIEAIINFPEE-LNDLN-------
MNME_BUCAI      NSETELS-ARASLNSLQGKFSFFIKELMNLIIEFRINIESNIDFSEEEININ--------
MNME_BUCMP      NSETESS-IRASLHSLQGDFSSHIKQLISTVIEFRTNIESSIDFSEEEIDID--------
MNME_BUCAP      NSETESV-VRASLNSLHGNFSFYIQKIIKKLIEFRTNIEASIDFSEENIDFD--------
MNME_BUCBP      NATSEQA-ARSAMQSLQGLFSIYINNLIKDFTKFRAKIEAQINFSDHEINADN-------
MNME_CAUVC      DAETEAQ-RRQALGQVGGALSQRYDRWRDLLVQALAMLEAAVDFPDE-DLPEE-------
MNME_CAUSK      DAETEAQ-RRQALGQLGGALSQRYEAWRGLLVQALAMLEAAVDFPDE-ELPED-------
MNME_MARMM      DAETEGQ-RVQALSQMSGSLRRLYDGWRDALITAMASIEGEIDFPDEADVPDA-------
MNME_RHORT      DAETQAQ-RRQALRQADGALVRLYEGWRKTGIGLLAHLEAVLDFPDE-DLPPE-------
MNME_MAGSA      DAETAAQ-RRQALRQLDGGLAGLVEGWRSALVRAMAHLEAVIDFADE-DIPDT-------
MNME_PARL1      DAETEAQ-RAQALRQMEGALGQLYEAWRARLMRALAYAEAEIDFPDE-EVPGD-------
MNME_NITWN      HADTDRQ-RRQALRQLQGLLGDRARGWRKELIDASALIEAGIDFADEEDVPED-------
MNME_NITHX      HADTDRQ-RRQALRQLQGLLGDRAREWRRELIEASALIEAGIDFADEGDVPDD-------
MNME_BRASO      HADTDRQ-RRQALRQLKGLLGDKVRRWREQIIEAAALIEAGIDFSDEGDVPAE-------
MNME_BRASB      HADTDRQ-RRQALRQLKGLLGDKARSWRDQIIQAAALIEAGIDFADEGDVPAE-------
MNME_BRADU      HADTDRQ-RRQALRQLQGLLGNRARDWRERIIEASALIEAGIDFSDEGDVPAE-------
MNME_RHOP5      HADTDRQ-RRQALRQLNGLLGDRARDWRAQIIEAQALIEAGIDFADEGDVPDD-------
MNME_RHOPS      HADTEAQ-RRQAVRQLGGLLGDRARRWRAQIIEATALIEAGIDFADEGDVQGE-------
MNME_RHOP2      HADTEAQ-RRLAVRQLGGLLGDRARRWRAQIIEALALIEAGIDFADEGDVQGE-------
MNME_RHOPA      HADTDAQ-RRQALRQLGGVLGDRARRWRDQIIEALALVEAGIDFSDEGDVADE-------
MNME_RHOPB      HADTERQ-RRQALRQLQGLLGDRARDWRGEIIAASALVEAAIDFADEGDVPDE-------
MNME_METPB      DAETEAQ-RVQALRQLDGALGRQVAAWRETGIELLAGAEAALDFADEGDVDEDG------
MNME_METRJ      DAETEGQ-RRQALRQLDGALSRQVAAWRAEAIDCLAAAEAALDFADEGDVDDAG------
MNME_METS4      DAETEAQ-RRQAMRQLDGALGRLVEAWRDTLLGVLAGAEAALDFSDEGDVDESA------
MNME_AZOC5      VAESEAQ-RRQALAQSSGALSRAVAGWRERLIRALALVEATIDFSDEGDVPDD-------
MNME_BEII9      EAETEWQ-RRQALRQMRGALSRQAEMWRQALLEALSLAEAEIDFSDEADVPPE-------
MNME_RHIEC      SAETEMQ-RRLAVEQSAGGVSAIYDSWAKRLIRARALIEAELDFPDEDDVPGS-------
MNME_RHIL3      GAETEMQ-RRLAVEHSAGGLSAIYDSWAERLTRARALVEAELDFPEEDDVPGS-------
MNME_SINMW      AAETEMQ-RRLAVEQSGGGQSALYAGWARRLTHARAMIEAELDFADEDDIPGS-------
MNME_RHIME      AAETEMQ-RRLAIEQSGGGQSALYAGWARRLTHSRAMIEAELDFADEDDVPGS-------
MNME_AGRFC      QAETEMQ-RRLAVEQSSGQLSALYDGWANRLTRARALIEAELDFADEEDVPDS-------
MNME_BRUC2      AAETEGQ-RRLAMQVASGNQRKLYSEWRQRLINARAFIEAELDFADESDVPGS-------
MNME_BRUSU      AAETEGQ-RRLAMQVASGNQRKLYSEWRQRLINARAFIEAELDFADESDVPGS-------
MNME_BRUA2      AAETEGQ-RRLAMQVASGNQRKLYSEWRQRLINARAFIEAELDFADESDVPGS-------
MNME_BRUAB      AAETEGQ-RRLAMQVASGNQRKLYSEWRQRLINARAFIEAELDFADESDVPGS-------
MNME_BRUME      AAETEGQ-RRLAMQVASGNQRKLYSEWRQRLINARAFIEAELDFADESDVPGS-------
MNME_BRUO2      AAETEGQ-RRLAMQVASGNQRKLYSEWRQRLINARAFIEAELDFADESDVPGS-------
MNME_BRUSI      AAETEGQ-RRLAMQVASGNQRKLYSEWRQRLINARAFIEAELDFADESDVPGS-------
MNME_OCHA4      AAETEGQ-RRLALQVASGTQRELYTEWRQRLLRARAFIEAELDFADESDVPGS-------
MNME_BARHE      EAETESQ-RRLAVMGTSGRLTTLYRDWRHKLMKIRAFIEAELDFSDEADIPNT-------
MNME_BART1      EAETESQ-RRLAVMGTSGHLTTLYRDWRHKLMKVRAFIEAELDFADEEDIPDT-------
MNME_BARQU      EAETESQ-RRLAVMGTSGRLTTLYRDWRNRLIKARAFIEAELDFSDEADVSDL-------
MNME_BARBK      EAETESQ-RRLAVMGANGHLTELYRHWRNKLMTARALIEAELDFSDEADVSNF-------
MNME_CHESB      AAETEAQ-RRFALVNSSDMRKRLYDGWRRRLIHARAMIEAELDFADESDVPGS-------
MNME_RHILO      NAETEAQ-RRFAVRNAEGVQSELYLSWRRRLIHARAMIEAEIDFADEDDVPGS-------
MNME_HYPNA      EAETGAQ-KAQALRQLGGGLTEIYDGWREELTGTLALIEVMIDFPDEGDVPED-------
MNME_GRABC      DAETSAQ-RRQALQQLDGGLSRQLETWTATLTRVLAWQETLIDFPDEDLPAE--------
MNME_ACICJ      DAETEAQ-RQLALDLAGGAMSRAVAAWREALIGLMAQLAALIDFADEDLPAE--------
MNME_GLUOX      DAETESQ-RKQALRQADGALSRLYDDWAQRLRLVLAHQEALIDFPDEELPQD--------
MNME_ERYLH      FAETELQ-RQVLQASAGGRLSELVGGWRERVLALSAQVESALDFSDEDDVDE--------
MNME_NOVAD      SAETELQ-RRTALAMAEGALSREVDEWRTTLLQISARLEAALDFSDEDDVGAGDGTQRAS
MNME_SPHWW      AAETEAQ-RRNAMLLAGGALSRALEDWQHRVLSLAARLEAQLDFSDEEDVAP--------
MNME_SPHAL      AAETESQ-RVQALDHASGHVSRAVAGWQARLLALMAAAEAELNFADEDDVEVGEG-----
MNME_ZYMMO      TAETASQ-RRAALMMSGGALGRQISAWQDRLLALSGQIEASFDFAEDIEEDETESRQ---
MNME_RUEST      DAETEAQ-RKQAQVILAGTLGDLADRWRTDLIRAASLIEVTIDFADE-EVPVD-------
MNME_RUEPO      DAETEAQ-RKQAQAVLNGALGQLAEGWRAKLIRAAALLEAVIDFADE-EVPTD-------
MNME_ROSDO      DAETEAQ-RRQAVRVLTGALGEKVEVWRSKLIRAAALIEATIDFADE-DVPVD-------
MNME_RHOS4      DAETEAQ-RRQAMRVFSGAIGERAERWRADLIRAAALLEATIDFADE-DVPVD-------
MNME_RHOS1      DAETEAQ-RRQAMRVFSGAIGERAERWRADLIRAAALLEATIDFADE-DVPVD-------
MNME_RHOS5      DSETEAQ-RRQAMRVFSGAIGKRTERWRSDLIRAAALLEATIDFADE-DVPVD-------
MNME_DINSH      EAETEAQ-RKQALRTFSGELGQKVELWRKDLVRAMALLEVTIDFADE-EVPED-------
MNME_JANSC      DSETEAQ-RKVAQASFEGGLSDKAERWRHLMIRAAALLEASIDFVDE-DVPVD-------
MNME_PARDP      SAETEAQ-RKLAMRATEGELGRKADELRSKLIRAGALIEASIDFADE-EVPDE-------
MNME_RICAH      NAETIMQ-HRQAIRQASGRLEELYNSWRSQLLKIISLLEAYIDFPDEDIPD---------
MNME_RICFE      NAETIMQ-HRQAIRQASGGLEELYNNWRTQLLKIISLLEAYIDFPDEDIPD---------
MNME_RICRO      NAETIMQ-HKQAIRQASGKLEALYNNWRSQLLKILSLLEAYIDFPDEDIPD---------
MNME_RICRS      NAETIMQ-HKQAIRQASGKLEALYNNWRSQLLKILSLLEAYIDFPDEDIPD---------
MNME_RICCN      NAETIMQ-HKQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDIPD---------
MNME_RICM5      NAETIMQ-HKQAIRQANGKLEELYNNWRSQLLKIISLLEAYIDFPDEDIPD---------
MNME_RICCK      NAETIMQ-HRQAIRQAGGALEELYNNWREQLLQIISLLEAYIDFPDEDIPD---------
MNME_RICPR      NAETIMQ-HRQAVRQANGGLKELYNKWRNQLLKIISLLEAYIDFPDEDIPE---------
MNME_RICTY      NAETIMQ-HRQAVRQANGGLEELYNNWRNQLLKIIALLEAYLDFPDEDIPD---------
MNME_RICB8      NAETIMQ-HKQAIRQAGGALEELYNSWRSQLLRIISLLEAYIDFPDEDIPE---------
MNME_RICBR      NAETIMQ-HKQAIRQAGGALEELYNSWRSQLLRIISLLEAYIDFPDEDIPE---------
MNME_ORITB      ESETLMQ-HKQAIRQMEGELEKLYSHWRGMLIKILSFIEGYIDFPDEEIPQ---------
MNME_ANAMM      NSETEAQ-LRQAFAQSSGFLERLYEEWRSSLVDILSDLEAYIDFPDDV-SP---------
MNME_ANAPZ      NAETDAQ-LRQALAQSTGKLEKQYDQWRSILLDILTDLEACIDFPEDVDSS---------
MNME_EHRCJ      NSETEMQ-AKQAIRQMSGALEKLYQSWRQQLIDILSNIEAYIDFPEEVNS----------
MNME_EHRCR      NSETEMQ-AKQAIRQMSGVLEKLYQNWRQQLIDILSNIEAYIDFPEEVNS----------
MNME_EHRRW      NAETEMQ-AKQAIRQMSGSLEKLYQSWRQQLIDVLSNMEAYIDFPEEVTS----------
MNME_EHRRG      NAETEMQ-AKQAIRQMSGSLEKLYQSWRQQLIDVLSNMEAYIDFPEEVTS----------
MNME_WOLTR      DAETKMQ-AKQAIKQMSGELEKLYSSWRQRLIAVQSKIEAYIDFPEDVATEK--------
MNME_WOLPM      DAETKMQ-AKQAIKQISGELERLYSNWRQRLITIQSKIEAYIDFPEDIWAEK--------
MNME_NEOSM      NSETQEQ-LKQASRHLSGKLAEEYNSLRDKIIKVLSYLEAYIDFPDEEIPE---------
MNME_PELUB      SAETEIQ-RQQAIKIMNGKSADKFNNLREKLLKILSHVEAKIDFPDEDLPE---------
MNME_DEIRA      EASTETA-RRQSALGLSGALSERVAGVARALTRTLAAIQALLDYPEEGVPDED-------
MNME_DEIGD      NAGTETA-RRQAALGLSGALGERVERIAAHVTRTLAALQAMLDYPEEGVPDED-------
MNME_THET8      EAEGELA-RRQALRALEGALSRRIEALENRLLNLLAHIQALLDYPEEGVEPLE-------
MNME_THET2      EAEGELA-RRQALRALEGALSRRIEALENRLLDLLAHIQALLDYPEEGVEPLE-------
MNME_HALHL      EAETDGA-RRAALRALSGAFGQRVDGLADRMIDLRALIEAFLDFPEDEDVPADP------
MNME_MYXXD      AADSEAA-VRAAAAGLSGALASRVQALEEPLRALHADMEGVLSFPDEAEGADE-------
MNME_RHOBA      EAEDRGT-LDQALSQLAGNLSRPLQAARSTLLDLLADVEAGLDFVDEDIEFISD------
MNME_AQUAE      SAKTELA-RKVALKQLHGELSKHIRPLRETLLELLAYVEADIEFAEEDIPTL--------
MNME_MAGMM      EATSLRA-AREASRQMTGTLSEHLMALKDHLVLTYAHLEAALDFSDEDIEPE--------
MNME_KORVE      ESQTLYQ-ARVAAQQLGGSVSRRLQPTKQKLVNLIAVLEAGIDFADDDVSVL--------
MNME_SOLUE      DATTLYQ-ARIAAQQVEGSVSRRIAPLKEQLLELIALLEAGIDFAEDDISVA--------
MNME_CHLTR      AADNIDA-FRIAQNQFQGHTSQAISSISSLIIEALAYIEVLADFPEEDIETED-SLPKHR
MNME_CHLTB      AADNIDA-FRIAQNQFQGHTSQAISSISSLIIEALAYIEVLADFPEEDIETED-SLPKHR
MNME_CHLT2      AADNIDA-FRIAQNQFQGHTSQAISSISSLIIEALAYIEVLADFPEEDIETED-SLPKHR
MNME_CHLTA      AADNIDA-FRIAQNQFQGHTSQAISSISSLIIEALAYIEVLADFPEEDIETED-SLPKHR
MNME_CHLMU      SAENIDA-FHIAQNQFQGHTSQAISSISSLIIEALAYIEVLADFPEEDIETER-SLPVQK
MNME_CHLCV      AADNLDA-FFIAQNHFQGHFSKKIQLISSLIVESLAFIEVLADFPEEE-QPDM-DVPKQR
MNME_CHLFF      AADNLDA-FHIAQNHFQGHFSQRVQKISSLIIESLAFIEVLADFPEEE-QPDM-EVPEKR
MNME_CHLAB      AADNLDA-FHIAQNHFQGHFSKKVQQISSLIIESLAFIEVLADFPEEE-QPDM-QEPMNR
MNME_CHLPN      VAENIDA-FRIAQTHFQGNFSKKIQEIHTLIIEALAFLEVLADFPEEE-QPDL-LVPQEK
MNME_PARUW      CAKNEKA-LGAAESQLKGSLSNRVLAFQSTLTQIAAILEAWVDFPEEGLEFAT-MDELDQ
MNME_OPITP      HAQSDRA-LAAANHQLRGSLGRHVQRIIDRVVRVLAQVEAYIDFPDEDLPSSN-RDTLAA
MNME_BDEBA      ESQSQQA-AKLALRQLKGTLSHKLEEIEDDMTWILAHAEASIDFSTEGIEVIE-ENVIQV
MNME_DESHY      AAKTDSS-ADLALAQMEGLLSQKILLLKDQVMETLAFIEAGIDFPEDDVESLD-RDALLQ
MNME_ALKMQ      SAKTDMG-FDVALNQLEGSLSKRVKKVKDELLDMLAHIEVSIDFSDEDVD----EVTLDL
MNME_ALKOO      SAKTEKG-FDVALSQLEGSLSKKVAKVREKLLDMLAHVEVSIDFAEDDVD----EVALDY
MNME_CLOD6      KAKTDIA-HEVAQNQLEGSLSKKIRELRDKVTEILAHVEVAIDYPEEDIE----HITYQT
MNME_FINM2      KAKTDKA-YSVSMKQLEGSVNRNIKQLRDKLLDMLSHVEYSINFTEDMQD----ELDNTP
MNME_FUSNN      HGKTEKS-LSLSLNQLRGDLRDKIATIKKSILDLAAHINVVLDYPEEGID----DPVPEN
MNME_CLOB1      RSKTDLS-MKSALKQAEGTLSKEINSIRNRMIKIIAHIEATVDYPEDDLE----EITGQK
MNME_CLOBK      RSKTDLS-MKSALKQAEGTLSKEINSIRNRMIKIIAHIEATVDYPEDDLE----EITGQK
MNME_CLOBH      RSKTDLS-MKSALKQAEGTLSKEINSIRNRMIKIIAHIEATVDYPEDDLE----EITGQK
MNME_CLOBL      RSKTDLS-MKSALKQAEGTLSKEINSIRNRMIKIIAHIEATVDYPEDDLE----EITGQK
MNME_CLOBM      RSKTDLS-MKSALKQAEGTLSKEINSIRNRMIKIIAHIEATVDYPEDDLE----EITGQK
MNME_CLOK5      RAKSHIS-VKSAVQQSQGKISKEINLLREELLEIIAHIEATVNYPEEDLE----EMTSDQ
MNME_CLOTE      RSKTELS-MKSAVSQSIGKVSEEINVLRENLIETIAHIEATVDYPEEDLE----EITSSQ
MNME_CLONN      NAKTELS-AKSALEQSEGKLSREIGKIRNKLLEIIASIEATVDYPEDDLE----EVTSEK
MNME_CLOAB      NSKTELS-MKSAVAQSEGVISREINKLRQRILEIIAHIEATVDYPEDDLE----EVTAEN
MNME_CLOPE      TAKTELS-MKSAMTQSQGRLSTEINNLRKEALDILALIEYAVDFTEDDEE-PD-ETIPVK
MNME_CLOP1      TAKTELS-MKSAMTQSQGRLSTEINNLRKEALDILALIEYAVDFTEDDEE-PD-ETIPVK
MNME_CLOPS      TAKTELS-MKSAMTQSQGRLSTEINNLRKEALDILALIEYAVDFTEDDEE-PD-ETIPVK
MNME_CLOB8      TAKTELS-MKAAMIQSKGALSKEINELRGYLLNVLALIEYAVDFTEDDEDIVD-DNLILQ
MNME_LACP7      HANNELA-LKNSMKQLKGNVLHKVKDVRHSIILDTAYIEAALDDPEHISL----EGFSDK
MNME_THEP3      RAKTMLA-NRYAQKQLVGYVGSKIKEMKDKIMGLLVHLLALIDFPEEDVE----ELERKE
MNME_THEPX      RAKTMLA-NRYAQKQLVGYVGSKIKEMKDKIMGLLVHLLALIDFPEEDVE----ELERKE
MNME_CALS4      TSKTMLA-NRYAQKQLAGVLGQKMKDLKNKIMELLSHLLALIDFPEEDVE----ELEREE
MNME_HUNT2      NSKTNES-SKAAISQLEGKLSRKIKDARSKLIELLAHIEVTVDYPEHDIE----EITGNM
MNME_CARHZ      RAKTEAS-LKLAGRQLSGELREKINAVRQKIINILAFIEVSIDYPEYEFD----EVTPET
MNME_DESRM      RAKTDAG-AKIAVNQLGGKLSEKVNGLQHKVLGLLAKIEAIIDFPEDDIP----EENLLG
MNME_PELTS      RSKTEAG-LRVAVSQLRGDLSRKVEDLQGRLLGLLAQVEANIDFPEDDLE----EATVED
MNME_CALS8      NSKTELL-QKNAAKQLKGVLSKKIDEIAEILLNLISSIEASIDFSEHEVD----EISPQE
MNME_SYNWW      RAKTERG-MNLALKQLAGRNSQEINLLEDQMIEVNAMLEASLDFPDEVGD-----LDYSA
MNME_NATTJ      TSKTNNL-KNVAINQLQGNLKQKIDRLRDDLVSVMANLEARIDFPDEDID----VEDYHE
MNME_DESPS      SAKTRKG-VDVAQEQLAGSLYRRIEPIRNALVHMRALFEVAIDFPDQSHD----IVDYEQ
MNME_MOOTA      RARSSRG-LTAALDHLRGNLSRKIGELNERLTGILAALEASMDFPEE--VGEV-DPENLA
MNME_DESAP      RARTGSS-LQVALGQLRGGLSERIGAMREALLQVLAEIEASIDFPEEEDVPET-RLEALA
MNME_ROSS1      TARTTTA-LALAEAQLGGWLSQELHRIRDLLMDPLAYCTALVDFPEDE-VDPQ-D---IE
MNME_ROSCS      TARTTTA-LALAEAQLGGWLSHELRRIRALLIDPLAYCTALVDFPEDE-VEPQ-D---VE
MNME_CHLAA      RAQTSAG-LAIAQAQLGGWLAREVRAARTAILEPLAYITALIDFPEEG-IEPQ-T---VA
MNME_SYMTH      RAKTDRA-MAAAVAHLRGSLRQAIGRIRERLMEMMAHLEADIDFPELE-LEVQ-TREEVA
MNME_HELMI      RAKTRDG-LGAAVSQLEGQLSRRIRKVRDDLLALLAHLEAMIDFPEED-LPDI-GSERIC
MNME_GEOSL      RAKTDAA-LALAQHQRQGRLSQRLDTVMAELRQALALVEAFIDFPEDD-IDPA-AQDALT
MNME_GEOMG      RSKTEAA-LNLAQHQREGRLSERLKAVQGCLRHSLALVEAFIDFPDDE-VDPA-SRVEIE
MNME_GEOUR      RSKTEKS-LALAQHQREGLLSQRIARVKDGIVSSLALIEAFIDFPEED-IDVL-GIQQVG
MNME_PELPD      SAQTDAA-LALAQRQRGGVLSSRIAEARQLLLHALALIEAYIDFPEDD-LGET-DVESIR
MNME_PELCD      RSRSNLA-SDVALSQLEGRLAQQIGVFGQVIADLLAQVEAAIDFPEED-IELD-DQQMLG
MNME_SYNAS      MARTSKG-LEAAVSHLKGQLKQKIDSLRDELIDVQVLLESAIDFTEDV--EFP-SPSEVL
MNME_SYNFM      RSRSEQG-LLLANRLLRGALGEKVRSWREGLLELQSRIEATIDFEDDL--DED-ALCAVS
MNME_DESVH      AAPSREG-MRLAQAKLDGLLGQRVGALRARLDALRMQLCVAVDFPEEEVE----CLAPEA
MNME_DESVV      AAPSREG-MRLAQAKLDGLLGQRVGALRARLDALRMQLCVAVDFPEEEVE----CLAPEA
MNME_DESAG      AAPAAEG-VRLAQARLDGMLGRHINALRERLELVRVQLCVAVDFPEDEVE----CLAPAD
MNME_LAWIP      AASSRNE-VLLASNRLKGLLGQKIIDIRRRIEELRVWICLAVDFPEEESG----IFPLEK
MNME_NOSS1      GARSPQA-AQTALAGLQGKLAHPIRQLRANCLDILAEIEARIDFEEDLPPLD---DEAII
MNME_TRIV2      GARSPQA-AQTALAGLQGKLAHPIRQLRANCLDILAEIEARIDFEEDLPPLD---DEKII
MNME_TRIEI      GSQSPAA-AQVALAGLQGKLASPIRHLRACCLDILAEIEARIDFEEDLPPLD---ESEIS
MNME_ACAM1      GARSPQA-AQAALAGVQGKLASPIRELRQRCLDTLAEVEARVDFEDDLPPLD---EAGVQ
MNME_SYNY3      GAQSPQA-AAIALAGLQGKLAQPIRDLRNTCLDILAEVEARIDFEDDLPPLD---EDSIR
MNME_MICAN      GARSPQA-AQFALAGLQGKLAQPIRHLRATCLDILAEIEARIDFEEDLPPLD---HAAVL
MNME_SYNP2      GAKSPQS-AQVALAGIQGKLAQPIQQLRGQCLDILAEVEARIDFEDDLPPLD---EPQIQ
MNME_SYNE7      SAQSPQA-AQAALGSLQGKLGHPIRQLRDRCLDILAEVEARIDFEDDLPPLD---LEAIA
MNME_SYNP6      SAQSPQA-AQAALGSLQGKLGHPIRQLRDRCLDILAEVEARIDFEDDLPPLD---LEAIA
MNME_THEEB      AAQSTTA-AQIALAGLTGKLARPLQQIRQTCLSLLAEIEARLDFTDELPPLD---PAAIA
MNME_SYNJA      AARSPQA-AQMALAGLQGKLGQSIRALRQELLGLLAEIEARLDFEEDLPPLD---VPAWQ
MNME_SYNJB      AARSPQA-ARMALAGLQGKLGGSIRALRQELLGLLAEIEARLDFEEDLPPLD---VAAWQ
MNME_GLOVI      SARSPEA-ARLAVGGLAGKLAGEVRQLRSGCLDLLAELEARLDFEDDLPPLD---TGAVR
MNME_PROM1      SARSRKA-AELAINGIEGNIQTTIQSIRKRLIEQLTEIEARIDFEEDLPLLD---EKHVK
MNME_PROMT      SARSRKA-AELAINGIEGNIQTTIQSIRKRLIEQLTEIEARIDFEEDLPLLD---EKHVK
MNME_PROMA      HARSQKA-AQLAIAGIDGDITNKINYLREKLLDQLSEIEARIDFEEDLPKLN---SKKLL
MNME_PROM3      AARSRRA-AQLAMTGVDGGIQRRITSLRERLLDQLSELEARVDFEEDLPPLD---AAELL
MNME_PROMM      AARSRRA-AQLAMTGVDGGIQRRITSLRERLLDQLSELEARVDFEEDLPPLD---GAELL
MNME_SYNSC      AARSRRA-AELAMAGLDGGIQAEITVLRERLLDQLTELEARVDFEEDLPPLD---GEALL
MNME_SYNPX      AARSRRA-AELAMAGLDGGIQAKITALRERLLDQLTELEARVDFEEDLPPLD---GDALL
MNME_SYNS9      SARSRRA-ADLAMAGLDGGIQARITVLRERLLDQLTELEARVDFEDDLPPLD---GTALL
MNME_SYNPW      AARSQRA-AELAMAGVDGGIQKRITALRDRLLDQLSELEARVDFEEDLPALD---GAALL
MNME_SYNS3      GARSQRA-AQLAMAGLDGGIQKKMVVLRERLLDQLSELEARVDFEEDLPPLN---GEALL
MNME_SYNR3      SARSRRA-AELAMAGLDGGLQQRIEALRDQLLDQLCELEARVDFEEDLPSLD---GAAVC
MNME_PROMS      NASNARS-AELAFSGVQGEIKKKIDDIKNDLINQLCEIEARVDFEEDFTDFD---YTKYL
MNME_PROM0      NASNTRS-AELAFSGIQGEIKKKIDDIKNDLINQLCEIEARVDFEEDFTDFD---YTKYL
MNME_PROM2      NASNTRS-AELAFSGIQGEIKKKINDIKNDLINQLCEIEARVDFEEDFTDFD---YTKYL
MNME_PROM9      NASNTRS-AELAFSGVQGKIKKKINDIKNDLINQLCEIEARVDFEEDFTDFD---YNKYL
MNME_PROM5      NAKNLKS-AEIAFNGVKGEIKKKIDVIKNDLIEQLSEIEARVDFEEDFSDFN---YHDFS
MNME_PROMP      NAKNLKS-AEIAFNGVKGEIKKKIDIIKNDLIEQLSEIEARVDFEEDFSEFN---YNDFS
MNME_CYACA      HSKTIAS-AKLAANTLRRGGSERIRRLKHTLSLLLADLEFHIDFSDEFIDVDS-IEDELR
MNME_CYAM1      HAPSVAM-AKKALSNLRGALSTQLHQVRSELIQLLAQIEAHLDFD---LDNTF-VFNSFI
MNME_BACFR      ASSSAAT-HRLALSQMRGGFSKELTTLREKLLNFTSMIELELDFSE-EDVEFADRSA---
MNME_BACFN      ASSSAAT-HRLALSQMRGGFSKELTTLREKLLNFTSMIELELDFSE-EDVEFADRSA---
MNME_BACTN      ASSSAAT-HRLAMSQMRGGFSKELTDLRSKLLNFTSMIELELDFSE-EDVEFADRSA---
MNME_BACV8      ASSSAST-HRLAMSQMRGGFSKELSNLRNQLLHFTSLMELELDFSDHEELEFANRDE---
MNME_PARD8      ASTSAGQ-HRLALSQMRGGFSRELAELRNQLLHFTSLMELELDFSDHEELEFADRSE---
MNME_PORGI      ASESKAQ-HQMAMKQLRGGYSEELNALREELLRLTGLMELELDFPE-EDVEFADRTE---
MNME_FLAJ1      SSDNEAS-HHIAMQQMRGGFSNEIAKLREELLNFASLIELELDFAE-EDVEFADRTQ---
MNME_FLAPJ      SSDNEAA-HQIAMQQMRGGFSNEIAKLREELLNFASLIELELDFAE-EDVEFADRTQ---
MNME_GRAFK      NSENAAS-HQMAMQQMRGGFSNEIQKLREELLNFASLIELELDFAE-EDVEFANRDQ---
MNME_CYTH3      SSDSHAS-HQVALQQMRGGFSDEIRKLREQLIHFASMVELELDFSE-EDVEFADRTQ---
MNME_SALRD      DATSTKA-HQASLTHLKGRYSDLLGDLREELLNLCSLVELEIDFSD-EDVEFADRER---
MNME_CHLTE      HARTESA-YRTAVSQMKGDLSVRLGGLREQLIRSCALIELELDFSE-EDVEFQSRDE---
MNME_CHLPD      HARSESA-YRTAVIQMKGDLSATLGALREKLLRSCALLELELDFSE-EDVEFQSREE---
MNME_CHLPM      HARTESA-FRTAVTQMQGNLSRHLQEMRAGLLQSCALLELELDFSE-DDVEFQSRDA---
MNME_PELLD      HARTDGA-FRTAVTQMQGGLSRRLLEMREGLLQSCALLELELDFSE-EDVEFQSREE---
MNME_CHLCH      HARSESA-FRTAVTQMQGRLSRQLEEMREKLLHSCALLELELDFSE-EDVEFQNREE---
MNME_BORAP      FAKTNKA-YSLAVNKLSGALFVKIDTIKKCILNFLSAVSVYLDYEV--DD--REIDI---
MNME_BORBU      FAKTNKT-YSLAVNKLSGALFVKIDAIKKSILNFLSAVSVYLDYEV--DD--HEISI---
MNME_BORBP      FATTNKT-YSLAVTPLSGALFANLDAIQRCLLNILSAVSAYLDYEV--DD--HEISI---
MNME_TREPA      DARTCAA-QQQAVLHLSGALQQEIAALTRALLAFSATLQGEIEYPE--DEETRVHDI---
MNME_TREDE      NSKTDIN-IELAAGRLSGNLFSGIEEIKHELTAVIAAADVEIEYPE--DEETSQGAF---
MNME_LEPBJ      SARSRFE-LELAQKNVFGEVSRLTSNLRSQLISLKAECEAEIDFSTEDLTYES-------
MNME_LEPBL      SARSRFE-LELAQKNVFGEVSRLTSNLRSQLISLKAECEAEIDFSTEDLTYES-------
MNME_LEPIN      SARSRFE-LELAQKNVFGEVTRFTSNLRSQLISLKAECEAEIDFSTEDLTYES-------
MNME_LEPIC      SARSRFE-LELAQKNVFGEVTRFTSNLRSQLISLKAECEAEIDFSTEDLTYES-------
MNME_LEPBA      EARSKYE-LELAQKNVFGEITKLSSKIRSDLISLKAECEAEIDFSTEDLTFES-------
MNME_LEPBP      EARSKYE-LELAQKNVFGEITKLSSKIRSDLISLKAECEAEIDFSTEDLTFES-------
MNME_UNCTG      TSKTEMS-AKAALNSLSGEFSSKIKNIRDAVTNLIASMEANLDHPDEDNMFLS-------
MNME_SULMW      NSETFFS-HKFAINQMRGNISLLIRKLSKEIINLLSLIEFELDFSEENCNFIN-------
MNME_CARRP      LYDNENM-FQLTKNSEKKIFLCIIKNLKFKINSLIICIEIA-NFNFSFFFFND-------
                                                          .                 

MNME_THEMA      TNTGEVVTRLERIKEKLTEELKKADAGILLNRGLRMVIVGKPNVGKSTLLNRLLNEDRAI
MNME_THESQ      TNTGEVVTRLERIKEKLTEELKKADAGILLNRGLRMVIVGKPNVGKSTLLNRLLNEDRAI
MNME_THEP1      TNTGEVVTRLERIKEKLTKELKKADAGILLNRGFRMVIVGKPNVGKSTLLNRLLNEDRAI
MNME_FERNB      VPKEEILNDLINVQSFLKEKIKHADKGLHISTGVTMAIVGKPNVGKSTLLNRLLVEDRAI
MNME_THEM4      LDEKSILNLLSKLKDEVGRKIEDSKKSIMLNNGIVMTIVGKPNSGKSTLLNRLLLEDRAI
MNME_PSELT      TDPYLIEKELNDAILQIEEILKNAQNRLILSSGIKVVIIGKPNVGKSTLLNTLVKEERAI
MNME_PETMO      FEDHDLKNKLVHIVNSMNQLLKEAENGIIAVEGVRTVIVGKPNSGKSTLLNALLRKDRAI
MNME_AYWBP      ITQQKIALEVQSLIKQLENILSHSHKNRYLKEGIKTLIIGRPNVGKSSLLNAFLNENKAI
MNME_ONYPE      ITQQKIALEVKSLIKQLENILNHSHKNRYLKEGIKTLIVGRPNVGKSSLLNAFLNETKAI
MNME_ACHLI      MSKELIYPRVNDLLDEINDILTKSKRTQYIREGVKTVIVGRPNVGKSSLLNALLNEERAI
MNME_BACAN      MTHNILIEKATHVRAEIAKILETSKQGKILREGIATAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACHK      MTHNILIEKATHVRAEIAKILETSKQGKILREGIATAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACCZ      MTHNILIEKATHVRAEIAKILETSKQGKILREGIATAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACAH      MTHNILIEKATHVRSEIAKILETSKQGKILREGIATAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACC1      MTHNILIEKATHVRAEIAKILETSKQGKILREGIATAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACCR      MTHNILIEKATHVRSEIEKILETSKQGKILREGIATAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACMK      MTHNILIEKATHVRAEIAKILETSKQGKILREGISTAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACCN      MTHRILIEKATHVQNEIEKILETSKQGKILREGIATAIIGRPNVGKSSLLNSLVQEKKAI
MNME_BACSU      MTHQILVEKATAVKKEIETLLRTSEQGKILREGLSTVIIGRPNVGKSSLLNSLVHEAKAI
MNME_BACVZ      MTHQLLVEKASGVKKEIEALLRTSEQGKILREGLSTVIIGRPNVGKSSLLNSLVHETKAI
MNME_BACP2      MTHRVLVEKATSVKKEIESLLSTSHQGKILREGLSTVIIGRPNVGKSSLLNSLVQETKAI
MNME_BACLD      MTHKMLIEKATKVKKEIEALLTTSEQGKILREGISTVIIGRPNVGKSSLLNSLVHETKAI
MNME_GEOKA      MTPRLLREKAEYVRGQIEKLLSTAAQGKILREGLATVIIGRPNVGKSSLLNALAHENRAI
MNME_GEOTN      MTPRLLKEKAEYVRGQIEKLLSTATQGKILREGLATVIIGRPNVGKSSLLNALAHENRAI
MNME_LYSSC      MTVPVLVEKCTWVRDEIIKLLQTSSQGKILREGLSTVILGRPNVGKSSLLNSLVQENKAI
MNME_OCEIH      MSHAMMKEKSKEVRDELDKLLQIAQQGKILREGLSTAIIGRPNVGKSSLMNTLVQENKAI
MNME_BACSK      MTAKLINEKMTIVLAEIEALLATAKQGKVLREGLATAIIGRPNVGKSSLMNSLVHEAKAI
MNME_BACHD      MTLDMLKDRAQFVRKEIDKLLMTAQQGKILREGLSTVIIGRPNVGKSSLLNSLVHENKAI
MNME_EXIS2      MTQQIVQKDAGEVRRILTELLATARQGKILREGLSTAIIGRPNVGKSSLLNTLVQEAKAI
MNME_STAAC      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAE      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAT      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAA3      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAA2      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAA9      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAR      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAW      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAN      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAA8      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAA1      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAM      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAS      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAAB      ATTEFLLEQSKEIKQEINRLLDTGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAES      ATTDFLLEQSKRIKEEINQLLETGAQGKIMREGLSTVIVGRPNVGKSSMLNNLIQDNKAI
MNME_STAEQ      ATTDFLLEQSKRIKEEINQLLETGAQGKIMREGLSTVIVGRPNVGKSSMLNNLIQDNKAI
MNME_STAHJ      ATTEFLLEQSKKIKNEINLLLETGAQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_STAS1      ATTEVLLGKSNEIKTEINKLLDTGTQGKIMREGLSTVIVGKPNVGKSSMLNNLIQDNKAI
MNME_LISMO      MTQRMLLEKTELVRASVEQLLRTASQGKILREGLATAIIGRPNVGKSSLLNQLIQEEKAI
MNME_LISMF      MTQRMLLEKTELVRASVEQLLQTASQGKILREGLATAIIGRPNVGKSSLLNQLIQEEKAI
MNME_LISIN      MTQRMLLEKTELVRASVEQLLQTASQGKILREGLATAIIGRPNVGKSSLLNQLIQEEKAI
MNME_LISW6      MTQRMLLEKTELVRASVEQLLQTASQGKILREGLATAIIGRPNVGKSSLLNQLIQEEKAI
MNME_ENTFA      LTTKLLLEKAEFVKAQIQQLLTTAKQGKILREGLSTAIIGRPNVGKSSLLNHLLREEKAI
MNME_LACP3      MTTKMLLEKAQTVQKAISNLLSTASQGKVLREGLATAIVGRPNVGKSSLLNHMLHEDKAI
MNME_LACSS      MTTRILLEKAELVKGRIGELLQTAQQGKVLREGLATAIVGRPNVGKSSLLNHLLHEDKAI
MNME_LACS1      LTTKMLREKAIEVKKSIQQLLTTAKQGKVLREGLATAIVGRPNVGKSSLLNHLLHEDKAI
MNME_LACPL      MTTKMLKEKATEVAQSINQLLATAKQGKVLREGLATAIIGRPNVGKSSLLNHLLHEDKAI
MNME_LACBA      MTTKMLLEKAHEVKQQIKTLLATAKQGKVLREGLATAIVGRPNVGKSSLLNHLLHEDKAI
MNME_PEDPA      MTARLLKEKAIEVKAKIQQLLSTAKQGKVLRDGLATAIIGHPNVGKSSILNHLLHEDKAI
MNME_LACLM      MTSQMLLEKTAHFEQLLENLLSTAKRGKILREGLKTAIIGRPNVGKSSLLNQLLREEKAI
MNME_LACLS      MTSQMLLEKTAHFEQLLENLLSTAKRGKILREGLKTAIIGRPNVGKSSLLNQLLREEKAI
MNME_LACLA      MTSQMLLEKTAHFEQLLENLLSTAKRGKILREGLKTAIIGRPNVGKSSLLNQLLREEKAI
MNME_STRA1      MTTTLMREKTQEFQALMENLLRTARRGKILREGLSTAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRA5      MTTTLMREKTQEFQALMENLLRTARRGKILREGLSTAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRA3      MTTTLMREKTQEFQALMENLLRTARRGKILREGLSTAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRAG      MTTTLMREKTQEFQALMENLLRTARRGKILREGLSTAKIGRPNVGKSQLLNNLLREEKAI
MNME_STRTD      VTTNLVREKTQEFQALLENLLATAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRT1      VTTNLVREKTQEFQALLENLLATAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRT2      VTTNLVREKTQEFQALLENLLATAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRMU      MTTALMREKTQEFETLLTNLLKTARRGKILREGLSTAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRP8      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRPD      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRP6      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRP3      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRPG      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRP1      MTTALLREKTQEFQSLLESLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRPC      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRPM      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRPF      MTTALLREKTQEFQSLLENLLRTAKRGKILREGLSTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRGC      MTTQLMREKTAEFEELLTSLLNTARRGKILREGISTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRSV      MTTQLMREKTAEFEALLSNLLNTARRGKILREGISTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRR6      ATTAVVREKTMEFEQLLTKLLRTARRGKILREGISTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRP2      ATTAVVREKTMEFEQLLTKLLRTARRGKILREGISTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRPI      ATTAVVREKTMEFEQLLTKLLRTARRGKILREGISTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRPN      ATTAVVREKTMEFEQLLTKLLRTARRGKILREGISTAIIGRPNVGKSSLLNNLLREDKAI
MNME_STRSY      ATTELVREKTLQFQALLENLLRTARRGKILREGIATAIIGRPNVGKSSLLNNLLREEKAI
MNME_STRS2      ATTELVREKTLQFQALLENLLRTARRGKILREGIATAIIGRPNVGKSSLLNNLLREEKAI
MNME_LACGA      LTSQEMKKKAQEVSKQIEQLLQTAQEGKIIRNGLATAIVGRPNVGKSSLLNYLTQDDKAI
MNME_LACJO      LTSQEMKKKAEEVSKQIDQLLKTAQEGKIIRNGLATAIVGRPNVGKSSLLNYLTQDDKAI
MNME_LACAC      VTANQMADTAKSVIEKIDRLLKTAQEGKILRNGLATAIVGQPNVGKSSLLNYLTQSDKAI
MNME_LACH4      VTAKQMADTAKSVIKKIDRLLKTAQEGKILRNGLATAIVGRPNVGKSSLLNYLTQSDKAI
MNME_LACDB      VTAQKLLACAEAVSGKIDRLLETAQEGQILRNGLKTAIVGRPNVGKSSLLNYLTQSDKAI
MNME_LACDA      VTAQKLLACAEAVSGKIDRLLETAQEGQILRNGLKTAIVGRPNVGKSSLLNYLTQSDKAI
MNME_MYCGE      VELSTLNNKVKLIIEKLKRIIENSKQLKKLHDPFKIAIIGETNVGKSSLLNALLNQDKAI
MNME_MYCPN      RELVTMNQAVVQITQILNQIVVGQDQLQRLKDPFKIAIIGNTNVGKSSLLNALLDQDKAI
MNME_MYCGA      KELTEEFKNLTNIRQKLQRIVNKSLKLKQISEGIKIAIVGEPNAGKSSLLNALLNEQKAI
MNME_UREPA      VDAIILKQRLLSLDKKITKIIDQSKKFLPINKGIRVLIIGKPNVGKSTLLNALCNEQKAI
MNME_UREP2      VDAIILKQRLLSLDKKITKIIDQSKKFLPINKGIRVLIIGKPNVGKSTLLNALCNEQKAI
MNME_MYCPE      VTAKEFNLEVKEIIDKLNKTINDFNKVSYLYNGLNVVIVGKPNVGKSSLLNSLIKKNKAI
MNME_MYCMS      SSIEDLTNLLEIINDQINKLLMRSKMAFKNSEGIKTAIIGQTNVGKSSILNALINEDKAI
MNME_MYCCT      SSIEDLTNLLEIINDQINKLLMRSKMAFKNSEGIKTAIVGQTNVGKSSILNALINEDKAI
MNME_MESFL      SSIPELAKALSGINEEVNNLLKRSKMAIKNTNGIKTAIVGKTNVGKSSLLNALLNEDKAI
MNME_MYCPU      LTLEVLLPKLKDLEKEISKAVELSERSRIYFNEIPIAIVGRPNVGKSSLLNALLEEDKSI
MNME_MYCMO      LHNETLLPKIKELIQKLNDLIKISEKASIIYNGLKIAIVGKPNVGKSSLLNALLNEERAI
MNME_MYCAP      PFTDKLISRLESIRNKISKTIELSQTSRMIFEGIKIAILGKPNVGKSSILNAILEEDKAI
MNME_MYCS5      SKEDINLTRINKLIARLEKIVKSSETALNYFEGIKLAIVGKPNVGKSSLLNTMLKEDKAI
MNME_MYCHJ      LTSDVLLPRINQLLADFDQLIKIANNSRLIYQGIKTCLVGAPNSGKSSLLNILINENKAI
MNME_MYCH2      LTSDVLLPRINQLLADFDQLIKIANNSRLIYQGIKTCLVGAPNSGKSSLLNILINENKAI
MNME_MYCH7      LTSDVLLPKINQLLADFDQLIKIANNSRLIYQGIKTCLVGAPNSGKSSLLNILINENKAI
MNME_CAMJE      DLLEQISTMCEENSKILKEIYTLSQSKKGLIEGFKIAIVGKPNVGKSSLLNALLSYERAI
MNME_CAMJJ      DLLEQISTMCEENSKILKEIYTLSQSKKGLIEGFKIAIVGKPNVGKSSLLNALLSYERAI
MNME_CAMJR      DLLEQISTMCEENSKILKEIYTLSQSKKGLIEGFKIAIVGKPNVGKSSLLNALLSYERAI
MNME_CAMJ8      DLLEQISTMCEENSKILKEIYTLSQSKKGLIEGFKIAIVGKPNVGKSSLLNALLSYERAI
MNME_CAMJD      DLLEKISTMCEENSKILKEIYTLSQSKKGLIEGFKIAIIGKPNVGKSSLLNALLSYERAI
MNME_CAMC5      DLLEQIKTMLEANAAKLDKIVQISEQRRGLIDGFKVAIVGKPNVGKSSILNSLLSYERAI
MNME_CAMC1      NLLEQTKLMLLKNSEKLERIATLSEQRRGLIDGFKIAIVGKPNVGKSSILNSFLAYERAI
MNME_CAMHC      DILDKIQNLLSENITKIDEITQISASRRGLLEGFKVAIIGKPNVGKSSILNSLLKFSRAI
MNME_CAMFF      DILHSSKDLLLNSYKKLEHIINISNSKKGLIDGYKVAIIGRPNVGKSSILNSLLHYERAI
MNME_SULDN      DLVMQIQAKLKELKTSLNKTLQASKAREGLMQGFKVAIIGKPNVGKSSLLNALLNYNRAI
MNME_ARCB4      DIYEQIENKMQKISLKLSNTLEASRRREGMIEGFKVAIIGKPNVGKSSLLNKLLNFDRAI
MNME_NITSB      DLQEQIEQQLNDIQEELQKIVASSKRRAGLIEGFKVAIIGKPNTGKSSLLNALLDYERAI
MNME_SULNB      DIMRSIVTQLDGLSEQIMKIVDASYRRRGLIEGFKVAIIGKPNVGKSSLLNALLSYDRAI
MNME_HELHP      YIRD-IQQKLAYVENELSHIYHISLTRQSIIEGYTLSIIGKPNVGKSSLLNALLRYERAI
MNME_WOLSU      DLEARMVEKIERIAEDLERIYQGSKRRSSLVEGYKLAIIGRPNVGKSSLLNALLLWERAI
MNME_HELPY      DFLDGVSLNLEKQIASFKDLLDFSNAQKQRNKGHALSIVGKPNAGKSSLLNAMLLEERAL
MNME_HELPJ      DFLKEVSFNLEKQIASFKDLLDFSNAQKQRNKGHALSIVGKPNAGKSSLLNAMLLEERAL
MNME_HELPH      DFLKEVSFNLEKQIASFKDLLDFSNAQKQKNKGHALSIVGKPNAGKSSLLNAMLLEERAL
MNME_HELAH      DFLNEVSLSLEKQIASFKDLLDFSNMQKQKNKGHALSIIGKPNAGKSSLLNAMLLEERAL
MNME_ECOLI      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECOLC      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SHIBS      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECODH      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SHIFL      -SDGKIEAQLNDVMADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SHIF8      -SDGKIEAQLNDVMADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SHIDS      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECO57      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECOUT      -SDGKIEAQLNNVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECOL5      -SDGKIEAQLNNVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECOK1      -SDGKIEAQLNNVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECOL6      -SDGKIEAQLNNVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECOSM      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECO24      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ECOHS      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SHISS      -SDGKIEAQLNDVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SALCH      -SDGKIEAQLNGVIADLDAVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SALPB      -SDGKIEAQLNGVIADLDAVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SALTY      -SDGKIEAQLNGVIADLDAVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SALPA      -SDGKIEAQLNGVIADLDAVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SALTI      -SDGKIEAQLNGVIADLDAVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SALAR      -SDGKIEAQLNGVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_CITK8      -SDGKIEAQLNGVIADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ENT38      -SDGKIEAQLNTVMADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_KLEP7      -SDGKIEAQLNEVMADLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_CROS8      -SDGKIEAQLNEVIGDLDAVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERPA      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERPN      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERPP      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERPE      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERPS      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERP3      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERPY      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_YERE8      -SDGKIEGQLNGVMADLEQVRTEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SERP5      -SDGKIEAQLNGVMADLDSVRAEARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_PECAS      -SDGKIEAQLNGVMADLDAVRTEAHQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_PHOLL      -SDGKIEAKLDEVIVELERVRSQARQGSLLREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_SODGM      -SEGKIEASLNDVIARLERVRTEARQGSLLREGMKVVIAGKPNAGKSSLLNALAGREAAI
MNME_ACTP2      -ADGKIEGHLNDTIRQLNGVRKEAKQGAILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ACTPJ      -ADGKIEGHLNDIIRQLNGVRKEAKQGAILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_HAEDU      -ADGKIERHLNDIIHQLAAVRQEAKQGSILREGMKAVIAGRPNAGKSSLLNALAGREAAI
MNME_HAEI8      -ADGKIEANLRGIINQLENVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_HAEIE      -ADGKIEANLRGIINQLENVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_HAEIN      -ADGKIEANLRGIINQLEDVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_HAEIG      -ADGKIEANLRSIINQLEDVRAEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_MANSM      -ADGKIEGHLNDLIGQLDKVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_ACTSZ      -ADGKIEGHLNDIIAQLERVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_PASMU      -ADGKIEAHLNDIITQLDHVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_HAES1      -ADGKIETHLREIIAKLAKVKNEAKQGAILREGMKVVIAGRPNAGKSSLLNTLAGREAAI
MNME_HISS2      -ADGKIETHLREIIAKLAKVKNEAKQGAILREGMKVVIAGRPNAGKSSLLNTLAGREAAI
MNME_AERHH      -SDGKVAGDLYAIMAELDDVRGEAKQGALLREGMKVVIAGRPNAGKSSLLNALAGRESAI
MNME_AERS4      -SDGKVAGDLYAIMAELDGVRSEAKQGALLREGMKVVIAGRPNAGKSSLLNALAGRESAI
MNME_SHEB8      -SDGKIANALYKIIDKLDLVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEB9      -SDGKIANALYKIIDKLDLVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEB5      -SDGKIANALYKIIDKLDLVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEPC      -SDGKIANALYKIIDKLSTVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHESW      -SDGKIANALYKIIDKLSTVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHESA      -SDGKIANALYKIIDKLSAVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHESM      -SDGKIANALYKIIDKLSVVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHESR      -SDGKIANALYKIIDKLSVVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEON      -SDGKIANALYKIIDKLIAVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEFN      -SDGKIANALYKIISKLDTVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEDO      -SDGKIANALYRIIAKLDTVQDSAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEHH      -SDGKIAASLNGIIGKLDGVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEPA      -SDGKIAASLNGIVGKLDGVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHESH      -SDGKIAGSLYRIITKLDSVQASAKQGAIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEWM      -SDGKIAGSLNRIITKLDSVQASAKQGAIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHELP      -SDGKIAASLGKIITKLDSVQSSAKQGAIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_SHEAM      -SDGKIAAALYAIIDQLDEVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAI
MNME_VIBCH      -ADGKVSADLQTIIDNLAAVRREANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKESAI
MNME_VIBC3      -ADGKVSADLQTIIDNLAAVRREANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKESAI
MNME_VIBCB      -ADGKVSGDLQAIIDNLDAVRKEANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKESAI
MNME_VIBPA      -ADGKVAGDLQAIIDNLDAVRKEANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKESAI
MNME_VIBVU      -ADGKVAGDLQAIIDNLDAVRKEANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKDSAI
MNME_VIBVY      -ADGKVAGDLQAIIDNLDAVRKEANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKDSAI
MNME_ALIF1      -ADGKVSGDLQGIIDNLNAVRKEANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKDTAI
MNME_PHOPR      -SDGKVSNDLHGIIDNLEAVRREANQGSIIREGMKVVIAGRPNAGKSSLLNALSGKDSAI
MNME_PSYIN      -SDGKISKGLYQIIDNLEAVKKQAKQGAILRDGMKVVIAGRPNAGKSSLLNSLVGVERAI
MNME_PSEA6      -SDGKVQNDLKAITKQLSSVKSQARQGSLLREGMRVVIAGRPNAGKSSLLNALAGRDAAI
MNME_PSEHT      -SDGKVSGDLDAIIAQLNTVTDQAKQGSIMREGMRVVIAGRPNAGKSSLLNALAGREAAI
MNME_IDILO      -SDGKVSGDLAEIIDQLFHIEQEAKQGTLMREGMRIVIAGRPNAGKSSLLNALAGRESAI
MNME_COLP3      -ADKKIVTDLKAIISRVEDVRKQAQQGSIIREGMRVVIAGRPNAGKSSLLNALSGKQTAI
MNME_CHRSD      -ADGKVAAMLQGAQETLGEVRAAAGQGALMREGMNVVIAGRPNAGKSSLLNALTERDSAI
MNME_MARMS      -GDGKVAAELAGIQAKLAEVLKEANQGALIREGMNVVIAGRPNAGKSSLLNALSGKESAI
MNME_MARHV      -ADGKVASDLQGLLEQVQQILGEAQQGTILRDGMKVVIAGRPNAGKSSLLNALAGREAAI
MNME_HAHCH      -SDGKVLNDLDTLLSQTQSVFASAKQGALMREGMTVVIAGRPNAGKSSLLNALAGRESAI
MNME_PSEAE      -ADGHVLGLLEKVRTELSTVQREASQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSEAB      -ADGHVLGLLEKVRTELSTVQREASQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSEA7      -ADGHVLGLLEKVRTELSTVRREASQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSEPU      -ADGHVLSMLDAVRSELSTVQREAGQGALLRDGMTVVIAGRPNAGKSSLLNQLAGREAAI
MNME_PSEP1      -ADGHVLSMLDAVRSELSTVQREAGQGALLRDGMTVVIAGRPNAGKSSLLNQLAGREAAI
MNME_PSEPK      -ADGHVLSMLDAVRSELSTVQREAGQGALLRDGMTVVIAGRPNAGKSSLLNQLAGREAAI
MNME_PSEPG      -ADGHVLSMLDAVRGELSTVQREAGQGALLRDGMTVVIAGRPNAGKSSLLNQLAGREAAI
MNME_PSEPW      -ADGHVLSMLDSVRAELSTVQREAGQGALLRDGMTVVIAGRPNAGKSSLLNQLAGREAAI
MNME_PSEE4      -ADGHVLRMLDDVRSELSTVQREAGQGALLRDGMTVVIAGRPNAGKSSLLNQLAGREAAI
MNME_PSEF5      -ADGHVLSMLDAVRDELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSEPF      -ADGHVLSMLDKVRNELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSE14      -ADGHVLNMLDDVRAELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSEU2      -ADGHVLNMLDDVRAELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSESM      -ADGHVLGMLDDVRAELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSEMY      -ADGHVLSQLDGVRADLSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_PSEU5      -ADGHVLAQLDGVRTELSTVLREAGQGALLRDGMTVVIAGRPNAGKSSLLNALAGREAAI
MNME_SACD2      -SDGIVEGKLNDVIDQTDAVLAQAQQGALLRDGMKVVIAGRPNAGKSSLLNALAEKDIAI
MNME_HYDCU      -SDGKVAGQLQHILEQLHRVLASAQQGVLLREGMSVVILGRPNAGKSSLLNALSGRESAI
MNME_LEGPC      -NDGNVSQLLQRIIGRLEEIRSQANQGVLLREGLSLVIAGRPNAGKSTLINNLAGRDVAI
MNME_LEGPH      -NDGNVSQLLQKIIGRLEDIRSQANQGVLLREGLSLVIAGRPNAGKSTLINNLAGRDVAI
MNME_LEGPA      -NDGNVSQLLQRIIGRLEEIRSQANQGVLLREGLSLVIAGRPNAGKSTLINNLAGRDVAI
MNME_LEGPL      -NDGNVSQLLQRIIGRLEEIRSQANQGVLLREGLSLVIAGRPNAGKSTLINNLAGRDVAI
MNME_ALCBS      -SDGKVASDLRAVRKQCLRVLGEANQGRLVREGMTLVIAGKPNAGKSSLMNALAGFDAAI
MNME_METCA      -DDATLGHEITGLLDELDTIDTKAHQGALLREGLTTVIAGRPNVGKSSLLNALAGRDLAI
MNME_NITOC      -ERGMVAERLKEIQSTLQSIHRSARQGALLREGVRVVLAGRPNVGKSSLHNRLAGFEAAI
MNME_ALKEH      -ADEAVAGQIGALIDQLQALRDKAGQGRVLRDGMQVVLAGPPNAGKSSLLNALTEDDSAI
MNME_COXBU      -ADERIKETLENLTHQVQEIEKTAKQGALLREGITVVIAGEPNVGKSSLLNLLSGQETAI
MNME_COXBN      -ADERIKETLENLTHQVQEIEKTAKQGALLREGITVVIAGEPNVGKSSLLNLLSGQETAI
MNME_COXBR      -ADERIKETLENLTHQVQEIEKTAKQGALLREGITVVIAGEPNVGKSSLLNLLSGQETAI
MNME_PSYCK      -SDGVIQGKLEQTQEKIQQVLATAKQGQLLRDGIHVVLAGRPNAGKSSLLNRLAGQERAI
MNME_PSYA2      -SDGVIQGKLEQTQEKIQHVLATAKQGQLLRDGIHVVLAGRPNAGKSSLLNRLAGQERAI
MNME_PSYWF      -SDGVIEGKLQRIQQQLTTILSTAQQGQLLRDGVHVVLAGRPNAGKSSLLNSLAGQERAI
MNME_ACIBY      -ADGKILALLEDVQQSVHAVQTSARQGQLLREGLQVVIAGKPNAGKSSLLNALAGVERAI
MNME_ACIBT      -ADGKILALLEDVQQSVHAVQTSARQGQLLREGLQVVIAGKPNAGKSSLLNALAGVERAI
MNME_ACIAD      -ADGKILALLDDVRDSVQQVQTSARQGQLLREGLQVVIAGKPNAGKSSLLNALAGNERAI
MNME_DICNV      -GEGKIREKLVDSLQKTQQLLAQSQQGQLLNDGIHLVLAGKPNAGKSSLLNALLGEERAI
MNME_BORBR      -EKYQARPTLQALTHDLDTLIAQARQGVILREGLHVVLAGKPNVGKSSLLNALAGDDIAI
MNME_BORPA      -EKYQARPTLQALTHDLDTLIAQARQGVILREGLHVVLAGKPNVGKSSLLNALAGDDIAI
MNME_BORPE      -EKYQARPTLQALTHDLDTLIAQARQGVILREGLHVVLAGKPNVGKSSLLNALAGDDIAI
MNME_BORPD      -EKYQARPTLQALAADLATLIAQARQGVILREGLHVVLAGKPNVGKSSLLNALAGDDIAI
MNME_BORA1      -EKYQARPTLDGLRQDLDTLIAQARQGIILREGLHVVLAGQPNVGKSSLLNALAGDDIAI
MNME_CUPPJ      -EASDARGQLATIRNDLGNVLAQARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_CUPNH      -EQSDARGQLATIRTELSGVLAQARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_CUPMC      -EASNARGQLTRIREDLAGVLKQARQGSLLREGLSVVLAGQPNVGKSSLLNALAGSDLAI
MNME_RALSO      -EAADARGQLADIRARLDGVLAQARQGALLREGLHVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURM7      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURMA      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURP6      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURP0      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURMS      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURM9      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURPS      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURP1      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURTA      -EAADARGKLAHIRERLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURCA      -EAADARGKLAKIRAQLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURCH      -EAADARGKLAKIRAQLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURCC      -EAADARGKLAKIRAQLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURL3      -EAADARGKLAKIRAQLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURCM      -EAADARGKLAKIREQLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURA4      -EAADARGKLARIREQLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_BURVG      -EAADARGKLAKIREQLAHVLGDARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_PARXL      -EAADARGKLARIRERLGHVLSEARQGALLREGLSVVLAGQPNVGKSSLLNALAGAELAI
MNME_JANMA      -EKSDARGQLNGIREALQAVFTQASQGALLRDGLNIVLAGQPNVGKSSLLNALAGSDVAI
MNME_HERAR      -EKSDARGQLTNIREALQRVFSQAAQGALLRDGLNIVLAGQPNVGKSSLLNALAGSDVAI
MNME_ACISJ      -RKADASGQLSNLKRSLARVMQRASQGALLREGIKVVIAGQPNAGKSSLLNALAGAELAI
MNME_ACIAC      -RKADAHGQLAALQRTLAEVMGRTRQGALLREGIKVVIAGQPNAGKSSLLNALAGAELAI
MNME_VEREI      -HQADARGQLSRLRQALGAVLQQARQGALLRDGIEVVIAGQPNAGKSSLLNALAGAELAI
MNME_RHOFT      -RQADARGQLSDLQQSLQSVLQKASQGALLREGITVVIAGQPNVGKSSLLNALAGAELAI
MNME_POLSJ      -QKADAQGQLSRLQATLTGVMQRATQGAILREGIKVVIAGQPNAGKSSLLNALAGAELAI
MNME_POLNA      -QQADAQGQLLRLQATLASVLARATQGAILREGIKVVIAGQPNVGKSSLLNALAGAELAI
MNME_LEPCP      -QRADAHGRLARLAERLAGLLDTARQGALLREGLRVVIAGQPNAGKSSLLNALAGAELAI
MNME_METPP      -EKADARGRLARIAEALDAVLARAKQGALLREGLRVVLAGQPNVGKSSLLNALAGAELAI
MNME_NEIMA      -EAADARGKLDGLRRAVDDVLANAQQGAILREGLNVVLVGAPNVGKSSLLNALAGDEVAI
MNME_NEIMB      -EAADARGKLDGLRRAVDDVLANAQQGAILREGLNVVLVGAPNVGKSSLLNALAGDEVAI
MNME_NEIM0      -EAADARGKLDGLRRAVDDVLANAQQGAILREGLNVVLVGAPNVGKSSLLNALAGDEVAI
MNME_NEIMF      -EAADARGKLDGLRRAVDDVLANAQQGAILREGLNVVLVGAPNVGKSSLLNALAGDEVAI
MNME_NEIG1      -EAADARGKLDGLRRAVDDVLANAQQGAILREGLNVVLVGAPNVGKSSLLNALAGDEVAI
MNME_CHRVO      -KQADAIGRLRRLRAQLVGVQATAKQGAILREGMHVVLVGQPNVGKSSLMNALAGDDIAI
MNME_AZOSB      -DKGRALPRLAAIRTQLDALLDRARQGALLRTGMNVVLVGRPNVGKSSLLNQLAGEDRAI
MNME_AROAE      -ENARALERLDAIRVKLERVLERARQGALLRSGMNVVLVGQPNVGKSSLLNCLAGDERAI
MNME_DECAR      -KAANAFGRLERLQLKLAEIFDRAGQGKLLQSGLHVVLAGQPNVGKSSLLNRLAGDDLAI
MNME_NITEU      -QSAHAAEQLATIRAKLEQVLVASRQGNLLQEGIKVVLAGQPNVGKSSLLNRLAGDEVAI
MNME_NITEC      -QSAHAVEQLASIQTKLEQVLSASRRGNLLQEGIKVVLTGQPNVGKSSLLNRLAGDEIAI
MNME_NITMU      -SGRELEFRLEHIRQQLEQVFSAARQGSLLREGIWIALVGQPNVGKSSLLNRLAGEEVAL
MNME_THIDA      -EQADAFGRLKAIGTSVAAVRSQARQGVLLREGLTVVLVGQPNVGKSSLLNRLAGFDAAI
MNME_METFK      -SQGRVAEKLAEVTAGLEAVFREARQGNLLREGLQVVLVGQPNVGKSSLMNQLAGEEVAI
MNME_POLAQ      -ENAQARERLAAVKKKLEALQAGAKQGKILRDGIQLVLAGAPNVGKSSLLNRLAGEEVAI
MNME_FRATF      -EDQKIHSSLEEIYKVILAIKNSCKQGVILAEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_FRATH      -EDQKIHSSLEEIYKVILAIKNSCKQGVILAEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_FRATO      -EDQKIHSSLEEIYKVILAIKNSCKQGVILAEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_FRATT      -EDQKIHSSLEEIYKVILAVKNSCKQGVILAEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_FRAT1      -EDQKIHSSLEEIYKVILAVKNSCKQGVILAEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_FRATW      -EDQKIHSSLEEIYKVILAVKNSCKQGVILAEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_FRATN      -EDQKIHSSLEEIYKVILAVKNSCKQGVILAEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_FRAP2      -EDQKIHNSLQDIYKTILDVKNSCKQGAILVEGITLILVGKPNAGKSSLLNALAGKESAI
MNME_RUTMC      -QFEQVKLKAKGIKQAVETILKSATQGVILREGLNVVIAGKPNAGKSSLLNALTQESSAI
MNME_VESOH      -QFDQVKCKIKDIKQTIETILKSATQGIILREGLNVAIAGKPNAGKSSLLNALTQESSAI
MNME_XANAC      -GGNQVRDGLGQARNVLAQLLRDAERGRKLRDGLHAVLIGPPNAGKSSLLNALAGSDRAI
MNME_XANC5      -GGNQLRDGLGQARNVLAQLLRDAERGRKLRDGLHAVLIGPPNAGKSSLLNALAGSDRAI
MNME_XANOM      -GGNQVRDGLTQARTLLAQLLRDAERGRTLRDGLHAVLIGPPNAGKSSLLNALAGSERAI
MNME_XANOR      -GGNQVRDGLTQARTLLAQLLRDAERGRTLRDGLHAVLIGPPNAGKSSLLNALAGSERAI
MNME_XANCP      -GGAQVREELTRTRALLAQLLRDAERGRKLRDGLHAVLIGPPNAGKSSLLNALAGSDRAI
MNME_XANC8      -GGAQVREELTRTRALLAQLLRDAERGRKLRDGLHAVLIGPPNAGKSSLLNALAGSDRAI
MNME_XANCB      -GGAQVREELTRTRALLAQLLRDAERGRKLRDGLHAVLIGPPNAGKSSLLNALAGSDRAI
MNME_XYLFA      -DRAQIRTSLQTLNVELTQLLRDAEHGKRLCDGLYTVLVGPPNVGKSSLLNALIGSDRAI
MNME_XYLFT      -DRAQIRTSLQTLNVELTQLLRDAEHGKRLCDGLYTVLVGPPNVGKSSLLNALIGSDRAI
MNME_BLOFL      -SYQHIYNTLQNIIDNTNQICKLTHSGVLLRDGIKVVIAGKPNAGKSSLFNSLINKDRAI
MNME_BLOPB      -PYEDIKKKLRNIISDVQKMYKSTYHGVLLREGIKIVIAGKPNAGKSSLFNALVGIDRAI
MNME_BAUCH      -IDKKIIANLDQAILSINKIRTAAYQGCILREGIKIVITGKPNVGKSSIINALAGHEVAI
MNME_WIGBR      -SIECIKHDLEKIILNINKIQCSFNRGAILKEGSKIVIIGKPNSGKSSIFNILSGNNNAI
MNME_BUCCC      -IQKNIKKKLSFIIKMITNLLDETHKNYIFSNTIKIVIAGPPNVGKSSLLNFLSKEKVSI
MNME_BUCAI      -MQDIINIKFRELHDKFLKLKATVLKGSLLREGKKIVIAGLPNSGKSSLLNILSYSDRAI
MNME_BUCMP      -LKSLIYIKLKELEEKFIKTKKVISEGSLLKEGKKIVIAGPPNAGKSSLLNALSHSNRAI
MNME_BUCAP      -FNIFIMSNFEKLNDKFLKIKNIVSEGSLIREAKRIVIVGPPNAGKSSLLNVLSCRDRAI
MNME_BUCBP      -LDVFIEHEINRIISRIKKIRNTAIQGSVLREGIKVVISGAPNSGKSSLLNALSLTNRAI
MNME_CAUVC      -VAERARPGLRQLSAELNAALADVSRGRRVRDGFRIALIGAPNAGKSTLLNGLAERDAAI
MNME_CAUSK      -VAARARPGLEALEAEIGAALVDASRGRRVRDGYRIALVGAPNAGKSTLLNALVERDAAI
MNME_MARMM      -LSHAAYEPLSELIGSMFEHLDDGRRGERIRIGFSIVLIGAPNAGKSSLLNCLARRDAAI
MNME_RHORT      -VETAVRGGIGALADALAGHLDDRHRGERLRDGLQVAVVGAPNVGKSSLVNRLARREAAI
MNME_MAGSA      -LLEQSVGEVRSLRREMEVHLDERRNGERLRDGIHITILGAPNAGKSSLLNRLAGREAAI
MNME_PARL1      -LIAKLGPDIEALETEIAAHLDDGRRGEQLRDGVEVAIVGPPNAGKSSLLNRLAGREAAI
MNME_NITWN      -LARPALEKIAQLRREIEQTLAASARGERLRDGLTVAIAGPPNAGKSTLLNRLARREAAI
MNME_NITHX      -LLKPAMEKIARLRREIEETLAASAQSERLRDGMTVAIAGPPNAGKSTLLNRLARREAAI
MNME_BRASO      -LLAPALSRVQQLLLEIEAVLAAQGRAERLRDGLTVVIAGPPNAGKSTLMNQLARREVAI
MNME_BRASB      -LIAPALAWIRQLLAEIEEVLAAQGRAERLRDGLTVVIAGPPNAGKSTLMNQLARREVAI
MNME_BRADU      -LRAPAVKAIKALHVEITEVLAAQGHSERLRDGMVVAIAGEPNVGKSTLMNQLARRDVAI
MNME_RHOP5      -LLAPALAKIEALAGEIEALLAAQGRSERLRDGLVVAIVGPPNVGKSTLMNQLARREVAI
MNME_RHOPS      -LMAPALQTIAALHDEIAEVLAAQGRSERLRDGMVVAIAGPPNVGKSTLINRLARREVAI
MNME_RHOP2      -LMAPALRTIATLHGEIAEVLAAQGKSERLRDGLVVAIAGPPNVGKSTLINRLARREVAI
MNME_RHOPA      -LMGPARAKIAELSAEIAEVLAEQGRGEKLRDGMVVAIAGPPNVGKSTLINRLARREVAI
MNME_RHOPB      -LIAPAKAKIEILLDEIEDVLAQEGRSEKLRDGLVVAITGPPNVGKSTLMNQLARREVAI
MNME_METPB      -LDAALAGRAAALRDAIRAALADGRRGERLREGFCVVLAGAPNAGKSTLLNALSGRDAAI
MNME_METRJ      -LDAALFDRAARLRDAVAATLRDGHRGERLREGFTVVLAGAPNSGKSTLLNALSRRDVAI
MNME_METS4      -LSASGLAAAARVRDAILAALAEGRRGERLREGFVVVLAGPPNAGKSTLLNALARREAAI
MNME_AZOC5      -LTGPARAEAAALCTELTTALADADRGERVRDGFIIAIAGPPNAGKSTLLNRLAGREAAI
MNME_BEII9      -TSRRVAALIEPVLADLRAELGQARAGERIREGLSIVIMGPPNAGKSTLLNALARREVAI
MNME_RHIEC      -VSDMVWTDMKRLRDDIGLHLKSASAGEIIRDGFKVVIAGAPNAGKSSLLNALARRDVAI
MNME_RHIL3      -VSDAVWADMAKLRSDIGDHLAAASAGEIIRDGFKVVIAGAPNAGKSSLLNALARRDVAI
MNME_SINMW      -VSAAIWTDIGRLREEIDEHIARAGVAEIIRDGLKIVIAGEPNAGKSSLLNALAQRDIAI
MNME_RHIME      -VSAVIWEDVGRLRQEIDGHIARAGLAEIIRDGLKIVIAGEPNAGKSSLLNALARRDIAI
MNME_AGRFC      -VATQVWEAMAALKGEINAHLQGGGNGEIIRDGFKVALVGEPNAGKSTLLNALSGREVAI
MNME_BRUC2      -VSMQVWQQLSALKHEIEHHIASGKRAAMLRDGLHVVIVGAPNAGKSSLLNFLAGRDVAI
MNME_BRUSU      -VSMQVWQQLSALKHEIEHHIASGKRAAMLRDGLHVVIVGAPNAGKSSLLNFLAGRDVAI
MNME_BRUA2      -VSMQVWQQLSALKHEIEHHIASGKRAAMLRDGLHVVIVGAPNAGKSSLLNFLAGRDVAI
MNME_BRUAB      -VSMQVWQQLSALKHEIEHHIASGKRAAMLRDGLHVVIVGAPNAGKSSLLNFLAGRDVAI
MNME_BRUME      -VSMQVWQQLSALKHEIEHHIASGKRAAMLRDGLHVVIVGAPNAGKSSLLNFLAGRDVAI
MNME_BRUO2      -VSMQVWQQLSALKHEIEHHIASGKRAAMLRDGLHVVIVGAPNAGKSSLLNFLAGRDVAI
MNME_BRUSI      -VSMQVWQQLSALKHEIEYHIASGKRAAMLRDGLHVVIVGAPNAGKSSLLNFLAGRDVAI
MNME_OCHA4      -VSEQVWQSLALLKSEIENHIASGKRASMLRDGLHVVIVGAPNAGKSSLLNFLAGREVAI
MNME_BARHE      -VSDKVWKDVENLCISLREHIAEGERASILRDGFKIVIVGAPNSGKSSIMNRLAGKPVAI
MNME_BART1      -ISDKIWKDVEDLCTSLREHIREGERASILRDGLKIVIAGAPNSGKSSIMNRLAGRSVAI
MNME_BARQU      -ISDKVWEDVEELCISIRDHIAQGERANILRDGLKIVIAGAPNSGKSSIMNRLAGKSVAI
MNME_BARBK      -SSDKVWQNMQELSDSLCEHIAEGERANILRDGIKVVIVGVPNSGKSSIINRLAGRPVAI
MNME_CHESB      -AGATVWEDIRRLRQEIVEHASSYRKAEIIRDGFQIVILGAPNAGKSSLLNALARRDVAI
MNME_RHILO      -VSDTVWSDVRAMIGEIDRHIAGFHAAEIIREGFEVVILGAPNAGKSSLFNALARRDAAI
MNME_HYPNA      -TARPILSRLEKIMSEIETALGDRGVGERIRDGFRVAIVGPPNAGKSSILNRLARREAAI
MNME_GRABC      -VDAALRTDLLLLRQEMAQALNEGAKAEKLREGLIFTILGKPNAGKSSLLNSLASRDAAI
MNME_ACICJ      -VEAAMLASMARLRDEIVAAIGAGLAAERLREGVEIVVLGAPNAGKSTLVNALAGEEVAI
MNME_GLUOX      -VEDGLIEELSKLQTEMSAHLQDN-RGELMRQGLTVVIAGSPNVGKSSLLNALSGTDAAI
MNME_ERYLH      -LAPAFYTDVSTLADELGEWLERP-QVERLRDGVRVVFAGPPNAGKSTLFNALLQSEAAI
MNME_NOVAD      LLPPHFAADCISLACSLNTWLDRP-RAEPLKEGFRVVLAGPPNAGKSTLFNALVEHEAAI
MNME_SPHWW      -LDPGFAAELAALDAEVVRWRGRL-PVERLRDGVRVVLAGPPNAGKSTLLNALAGREAAI
MNME_SPHAL      -VAQRVSEGMAALAGELGEWLARP-AAEVIAEGLSVVIAGPPNAGKSTLINALAQRELAI
MNME_ZYMMO      -HLAVMKDKIAALIAEHRQFENRP-TMERLRDGLRVVLAGRPNAGKSTLINALTGQDIAI
MNME_RUEST      -VTPEVKQLLSGVLHDIEKEVDGVAIAERIREGFEVAIVGSPNVGKSTLLNALAGRTAAI
MNME_RUEPO      -VSPEVRALLAEVRADLEHEIAGVRIAERIRTGFEVAIIGPPNAGKSTLLNMLAGREAAL
MNME_ROSDO      -VTPEVTSLLEDVSSDVRTEVAGTHVAERIRSGFEIALVGAPNAGKSTLLNKLAGRDAAI
MNME_RHOS4      -VTPEVLTLIDGLLADLRREVDGSRIAERIRDGFEVAIVGAPNAGKSTLLNALARREAAI
MNME_RHOS1      -VTPEVLTLIDGLLADLRREVDGSRIAERIRDGFEVAIVGAPNAGKSTLLNALARREAAI
MNME_RHOS5      -VTPEVRGLLERLISDLKREVDGSRVAERIRDGFEVAIIGAPNAGKSTLLNALAQREAAI
MNME_DINSH      -VYPEVQELLGRVSQNLAAESAGTHAAERIRHGFEVAILGAPNVGKSSLLNRLAGREAAI
MNME_JANSC      -VVPEVQSILMGLDTDLAKEVTGAVVAERLHDGFEVAILGAPNAGKSTLLNVLADREIAI
MNME_PARDP      -VPEEALDLIKAVRSDIQGMLASYPATERLRQGYEVAIIGPPNAGKSTLLNRIGQREIAL
MNME_RICAH      SVLNDVNNTHKNLVNEISNYLNDNRRGELLNSGLKLAIVGPPNTGKSSLLNFLMQRDIAM
MNME_RICFE      SVLNDVNNTHKNLVNEISNYLNDNRRGELLNSGLKLAIIGPPNVGKSSLLNFLMQRDIAI
MNME_RICRO      TVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAI
MNME_RICRS      TVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAI
MNME_RICCN      TVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAI
MNME_RICM5      TVLNEVTNTHTILVNTISEYLNDNRKGELLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAI
MNME_RICCK      SILNKVNNTHTNLINEISNYLNDNRRGELLNSGLKLAIIGPPNAGKSSLLNFLMQRDIAI
MNME_RICPR      SILNDVNNTHKNIVNEISNYLNDNRRGELLNNGLKLAIIGPPNTGKSSLLNFLMQRNIAI
MNME_RICTY      SILNDVNNTHKNIVNEISNYLNDNRRGELLNNGLKLAIIGPPNTGKSSLLNFLMQRNIAI
MNME_RICB8      SVLKDVTNTHKTLINTISEYLNDNRKGELLRSGLKLAIIGPPNAGKSSLLNFLMRRDIAI
MNME_RICBR      SVLKDVTNTHKTLINTISEYLNDNRKGELLRSGLKLAIIGPPNAGKSSLLNFLMRRDIAI
MNME_ORITB      SVLREAKSIINNLTREISNHLGDTRKGEVLRHGIVLAITGETNTGKSSLLNYLTMREAAI
MNME_ANAMM      QILRSVHDRVKELHNSLERHLDDGHRGERLRHGMRVAILGKPNVGKSTLFNHLARRDMAI
MNME_ANAPZ      CVLGGIYNNIEKLCAVLGQYLNDGHRGERLRSGVRVVILGPPNAGKSTLFNSIARRNAAI
MNME_EHRCJ      AALANIGYLLNNLQESLECHLNDDRKGERLRQGIYIAIVGEPNSGKSTLFNHLAKRDIAI
MNME_EHRCR      SAIANIDYLLNNLQKSLESHLNDDRRGERLRQGIYVTILGEPNSGKSTLFNHLAKRDIAI
MNME_EHRRW      SAVENISFLLDKIKESLENHLNDGRKGEILRQGIYVAILGEPNSGKSTLFNHLAKRDIAI
MNME_EHRRG      FAVENISFLLDKIKESLENHLNDGRKGEILRQGIYVAILGEPNSGKSTLFNHLAKRDIAI
MNME_WOLTR      NELEKINDEVQTLVQSIQEHLNDNRRGERLREGLHIVITGEPNVGKSTLFNFLARRDIAI
MNME_WOLPM      SELEKINNEVQSLVQLIQEHLNDNRRGERLREGLHIVITGEPNVGKSTLFNFLAKRDIAI
MNME_NEOSM      TVLAEIQQSIVAIQCDISRYLADGKVGEKIREGFSVVIVGKPNVGKSTLFNYLAKRDLAI
MNME_PELUB      DILKNIKKISNEVILNIKKILDDQKVGERIREGFKIAIIGPTNAGKSSLLNHLSNRDVAI
MNME_DEIRA      -----RAAPLLGAQSALEELLASAHAGRISTRGARLALIGRPNAGKSSLLNALLGYERSI
MNME_DEIGD      -----RTVPLAAAEAELHALVGTARAGQVATRGARLALIGRPNAGKSSLLNALLGYERSI
MNME_THET8      -----AERTIREVLAEVEALLAQAKASRLAQKGARLALIGAPNAGKSSLLNALLGYERAL
MNME_THET2      -----AERTLREVLAEVEALLAQAKASRLAQKGARLALIGAPNAGKSSLLNALLGYERAL
MNME_HALHL      ---PELAAEIEALGSELAEIRRRAAAGVRFGEGIRVALVGPPNAGKSSLLNVLSGEEAAI
MNME_MYXXD      ----DVGERVTALRAQAETLLAEVGRGRLVRRGARVALFGPVNAGKSTLFNRLVGEARAL
MNME_RHOBA      ---EALIQRLDELRSLLLQTRSQLSDRGGASSTIRVVLRGLPNAGKSRLLNVLSRTESAI
MNME_AQUAE      -TKEQVIQMVDKVIEGINELLKTAKTGKFIREGVKLAIVGRPNVGKSSLFNALLKEERAI
MNME_MAGMM      -SEGGLLDRLAYVHAGIKKMLGTAELGRQMRDGFELAIVGRPNVGKSSLFNALSGEDRAI
MNME_KORVE      -PAKEAIARIAEVHEPLAKLKEGFAFGKVVHEGLTLAIVGRPNVGKSSLFNRLVERDRAI
MNME_SOLUE      -PPAEILRRLSPVLEGTERLAASFQYGGLVHQGLTLAIVGRPNVGKSSLFNRLLEQDRAI
MNME_CHLTR      -IMEAL--------SITDELLSSFDEGQRLAQGTSIVLAGLPNAGKSSILNALTQKNRAI
MNME_CHLTB      -IMEAL--------SITDELLSSFDEGQRLAQGTSIVLAGLPNAGKSSILNALTQKNRAI
MNME_CHLT2      -IMEAL--------SITDELLSSFDEGQRLAQGTSIVLAGLPNAGKSSILNALTQKNRAI
MNME_CHLTA      -IMEAL--------SITDELLSSFDEGQRLAQGTSIVLAGLPNAGKSSILNALTQKNRAI
MNME_CHLMU      -ITEAL--------TITQELLSSFDEGQRLAQGTSIVLAGLPNAGKSSILNALTQKNRAI
MNME_CHLCV      -LNEAM--------LIIEDLISSFDEGQRLAQGTSIVLAGHPNVGKSSLLNALTNKNRAI
MNME_CHLFF      -LNEAL--------VIIEDLISSFDEGQRLAQGTSIVLAGHPNAGKSSLLNALTNRNRAI
MNME_CHLAB      -LHEAI--------LIIDDLIASFDQGQRLAQGTSIVLAGHPNAGKSSLLNALTNKNRAI
MNME_CHLPN      -IQNAL--------HIVEDFISSFDEGQRLAQGTSLILAGKPNVGKSSLLNALLQKNRAI
MNME_PARUW      DLERTA--------KDMEKLVNSFHNGKILHDGLSICLIGCPNVGKSSLMNALLDKDRAI
MNME_OPITP      ELEMAR--------HEAEQLIATQRYGNLIRDGIKTVIVGAPNVGKSSLLNRLVGRERAL
MNME_BDEBA      RLKKIE--------AGLKELVATFKVGRLLKDGFRIVLTGLPNVGKSSLLNLFLEDERAI
MNME_DESHY      RISKGL--------ELARDLLDGSKTGRILREGMLTVIVGQPNVGKSSLLNALMGEERAI
MNME_ALKMQ      LLKQSM-----EIEKKIKVLLETADTGKILREGLNTVIVGKPNVGKSSLLNALLKESRAI
MNME_ALKOO      LLNKSL-----EVEGDIQKLLDTADTGKIIREGLSTVIVGKPNVGKSSLLNALVRESRAI
MNME_CLOD6      LKEKTD-----ELKKDIKKLYDTAESGKILREGLKTVIVGKPNVGKSSLLNSILGENRAI
MNME_FINM2      VLNEGK-----EVLDKLKKLSESANRGRIIRDGINTTIIGKPNVGKSSLLNALLKENRAI
MNME_FUSNN      LVENLK-----KASAEIKDLVSSYDKGKIIKDGIKTAIIGKPNVGKSSILNSLLREDRAI
MNME_CLOB1      IKVDLK-----EIINKIDNLISASEEGKILREGLNTVIVGKPNVGKSSLLNALINENKAI
MNME_CLOBK      IKVDLK-----EIINKIDNLISASEEGKILREGLNTVIVGKPNVGKSSLLNALINENKAI
MNME_CLOBH      IKVDLK-----EIINKIDNLISASEEGKILREGLNTVIVGKPNVGKSSLLNALINENKAI
MNME_CLOBL      IKVDLK-----EIINKIDNLISASEEGKILREGLNTVIVGKPNVGKSSLLNALINENKAI
MNME_CLOBM      IKVDLK-----EIINKIDNLISASEEGKILREGLNTVIVGKPNVGKSSLLNALINENKAI
MNME_CLOK5      IYLKIN-----KILDEINYILSNAEEGKIVREGLSVVIVGKPNVGKSSLLNSLIEENKAI
MNME_CLOTE      VQEKIE-----KIIEELERLLDTSEEGKIIREGLDVVIVGKPNVGKSSLLNALLSEKRAI
MNME_CLONN      GRESVS-----KLLDEIDSLLDHADEGKILREGLNTVIVGKPNVGKSSLLNALLMETRAI
MNME_CLOAB      VSKDLN-----DILKEIDELILSADEGKILREGLNTVIIGKPNVGKSSLLNLLLDEKRAI
MNME_CLOPE      VKEDVI-----TLRGKVNNLIDTADEGKLIRDGLSMVIVGKPNVGKSSLLNALLNEKRAI
MNME_CLOP1      VKEDVI-----TLRGKVNNLIDTADEGKLIRDGLSMVIVGKPNVGKSSLLNALLNEKRAI
MNME_CLOPS      VKEDVI-----TLRGKVNNLIDTADEGKLIRDGLSMVIVGKPNVGKSSLLNALLNENRAI
MNME_CLOB8      IKDGIE-----NTNSKIETLLSNADAGKIVRDGLNIVIVGKPNVGKSSLLNALLRENRAI
MNME_LACP7      LRDNVI-----GSIKELSELINTSENGRMIKEGIRTVILGRPNAGKSSLLNLMVGEERAI
MNME_THEP3      ILETAK-----EIVEDIDKLIASSESGRIIREGLKTAIIGKPNVGKSSLLNALLKENRAI
MNME_THEPX      ILETAK-----EIVEDIDKLIASSESGRIIREGLKTAIIGKPNVGKSSLLNALLKENRAI
MNME_CALS4      IKRRAK-----DILNDIEYLIASSESGRIIREGLKTAIIGKPNVGKSSLLNALLKQNRAI
MNME_HUNT2      VYEEIG-----KIKEKLCDIVKSFERGRIIREGIDAVIIGKPNVGKSSLLNELSGKSKAI
MNME_CARHZ      ALKNID-----EIINDVRRLLSSYERGRILREGITAVIAGKPNVGKSSLLNALLRKKRAI
MNME_DESRM      ISKECN-----SLIKEIEHLLAYADTGKIYREGLKTVIVGKPNVGKSSLLNALLHEQRAI
MNME_PELTS      ILRSGE-----DLIEEIKEIVRRAEAGKIYREGISTVIIGRPNVGKSSLLNALLRENRAI
MNME_CALS8      IEKSID-----TALEMIYRLLKTYETGRAIKSGIYTVIVGRPNVGKSSLLNRLLKEERSI
MNME_SYNWW      AQGKLQ-----EVKNRIDKLLLAGERAEIYREGINVAICGKPNVGKSSLLNALLRKEKAI
MNME_NATTJ      LKHRIDN----AKVD-INNLIASYDKGKIIREGIKTVIVGRPNVGKSSLLNLLLGEERAI
MNME_DESPS      IDLQLKT----EVIAPVKELLAGVDRGRIYRQGISMVIAGRPNVGKSSLLNAVLQEERAL
MNME_MOOTA      -DLRRI-------LAGVDRLLATWEEGRLLTEGLKVAIVGRPNVGKSSLLNALLNQERAI
MNME_DESAP      GQLAAL-------EAGCVELLEGAEAGRVYRDGLGVAIVGKPNVGKSSLLNALLREKRAI
MNME_ROSS1      TPLTAA-------VQALDALVASAQHGIIYRQGARAALIGRPNAGKSSLLNALLRVDRAI
MNME_ROSCS      TPLTAA-------VQALDTLVATAEQGIIYRQGARATLVGRPNAGKSSLLNALLRIDRAI
MNME_CHLAA      GPIEQA-------LATVERLLAGADQGMVLRNGARVVLVGRPNVGKSSLLNALLRVERAI
MNME_SYMTH      AGCAWC-------LGEVERLLGGARTGRILREGLRAVLAGRPNVGKSSLLNRLVRENRAI
MNME_HELMI      TDLMQI-------QRQIGDMLERSRTGRVLREGWRTVIVGRPNVGKSSLMNALLDEQRAI
MNME_GEOSL      VHVRKA-------AETVGELIAGFDEGRVLREGVAVLIAGKPNVGKSSLLNTLLQEKRAI
MNME_GEOMG      AKAREA-------SGRIEELLEGFDEGRVLRDGVSVLIAGKPNVGKSSLLNTLLQEKRAI
MNME_GEOUR      AHVDCS-------LTELETLLAGFNEGKVLRDGVSVVIAGKPNVGKSSLLNTLLREKRAI
MNME_PELPD      SSVEGA-------RTHIRRLLEDFNEGRLLREGISVLIIGKPNAGKSSLLNRLLNENRAI
MNME_PELCD      ASAGAL-------IADMDRIIDTFESGRVLREGLRVLIFGKPNVGKSSLMNGLLGEARAI
MNME_SYNAS      SKLE-------RLSSDLEALLSTYDQGKVYRHGATVVIAGKPNTGKSSLLNCLLQEKRAI
MNME_SYNFM      DRARFVTRLDGELIPALSAALESAERSRALREGVSLVLAGKPNVGKSSLLNALVGRDRAI
MNME_DESVH      FLAEIE-----AVRQGVVELSAGYARTRCWQDGALVVLAGQVNAGKSSLMNALLGRRRAI
MNME_DESVV      FLAEIE-----AVRQGVVELSAGYARTRCWQDGALVVLAGQVNAGKSSLMNALLGRRRAI
MNME_DESAG      FMHAVE-----ETADAIRKLIGNYERARCWREGAQVVLAGQVNAGKSSLLNALLGRKRAI
MNME_LAWIP      FINGLL-----EIHEIIQKLIHAAERSRCWKEGVTVALAGAVNAGKSSLLNALLGKERAI
MNME_NOSS1      SDIENI-------AAEISQLLATKDKGELLRTGLKVAIVGRPNVGKSSLLNAWSQSDRAI
MNME_TRIV2      SDIENI-------AAEISQLLATKDKGELLRTGLKVAIVGRPNVGKSSLLNAWSQSDRAI
MNME_TRIEI      QKLDDI-------LVDLSMVLATASRGELLRTGLKVAIIGRPNVGKSSLLNAWSHSDRAI
MNME_ACAM1      AELQDI-------HATLQAILATADQGELLRNGLTVAIIGRPNVGKSSLLNAWCRCDRAI
MNME_SYNY3      QQLQNL-------YQQLEDILNTAQRGELLRTGLKVAIVGQPNVGKSSLLNAWSRTDRAI
MNME_MICAN      HSIEQV-------FCQVNLILATAERGELLRSGLKVAIVGRPNVGKSSLLNAWSRSDRAI
MNME_SYNP2      RDLTQV-------LEKVAQILQTSDRGELLRTGLKVAIVGRPNVGKSSLLNAWSRSDRAI
MNME_SYNE7      AQLTAA-------GADMQAILSTADRGELLRTGLKIAIVGRPNVGKSSLLNAWSRCDRAI
MNME_SYNP6      AQLTAA-------GADMQAILSTADRGELLRTGLKIAIVGRPNVGKSSLLNAWSRCDRAI
MNME_THEEB      EQIRQL-------QHQVEAFLATAERGALIRTGLKVAIVGRPNVGKSSLLNAWSRSDRAI
MNME_SYNJA      ARLQDI-------QAQMQALLATAERGQLLRTGVKVAIVGRPNVGKSSLLNAWSGQDRAI
MNME_SYNJB      ARLQAI-------QTQIQALLATAERGQLLRTGVKVAIVGRPNVGKSSLLNAWSGQDRAI
MNME_GLOVI      ANIGQS-------LAHARRLMATSTRGELLRTGLKVAIVGRPNVGKSSLLNAWSRTDRAI
MNME_PROM1      NEIVAI-------KKDLNELIDNAKRGSWVRSGLKVALAGKPNVGKSSLMNRLSKQEKAI
MNME_PROMT      NEIVAI-------KKDLNELIDNAKRGSWVRSGLKVALTGKPNVGKSSLMNRLSKQEKAI
MNME_PROMA      TDLMLI-------RAELKQLINDAKQGSLIRNGLKVALVGLPNVGKSSILNLLSKHERAI
MNME_PROM3      LELQCV-------RRELEQLVEDAKRGDVLRQGLQVALVGRPNVGKSSLLNRLSRRERAI
MNME_PROMM      LELQCV-------RRELEQLVEDAKRGDVLRQGLQVALVGRPNVGKSSLLNRLSRRERAI
MNME_SYNSC      QQLQAV-------RLELQQLVRDGERGDALRQGLRVALVGRPNVGKSSLLNRLSRRERAI
MNME_SYNPX      DGLQQV-------RQALLTLVADGERADALRSGLRVALVGRPNVGKSSLLNRLSRRERAI
MNME_SYNS9      NELQAV-------RVELLALVADGERGDALRHGLRVALVGRPNVGKSSLLNRLSRRERAI
MNME_SYNPW      EELQRV-------RGALQQLVKDGQVGAALRQGLRVALVGRPNVGKSSLLNRLSRRERAI
MNME_SYNS3      QELQAV-------RLELLTLVADGERGSVVRHGLRVALVGRPNVGKSSLLNLLSRRERAI
MNME_SYNR3      TALRDV-------QQALDQLVLDGQQAQLLRDGLRVAIIGRPNVGKSSLLNALSGHERAI
MNME_PROMS      KNIKKV-------KEKIELLIENAKRNSYIHNGISIALIGKTNVGKSSLLNLLAKKEKAI
MNME_PROM0      KNIKKV-------KEKIELLIENAKRNSYIHNGISIALIGKTNVGKSSLLNLLAKKEKAI
MNME_PROM2      KNIKKV-------KEKIELLIENAKRNSYIHNGISIALIGKTNVGKSSLLNLLAKKEKAI
MNME_PROM9      KNIKKV-------KEKIELLIENAKRNSYIHNGISIALIGKTNVGKSSLLNLLAKKEKAI
MNME_PROM5      RSIKNI-------KEKIEILIENTKRGASIHNGISIALIGKTNVGKSSLLNLLSKKEKAI
MNME_PROMP      RNIKII-------KEKIKILIENSKRGAHIHNGISIALIGKTNVGKSSLLNLLSKKEKAI
MNME_CYACA      STIQSS-------LLDIKDLISSYNKVSKLNEGTKVCIIGKPNVGKSSLLNAIAKRECSI
MNME_CYAM1      NSLTNI-------INQIQNLLNTPSKFYRY--GIQVALLGPANAGKSTLFNALIGEERSI
MNME_BACFR      -----LRRLADEIEEVIARLANSFSVGNVIKNGVPVAIIGETNAGKSTLLNVLLNEDKAI
MNME_BACFN      -----LRRLADEIEEVIARLANSFSVGNVIKNGVPVAIIGETNAGKSTLLNVLLNEDKAI
MNME_BACTN      -----LRKLADEIEQVISRLVHSFNVGNAIKNGVPVAIIGETNAGKSTLLNVLLNEDKAI
MNME_BACV8      -----LSSLATHIEQVIARLAHSFSVGNAIKNGIPVAIIGETNAGKSTLLNALLNEEKAI
MNME_PARD8      -----LRTLADHIEQVISKLAQSFSVGNAIKNGIPVAIIGETNAGKSTLLNALLNEDKAI
MNME_PORGI      -----LLALCDQIELKLKKLIDSYRLGNAVKRGIPVAIVGTTNVGKSTLLNTLLGEERAI
MNME_FLAJ1      -----FHELLNRIEFVLKRLIDSFAVGNVIKNGIPVAIVGEPNVGKSTLLNALLNEERAI
MNME_FLAPJ      -----FDDLLNRIEFVLKRLIDSFAVGNVIKNGIPVAIVGEPNVGKSTLLNTLLNEERAI
MNME_GRAFK      -----FKDLVSKIQTVLKRLLDSFATGNVLKNGIPVAIVGEPNVGKSTLLNALLNEERAI
MNME_CYTH3      -----LRKLIHEIKRVIDRLIHSFSLGNVIKNGVPTVIIGKPNAGKSTLLNTLLNEEKAI
MNME_SALRD      -----LEDLLDETEEILGDLLDTYPTGEKLKDGVQVVIGGRPNAGKSTLLNALVGHDRAI
MNME_CHLTE      -----LTMQIETLRSEVNRLIDSYQHGRIVSEGVSTVIAGKPNAGKSTLLNTLLGQERAI
MNME_CHLPD      -----LRVEIASLQSEVARLVDSYQHGRLLTEGVATVIAGRPNAGKSTLLNTLLGEERAI
MNME_CHLPM      -----LRLEVGRLQGEILRLVESYREGHLLTEGVAAVIAGRPNAGKSTLLNALLGHERAI
MNME_PELLD      -----LRGEVIRLQTELSGLVDSYQHGRLLSEGVSTVIAGRPNAGKSTLLNKLLGEERSI
MNME_CHLCH      -----LREDVQRLQGEINRLLDSYQHGRLLKEGVATVLVGSPNAGKSTLLNALLGEERSI
MNME_BORAP      -----PFDLILNSKVELKKLIDSYKVYEKIDHGITLVLAGSVNAGKSSLFNLFLKKDRSI
MNME_BORBU      -----PFDLILSSKAELKKLINSYKVYEKIDNGVALVLAGSVNAGKSSLFNLFLKKDRSI
MNME_BORBP      -----PFDLILNSKAELKKLINSYKVYEKIDHGVTLVLAGSVNAGKSSLFNMFLKKDRSI
MNME_TREPA      -----DMRELEPLVERLRRLRACWQERALQRTGVRIVLGGCPNAGKSSLFNALLGQDRAI
MNME_TREDE      -----SPDLILRIIEPLKDLADSWAAEKIFIQGAKVVLAGKTNAGKSSLFNALLKEDRAI
MNME_LEPBJ      --LEERKVRIEGVKTFCQTVIAKSNSAEKVIQQLRIVLYGEPNTGKSSLMNVLLGKDRSI
MNME_LEPBL      --LEERKVRIEGVKTFCQTVIAKSNSAEKVIQQLRIVLYGEPNTGKSSLMNVLLGKDRSI
MNME_LEPIN      --LEERKTRIENVKSLCQTLISKSSSAEKLIQQFRIVLYGEPNTGKSSLMNVLLGKERSI
MNME_LEPIC      --LEERKTRIENVKSLCQTLISKSSSAEKLIQQFRIVLYGEPNTGKSSLMNVLLGKERSI
MNME_LEPBA      --LEERKNRMVALKNLCSKLIKDSERAESYILQSTVVLYGEPNTGKSSLMNLLIGKDRSI
MNME_LEPBP      --LEERKNRMVALKNLCSKLIKDSERAESYILQSTVVLYGEPNTGKSSLMNLLIGKDRSI
MNME_UNCTG      --RSEKLSRFDSCIKDVQNLLNSYKTGKILQYGIKVVIIGKPNAGKSSLLNAILGKNRAI
MNME_SULMW      --YLEFKKMLYNIIKKLKTLIRSFKIGNALKNGISVSIIGCPNVGKSTLFNKLLKYERSI
MNME_CARRP      --FLFIKYTFKKLLKLLKILIDKITVINYLKKNFTIMILGRRNVGKSTLFNKICAQYDSI
                                                       *  * *** : *       ::

MNME_THEMA      VTDIPGTTRDVISEEIVIRGILF-RIVDTAGVRS----ETNDLVERLGIERTLQEIEKAD
MNME_THESQ      VTDIPGTTRDVISEEIVIRGILF-RIVDTAGVRS----ETNDLVERLGIERTLQEIEKAD
MNME_THEP1      VTDIPGTTRDVISEEIVIRGILF-RIVDTAGVRS----ETNDLVERLGIERTLQEIEKAD
MNME_FERNB      VTDIPGTTRDVIKGELKIKGVHF-IISDTAGIR-----MTEDKVEKIGIEKALNEAKKSD
MNME_THEM4      VTDIPGTTRDVIKGEIEINGIRF-VIVDTAGIR-----ETKDVVEKIGIERSLKEIQKAD
MNME_PSELT      VTDIPGTTRDLIEVPLMINGISF-TLIDTAGIR-----HSHDEVEKIGVERAIKAADEGN
MNME_PETMO      VTDIPGTTRDTIEENLNINGIYI-RLIDTAGIR-----YTEDTLERVGIERTINSIKNSH
MNME_AYWBP      VSDISGTTRDFVEAYFNCRGFTL-HLIDTAGIR-----KTDDPIEKIGILRTEKMLLQAE
MNME_ONYPE      VSDISGTTRDFVEAYFNCQGITL-HLIDTAGIR-----KTDDPIEKIGILRTEKMLLQAE
MNME_ACHLI      VSDIAGTTRDTIDAFVNLDGVTL-QLIDTAGIR-----DALDTIEKIGVDRSRKAIHEAE
MNME_BACAN      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDVVERIGVERSKEMMSQAD
MNME_BACHK      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDVVERIGVERSKEMMSQAD
MNME_BACCZ      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDVVERIGVERSKEMMSQAD
MNME_BACAH      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDVVERIGVERSKEMMSQAD
MNME_BACC1      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDVVERIGVERSKEMMSQAD
MNME_BACCR      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDVVERIGVERSKEMMSQAD
MNME_BACMK      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDIVERIGVERSKEMMSQAD
MNME_BACCN      VTDIAGTTRDVIEEYVNVRGVPL-RLIDTAGIR-----ETEDIVEQIGVERSKEMMSQAD
MNME_BACSU      VTDIPGTTRDVIEEYVNVRGVPL-RLVDTAGIR-----ETEDIVERIGVERSRQVLKEAD
MNME_BACVZ      VTDIPGTTRDVIEEYVNVRGVPL-RLVDTAGIR-----ETEDIVERIGVERSRQVLKEAD
MNME_BACP2      VTDIPGTTRDVIEEYVNVRGVPL-RLVDTAGIR-----ETEDIVERIGVERSRQVLKEAD
MNME_BACLD      VTDIPGTTRDVIEEYVNVRGVPL-RLVDTAGIR-----ETEDIVERIGVERSRQVLKEAD
MNME_GEOKA      VTDIPGTTRDVIEEYVNVRGVPL-RLIDTAGIR-----ETEDVVERIGVERSQQMLKRAD
MNME_GEOTN      VTDIPGTTRDVIEEYVNVRGVPL-RLIDTAGIR-----ETEDIVERIGVERSRQMLKKAD
MNME_LYSSC      VTDIAGTTRDIIEEYVNVRGVPL-RLVDTAGIR-----ETEDIVERIGVERSREALRGAD
MNME_OCEIH      VTEIPGTTRDIIEEYVNVRGVPL-RLVDTAGIR-----ETEDIVERIGVDRSRQVLKESD
MNME_BACSK      VTDIPGTTRDTLEEYVNVRGVPL-RLIDTAGIR-----ETEDIVERIGVERSRQALKEAD
MNME_BACHD      VTDIPGTTRDVIEEYVNVRGVPL-RLVDTAGIR-----ETEDIVERIGVERSREVLKEAE
MNME_EXIS2      VTDIAGTTRDTIEEYVNVRGVPL-KLIDTAGIR-----ETEDIVERMGVEKSRQALNSAD
MNME_STAAC      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAE      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAT      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAA3      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAA2      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAA9      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAR      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAW      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAN      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAA8      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAA1      VTEVAGTTRDVLEEYVNVRSVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAM      VTEVAGTTRDVLEEYVNVRSVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAS      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAAB      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----ETEDIVEKIGVERSRKALSQAD
MNME_STAES      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----DTEDIVEKIGVERSRKALSEAD
MNME_STAEQ      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----DTEDIVEKIGVERSRKALSEAD
MNME_STAHJ      VTEVAGTTRDVLEEYVNVRGVPL-RLVDTAGIR-----DTEDIVEKIGVERSRKALSEAD
MNME_STAS1      VTEVPGTTRDTLEEYVNVRGVPL-RLVDTAGIR-----DTEDIVERIGVERSRKALGEAD
MNME_LISMO      VTDIAGTTRDIIEEYVNVRGVPL-RLIDTAGIR-----ETEDIVEKIGVERSRKALADAD
MNME_LISMF      VTDIAGTTRDIIEEYVNVRGVPL-RLIDTAGIR-----ETEDIVEKIGVERSRKALADAD
MNME_LISIN      VTDIAGTTRDIIEEYVNVRGVPL-RLIDTAGIR-----ETEDIVEKIGVERSRKALADAD
MNME_LISW6      VTDIAGTTRDIIEEYVNVRGVPL-RLIDTAGIR-----ETEDIVEKIGVERSRKALADAD
MNME_ENTFA      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDIVERIGVERSRKALADSD
MNME_LACP3      VTDVAGTTRDVLEEYVNVRGVPL-KLVDTAGIH-----DTTDKVEKIGVERSRQAITQAD
MNME_LACSS      VTDVAGTTRDVLEEYVNVRGVPL-KLVDTAGIH-----DTEDKVEKIGVERSRAAITKAD
MNME_LACS1      VTDIAGTTRDVIEEYVNVRGVPL-KLIDTAGIR-----ETEDKVERIGVERSRKAIEQAD
MNME_LACPL      VTDVAGTTRDVIEEYVNVRGVPL-KLVDTAGIR-----DTEDKVEKIGVERSRKAIGAAD
MNME_LACBA      VTDVAGTTRDVIEEYVNVKGVPL-KLIDTAGIR-----DTTDKVEKIGVERSRKAINTAD
MNME_PEDPA      VTDVAGTTRDVIEEYVNVQGVPL-KLVDTAGIH-----ETEDKVEKIGVDRSRKALSQAD
MNME_LACLM      VTDIAGTTRDVITEFANIGGVPL-ELVDTAGIR-----ETDDLVEAIGIERSKKALAEAD
MNME_LACLS      VTDIAGTTRDVITEFANIGGVPL-ELVDTAGIR-----ETDDLVEAIGVERSKKALAEAD
MNME_LACLA      VTDIAGTTRDVITEFANIGGVPL-ELVDTAGIR-----ETDDLVEAIGVERSKKALAEAD
MNME_STRA1      VTDIEGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----DTDDIVEKIGVERSKKALEEAD
MNME_STRA5      VTDIEGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----DTDDIVEKIGVERSKKALEEAD
MNME_STRA3      VTDIEGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----DTDDIVEKIGVERSKKALEEAD
MNME_STRAG      VTDIEGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----DTDDIVEKIGVERSKKALEEAD
MNME_STRTD      VTDIEGTTRDVIEEYVNIKGVPL-KLIDTAGIR-----DTDDVVEKIGVERSKKALEEAD
MNME_STRT1      VTDIEGTTRDVIEEYVNIKGVPL-KLIDTAGIR-----DTDDVVEKIGVERSKKALEEAD
MNME_STRT2      VTDIEGTTRDVIEEYVNIKGVPL-KLIDTAGIR-----DTDDVVEKIGVERSKKALEEAD
MNME_STRMU      VTDIEGTTRDVIEEYVNIKGVPL-KLIDTAGIR-----ETDDLVEKIGVERSKKALEEAD
MNME_STRP8      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRPD      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRP6      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQESD
MNME_STRP3      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRPG      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRP1      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRPC      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRPM      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRPF      VTDIAGTTRDVIEEYVNIKGVPL-KLVDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRGC      VTDIAGTTRDVIEEYVNIKGVPL-KLIDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRSV      VTDIEGTTRDVIEEYVNIKGLPL-KLIDTAGIR-----ETDDLVEQIGVERSKKALQEAD
MNME_STRR6      VTDIAGTTRDVIEEYVNINGVPL-KLIDTAGIR-----ETDDIVEQIGVERSKKALKEAD
MNME_STRP2      VTDIAGTTRDVIEEYVNINGVPL-KLIDTAGIR-----ETDDIVEQIGVERSKKALKEAD
MNME_STRPI      VTDIAGTTRDVIEEYVNINGVPL-KLIDTAGIR-----ETDDIVEQIGVERSKKALKEAD
MNME_STRPN      VTDIAGTTRDVIEEYVNINGVPL-KLIDTAGIR-----ETDDIVEQIGVERSKKALKEAD
MNME_STRSY      VTDIAGTTRDVIEEYVNIKGVPL-KLIDTAGIR-----ETDDIVEKIGVERSKKALEEAD
MNME_STRS2      VTDIAGTTRDVIEEYVNIKGVPL-KLIDTAGIR-----ETDDIVEKIGVERSKKALEEAD
MNME_LACGA      VTDIAGTTRDTLEEYVSVKGVPL-KLIDTAGIH-----HTEDKVEKIGVERSKKAIKEAD
MNME_LACJO      VTDIAGTTRDTLEEYVSVKGVPL-KLIDTAGIH-----HTEDKVEKIGVERSKKAIAEAD
MNME_LACAC      VTDVAGTTRDTLEEYVSVKGVPL-ELIDTAGIH-----HTDDKVEKIGVERSKKALERAD
MNME_LACH4      VTDVAGTTRDTLEEYVSVKGVPL-ELIDTAGIH-----HTDDKVEKIGVERSKKALDRAD
MNME_LACDB      VTDVAGTTRDTLEEFVSVKGVPL-ELIDTAGIH-----HTEDQVEKIGVERSKKAIAQAD
MNME_LACDA      VTDVAGTTRDTLEEFVSVKGVPL-ELIDTAGIH-----HTEDQVEKIGVERSKKAIAQAD
MNME_MYCGE      VSNIKGSTRDVVEGDFNLNGYLI-KILDTAGIR-----KHKSGLEKAGIKKSFESIKQAN
MNME_MYCPN      VSAIKGSTRDIVEGDFALNGHFV-KILDTAGIR-----QHQSALEKAGIQKTFGAIKTAN
MNME_MYCGA      VTNIPGTTRDTVEGQIVLNDELIINLIDTAGIR-----KSSDQIEQIGINKSFKTIDKSD
MNME_UREPA      VTDIPGTTRDVIESSINIDNITL-NILDTAGIH-----LTNDFVENLGINKAKALIDKVD
MNME_UREP2      VTDIPGTTRDVIESSINIDNITL-NILDTAGIH-----LTNDFVENLGINKAKALIDKVD
MNME_MYCPE      VSDIKGTTRDLVTESINLEGLLL-NFIDTAGIR-----ESKNKIENIGIKKTMASIKEAD
MNME_MYCMS      VTDIPGTTRDIVEGQINLENVSL-NLIDTAGIR-----KTSDVVENLGILKSKNLINEAD
MNME_MYCCT      VTDIPGTTRDIVEGQINLENVSL-NLIDTAGIR-----KTSDVVENLGILKSKNLINEAD
MNME_MESFL      VTDIHGTTRDIVTGEINLENISL-NLIDTAGIR-----ETTDIVEGLGIEKSLKIIDEAE
MNME_MYCPU      VTNIEGTTRDVVEARFVLNGINF-LLKDTAGIR-----HSENVIEKIGIEKSFKQIQDSE
MNME_MYCMO      VTNEAGTTRDVIEASFQIDGFLF-SISDTAGLR-----EVQNNIENLGIQKTFETIEKSD
MNME_MYCAP      VTDIAGTTRDIVEAMWQYKGLLF-KFIDTAGIR-----DTKEKIEKIGIDKSFEQIEKAD
MNME_MYCS5      VTNVAGTTRDIVEGIYYLDNFIF-KIIDTAGIR-----KTRQEIEKIGIERSYKAILDAD
MNME_MYCHJ      ISEIPGTTRDVVEGNFVLDGLLF-KLFDTAGIR-----KTTEKIEQIGIEKSYESIKKAD
MNME_MYCH2      ISEIPGTTRDVVEGNFVLDGLLF-KLFDTAGIR-----KTTEKIEQIGIEKSYESIKKAD
MNME_MYCH7      ISEIPGTTRDVVEGNFVLDGLLF-KLFDTAGIR-----KTTEKIEQIGIEKSYESIKKAD
MNME_CAMJE      VSDIAGTTRDTIEENFKLGTHLL-RIIDTAGIRE----S-KDVIEQIGVALSKKSLEDAD
MNME_CAMJJ      VSDIAGTTRDTIEENFKLGTHLL-RIIDTAGIRE----S-KDVIEQIGVALSKKSLEDAD
MNME_CAMJR      VSDIAGTTRDTIEESFKLGTHLL-RIIDTAGIRE----S-KDVIEQIGVALSKKSLEDAD
MNME_CAMJ8      VSDIAGTTRDTIEESFKLGTHLL-RIIDTAGIRE----S-KDAIEQIGVALSKKSLEDAD
MNME_CAMJD      VSDIAGTTRDTIEESFKLGTHLL-RIIDTAGIRE----S-KDTIEQIGVALSKKSLEDAD
MNME_CAMC5      ISDEAGTTRDRIEENFKVGTHLV-RIIDTAGIRK----N-AGKIEKIGIRYSLAAIEEAD
MNME_CAMC1      VSDEAGTTRDRIEENFKIGSHLV-RIIDTAGIRK----D-AGKIEQIGINYSISAINEAD
MNME_CAMHC      VSDEAGTTRDRIEENLQIGSHLI-RIIDTAGIRK----S-ENSVENIGISYSIKAANEAD
MNME_CAMFF      TSETAGTTRDTIEEQIKFGSHLV-RIIDTAGIRD----EFDSSIEAAGIEYSKRAAREAD
MNME_SULDN      VSDIAGTTRDTIEEQVKIGTHLI-RIVDTAGIRE----A-SDEIERIGIERSLEAINESD
MNME_ARCB4      ISDIAGTTRDTIEESVRIGTHII-KIVDTAGIRD----A-SDVIEKIGIEKSIQAINEAD
MNME_NITSB      VSDIAGTTRDTIEESVRIGTHLV-RFVDTAGIRE----A-HDTIEKIGIERSIQAIEESD
MNME_SULNB      VSDIAGTTRDTIEEQVRIGSHII-RLVDTAGIRE----S-EDTIEKIGIERSLSSVEDAD
MNME_HELHP      VSEIEGTTRDTIEEMLTIKGSLL-RIVDTAGIRE----S-DDKIEQIGILKTKEALMRSN
MNME_WOLSU      VSDIPGTTRDTIEESLHLGNHWV-RIVDTAGIRE----A-QDAIEKIGIERTLLALKESD
MNME_HELPY      VSDIKGTTRDTIEEVIELKGHKV-RLIDTAGIRE----S-ADKIERLGIEKSLKSLENCD
MNME_HELPJ      VSDIKGTTRDTIEEVIELKGHKV-RLIDTAGIRE----S-ADEIERLGIEKSLKSLENCD
MNME_HELPH      VSDIKGTTRDTIEEVIELKGHKV-RLIDTAGIRE----S-ADKIERLGIEKSLKSLENCD
MNME_HELAH      VSDIKGTTRDTIEEVIELQGHKV-RLIDTAGIRE----S-VDKIERLGIEKSLKSLENCD
MNME_ECOLI      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECOLC      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_SHIBS      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECODH      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_SHIFL      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_SHIF8      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_SHIDS      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECO57      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECOUT      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECOL5      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECOK1      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECOL6      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECOSM      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECO24      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_ECOHS      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_SHISS      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_SALCH      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVERIGIERAWQEIEQAD
MNME_SALPB      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVERIGIERAWQEIEQAD
MNME_SALTY      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVERIGIERAWQEIEQAD
MNME_SALPA      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ANDEVERIGIERAWQEIEQAD
MNME_SALTI      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ANDEVERIGIERAWQEIEQAD
MNME_SALAR      VTDIAGTTRDVLREHIHIDGMPL-HVIDTAGLRD-----ASDEVERIGIERAWQEIEQAD
MNME_CITK8      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVERIGIERAWQEIEQAD
MNME_ENT38      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVERIGIERAWQEIEQAD
MNME_KLEP7      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ANDEVERIGIERAWQEIAQAD
MNME_CROS8      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_YERPA      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ANDEVERIGIERAWNEIEQAD
MNME_YERPN      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ANDEVERIGIERAWNEIEQAD
MNME_YERPP      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ANDEVERIGIERAWNEIEQAD
MNME_YERPE      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ANDEVERIGIERAWNEIEQAD
MNME_YERPS      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ANDEVERIGIERAWNEIEQAD
MNME_YERP3      VTDIAGTTRDVLREHIHINGMPL-HIIDTAGLRE-----ANDEVERIGIERAWNEIEQAD
MNME_YERPY      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ANDEVERIGIERAWNEIEQAD
MNME_YERE8      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWHEIEQAD
MNME_SERP5      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWNEIEQAD
MNME_PECAS      VTAIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVERIGIERAWQEIEQAD
MNME_PHOLL      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWQEIEQAD
MNME_SODGM      VTAIAGTTRDVLREHIHLDGMPL-HIIDTAGLRN-----AGDEVERIGIERAWREIEQAD
MNME_ACTP2      VTNIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVEKIGIQRAWDEIEQAD
MNME_ACTPJ      VTNIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVEKIGIQRAWDEIEQAD
MNME_HAEDU      VTNIAGTTRDVLHEHIHLDGMPL-HIIDTAGLRE-----ASDEVEKIGIQRAWNEIVAAD
MNME_HAEI8      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ATDEVERIGISRAWTEIEQAD
MNME_HAEIE      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ATDEVERIGISRAWTEIEQAD
MNME_HAEIN      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----AIDEVERIGISRAWTEIEQAD
MNME_HAEIG      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ATDEVERIGISRAWTEIEQAD
MNME_MANSM      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ATDEVERIGITRAWNEIEQAD
MNME_ACTSZ      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ATDEVERIGITRAWNEIEQAD
MNME_PASMU      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ATDEVERIGIVRAWSEIEQAD
MNME_HAES1      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ATDEVEKIGIRRAWDEIEQAD
MNME_HISS2      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ATDEVEKIGIRRAWDEIEQAD
MNME_AERHH      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TQDKVEQIGIERAWAEIEQAD
MNME_AERS4      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TLDKVEQIGIERAWAEIEQAD
MNME_SHEB8      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHEB9      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TNDTVEQIGIERAWNEINSAD
MNME_SHEB5      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHEPC      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHESW      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHESA      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHESM      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHESR      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHEON      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWNEINSAD
MNME_SHEFN      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TLDTVEQIGIERAWAEIASAD
MNME_SHEDO      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TLDTVEKIGIERAWAEIATAD
MNME_SHEHH      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TADTVEKIGIERAWDEIRTAD
MNME_SHEPA      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TVDTVEKIGIERAWDEIKTAD
MNME_SHESH      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TADTVEQIGIERAWAEIETAD
MNME_SHEWM      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TDDTVEMIGIERAWAEIETAD
MNME_SHELP      VTEIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDTVEQIGIERAWAEIETAD
MNME_SHEAM      VTDIAGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----TTDEVERIGIERAWSEIASAD
MNME_VIBCH      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDAVEKIGIERAWEEIRQAD
MNME_VIBC3      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDAVEKIGIERAWEEIRQAD
MNME_VIBCB      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVEKIGIERAWDEIAQAD
MNME_VIBPA      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVEKIGIERAWDEIAQAD
MNME_VIBVU      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVEKIGIERAWDEIRQAD
MNME_VIBVY      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----ASDEVEKIGIERAWDEIRQAD
MNME_ALIF1      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASDEVERIGIERAWDEIAQAD
MNME_PHOPR      VTDIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----ASNEVERIGIERAWEEIQQAD
MNME_PSYIN      VTDIAGTTRDVMREHIHIDGMPL-HIIDTAGLRE-----GADEIEKIGIERAWQEITTAD
MNME_PSEA6      VTAIAGTTRDVLKEHIHIDGMPL-HIIDTAGLRD-----SSDEVERIGIERAWQEIEQAD
MNME_PSEHT      VTEIAGTTRDVLREHIHIDGMPL-HIIDTAGLRE-----SPDLVEQIGIERAWDEINQAD
MNME_IDILO      VTEIAGTTRDVLREHIQIDSMPL-HIIDTAGLRE-----SPDHVEKIGIERAWDEIRQAD
MNME_COLP3      VTDIAGTTRDVLAEQIHIDGMPL-HIIDTAGLRD-----SDDVVEKIGIERAWQEINQAD
MNME_CHRSD      VTDIEGTTRDVLREYIHIDGMPL-HVIDTAGLRD-----TPDAIEKIGVARAWEEIEKAD
MNME_MARMS      VTNIEGTTRDVLREHIHLDGMPL-HIIDTAGLRD-----SPDEVERIGIQRAWDEISKAD
MNME_MARHV      VTAIEGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----SPDEVEQIGIARAWEEIRQAD
MNME_HAHCH      VTEIEGTTRDVLREHIHIDGMPL-HIVDTAGLRD-----SDDVVEKIGIERAWKEIDQAD
MNME_PSEAE      VTDIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TEDHVEKIGVERALKAIGEAD
MNME_PSEAB      VTDIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TEDHVEKIGVERALKAIGEAD
MNME_PSEA7      VTDIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TEDHVEKIGVERALKAIGEAD
MNME_PSEPU      VTDIAGTTRDILREHIHIDGMPL-HVVDTAGLRD-----TDDHVEKIGVERALKAIGEAD
MNME_PSEP1      VTDIAGTTRDILREHIHIDGMPL-HVVDTAGLRD-----TDDHVEKIGVERALKAIGEAD
MNME_PSEPK      VTDIAGTTRDILREHIHIDGMPL-HVVDTAGLRD-----TDDHVEKIGVERALKAIGEAD
MNME_PSEPG      VTDIAGTTRDILREHIHIDGMPL-HVVDTAGLRD-----TDDHVEKIGVERALKAIGEAD
MNME_PSEPW      VTAIAGTTRDILREHIHIDGMPL-HVVDTAGLRD-----TDDHVEKIGVERALKAIGEAD
MNME_PSEE4      VTDIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TDDHVEKIGVERALKAIGEAD
MNME_PSEF5      VTDIAGTTRDILREHIHIDGMPL-HVVDTAGLRD-----TEDQVEKIGVERALKAISEAD
MNME_PSEPF      VTEIAGTTRDILREHIHIDGMPL-HVVDTAGLRD-----TDDHVEKIGVERALKAIGEAD
MNME_PSE14      VTEIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TQDQVEMIGVQRALKAIGEAD
MNME_PSEU2      VTEIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TQDQVEMIGVQRALKAIGEAD
MNME_PSESM      VTEIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TQDQVEMIGVQRALKAIGEAD
MNME_PSEMY      VTDIAGTTRDVLREHIHIDGMPL-HVVDTAGLRD-----TDDQVERIGVERALKAIGEAD
MNME_PSEU5      VTDIAGTTRDVLREHILIDGMPL-HVVDTAGLRD-----TEDQVERIGVQRALSAIGEAD
MNME_SACD2      VTNIAGTTRDVLREHIHIDGMPL-HIIDTAGLRD-----SPDHVEQIGIERAWGEIESAD
MNME_HYDCU      VTDIAGTTRDIVKEEIQIDGMPL-HVLDTAGLRE-----ATDAVEQIGIQRAWAAIEEAD
MNME_LEGPC      VTEIAGTTRDIMREHILLDDIPL-HIIDTAGLRD-----SDDLVEKEGIKRAWQELKRAD
MNME_LEGPH      VTEIAGTTRDIMREHILLDDIPL-HIIDTAGLRD-----SDDLVEKEGIKRAWQELKRAD
MNME_LEGPA      VTEIAGTTRDIMREHILLDDIPL-HIIDTAGLRD-----SDDLVEKEGIKRAWQELKRAD
MNME_LEGPL      VTEIAGTTRDIMREHILLDDIPL-HIIDTAGLRD-----SDDLVEKEGIKRAWQELKRAD
MNME_ALCBS      VTDIAGTTRDVLRESIQLDGMPL-NLIDTAGLRD-----SADVVEQEGIRRAYAEMRKAD
MNME_METCA      VTEIPGTTRDLLRESLQVGGLPL-HIVDTAGLRD-----SEDPIEREGIRRARDALANAD
MNME_NITOC      VTDVPGTTRDLLRENITIDGLPI-HLSDTAGLHN-----SKDTIEQEGMRRTREELIHAD
MNME_ALKEH      VTEVPGTTRDLLREHLHIDGMPL-HVIDTAGLRD-----DPDRIEAEGIRRARAAMAEAD
MNME_COXBU      VTDIAGTTRDIIRESIHIDGLPI-HVVDTAGLRL-----TEDVVEKEGVRRTQKAVQQAD
MNME_COXBN      VTDIAGTTRDIIRESIHIDGLPI-HVVDTAGLRL-----TEDVVEKEGVRRTQKAVQQAD
MNME_COXBR      VTDIAGTTRDIIRESIHIDGLPI-HVVDTAGLRL-----TEDVVEKEGVRRTQKAVQQAD
MNME_PSYCK      VTDVAGTTRDTLQETVVLNGLTL-HLTDTAGLRE-----TEDTVERIGIERARTAIAQAD
MNME_PSYA2      VTDVAGTTRDTLQETVVLNGLTL-HLTDTAGLRE-----TEDTVERIGIERARTAITQAD
MNME_PSYWF      VTDVAGTTRDTLQETIVLNGLTI-HLTDTAGLRD-----TTDAVERIGIERARTAINQAD
MNME_ACIBY      VTDIAGTTRDVLHEKISLNGLPI-TLTDTAGLRE-----TGDIVEKEGIRRAIKEIEQAD
MNME_ACIBT      VTDIAGTTRDVLHEKISLNGLPI-TLTDTAGLRE-----TGDIVEKEGIRRAIKEIEQAD
MNME_ACIAD      VTDIAGTTRDVLHERISLNGLPI-TLTDTAGLRE-----TGDIVEKEGIRRAIKEIEQAD
MNME_DICNV      VTPQAGTTRDIVREDWIIDGIPV-HLSDTAGLRE-----SQDLVEQEGIRRSFDAVKRAD
MNME_BORBR      VTPIAGTTRDKVVQEIHIDGVPL-HIVDTAGLRD-----TDDAVESIGIERTWKEIERAD
MNME_BORPA      VTPIAGTTRDKVVQEIHIDGVPL-HIVDTAGLRD-----TDDAVESIGIERTWKEIERAD
MNME_BORPE      VTPIAGTTRDKVVQEIHIDGVPL-HIVDTAGLRD-----TDDAVESIGIERTWKEIERAD
MNME_BORPD      VTPIAGTTRDKVVQEIHIDGVPL-HIVDTAGLRD-----TDDTVESIGIARTWKEIERAD
MNME_BORA1      VTPIAGTTRDKVVQEIFIDGVPL-HIVDTAGLRE-----TEDTVESIGIARTWKEIERAD
MNME_CUPPJ      VTPIAGTTRDRVKETIQIEGIPL-HIIDTAGLRDE----ATDEVERIGIERTWDAIRRAD
MNME_CUPNH      VTPIAGTTRDRVRETIQIDGIPL-HIIDTAGLREH----AADEVERIGIERTWDAIRRAD
MNME_CUPMC      VTPIAGTTRDRVRETIQIDGIPL-HIIDTAGLRDD----AADEVERIGIERTWEAIRHAD
MNME_RALSO      VTPIAGTTRDKVQQTIQIEGIPL-NIVDTAGLRD-----TEDEVERIGIERTWAAIARAD
MNME_BURM7      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURMA      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURP6      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURP0      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURMS      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURM9      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURPS      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURP1      VTPIAGTTRDKVAQTIQIEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURTA      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVEKIGIARTWGEIERAD
MNME_BURCA      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVERIGIARTWSEIERAD
MNME_BURCH      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVERIGIARTWSEIERAD
MNME_BURCC      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVERIGIARTWSEIERAD
MNME_BURL3      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVERIGIARTWSEIERAD
MNME_BURCM      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVERIGIARTWSEIERAD
MNME_BURA4      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVERIGIARTWSEIERAD
MNME_BURVG      VTPIAGTTRDKVAQTIQVEGIPL-HIIDTAGLRE-----TEDEVERIGIARTWSEIERAD
MNME_PARXL      VTPIAGTTRDKVAQTIQIEGIPL-HVIDTAGLRD-----TEDEVEKIGIARTWNEIERAD
MNME_JANMA      VTAIAGTTRDKVIETIQIEGIPV-NVIDTAGIRDAS--DATDEVERIGIERTWAAVKTAD
MNME_HERAR      VTPIAGTTRDKVIETIQIEGIPV-NVIDTAGIRDAA--DAGDEVERIGIERTWAAVQTAD
MNME_ACISJ      VTPIAGTTRDKVQQTIQIEGVPL-HVIDTAGLR-----ESDDEVERIGIARAWDEIAGAD
MNME_ACIAC      VTPIAGTTRDKVQQTIQIEGVPL-HVIDTAGLR-----ESDDEVERIGIERAWQEIAAAD
MNME_VEREI      VTPVAGTTRDKVQQTIQIEGVPL-RIIDTAGLR-----ASDDEVERIGIARSWEAMAAAD
MNME_RHOFT      VTPIAGTTRDKVQQTIQIEGVPV-HVIDTAGLR-----DSDDVIEKIGIARTWDVIEAAD
MNME_POLSJ      VTPIAGTTRDKVSELIQIEGVPL-HVVDTAGLR-----EALDEVEKIGVERAWAEIESAD
MNME_POLNA      VTPVAGTTRDKVSQLIQIEGVPL-HVVDTAGLR-----EALDEVEKIGIQRAWTEIESAD
MNME_LEPCP      VTPIPGTTRDKISETIQIEGVPV-HVIDTAGLRSDE--QAGDEVERIGISRSWQAIAEAD
MNME_METPP      VTPIAGTTRDKVAETIQIEGVPL-HVVDTAGLRAED--DARDEVERIGMQRSWGAIGEAD
MNME_NEIMA      VTDIAGTTRDAVRERILIDGVPV-HIVDTAGLRE-----TDDVVERIGIERSRKAVSEAD
MNME_NEIMB      VTDIAGTTRDAVRERILIDGVPV-HIVDTAGLRE-----TDDVVERIGIERSRKAVSEAD
MNME_NEIM0      VTDIAGTTRDAVRERILIDGVPV-HIVDTAGLRE-----TDDVVERIGIERSRKAVSEAD
MNME_NEIMF      VTDIAGTTRDAVRERILIDGVPV-HIVDTAGLRE-----TDDVVERIGIERSRKAVSEAD
MNME_NEIG1      VTDIAGTTRDAVRERILIDGVPV-HIVDTAGLRE-----TDDVVERIGIERSRKAVSEAD
MNME_CHRVO      VTDIAGTTRDTVREEIVIDGVPV-HIIDTAGLRD-----TDDVVEKIGIERTWQAVERAD
MNME_AZOSB      VTDVAGTTRDALREAIQIEGIPL-HVIDTAGLRQ-----TSDVVERIGIERTWREVERAD
MNME_AROAE      VTDIAGTTRDAVRETIAIEGIPI-HVIDTAGLRE-----TADPVERLGVERTWREIARAD
MNME_DECAR      VTPIAGTTRDALRSTIQIEGIPL-HIIDTAGLRE-----TDDEVEKIGIERSWKEIERSD
MNME_NITEU      VTDIPGTTRDTVRQSIEIEGIPL-HLIDTAGLRE-----TSDIVEQHGIARTYAAIEQAD
MNME_NITEC      VTEIPGTTRDTIRQSIEIEGIPL-HLIDTAGLRE-----TSDIVEQHGIARAYAAIEQAD
MNME_NITMU      VTEVPGTTRDVIRQVIEIEGVPM-HLLDTAGLRE-----TEDAIEKMGMARTRSTIDKAS
MNME_THIDA      VTEIAGTTRDTVREAIQIEGVPI-HVIDTAGLRE-----TSDPIEQLGIARSWEAVEKAD
MNME_METFK      VTPIAGTTRDTIKNSIQINGITL-HITDTAGLRE-----TNDEVEQHGIARTWRALENAG
MNME_POLAQ      VTPIAGTTRDRVKESIQIEGVPM-HIIDTAGLRK-----TVDEVEAKGIERTWEAIRLAD
MNME_FRATF      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRN-----SDDIIESEGIKRAIKKIQEAD
MNME_FRATH      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRN-----SDDIIESEGIKRAIKKIQEAD
MNME_FRATO      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRN-----SDDIIESEGIKRAIKKIQEAD
MNME_FRATT      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRN-----SDDIIESEGIKRAIKKIQEAD
MNME_FRAT1      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRN-----SDDIIESEGIKRAIKKIQEAD
MNME_FRATW      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRN-----SDDIIESEGIKRAIKKIQEAD
MNME_FRATN      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRN-----SDDIIESEGIKRAIKKIQEAD
MNME_FRAP2      VTSIAGTTRDIVKEHIQINGVPM-HIIDTAGLRS-----SDDIIESEGIKRAIKKIQEAD
MNME_RUTMC      VTDIAGTTRDVLKETICVNGMPL-NIIDTAGLHD-----SDDKIEKEGIKRAHFEIERAD
MNME_VESOH      VTDIAGTTRDVLKETIHVNGVPL-SIIDTAGLRN-----SHDKIEKEGIKRANFEIEHAD
MNME_XANAC      VTDVAGTTRDTLHEAIQLDGFEL-TLVDTAGLRD-----GGDAIEREGMRRARAELERAD
MNME_XANC5      VTDVAGTTRDTLHEAIQLDGFEL-TLVDTAGLRD-----GGDAIEREGMRRARAELERAD
MNME_XANOM      VTDVAGTTRDTLHEAIQLDGFEL-TLVDTAGLRD-----GGDAIEREGMRRARAELERAD
MNME_XANOR      VTDVAGTTRDTLHEAIQLDGFEL-TLVDTAGLRD-----GGDAIEREGMRRARAELERAD
MNME_XANCP      VTDVAGTTRDTLHEAIQLDGFEL-TLVDTAGLRE-----GGDAIEREGMRRARAELQRAD
MNME_XANC8      VTDVAGTTRDTLHEAIQLDGFEL-TLVDTAGLRE-----GGDAIEREGMRRARAELQRAD
MNME_XANCB      VTDVAGTTRDTLHEAIQLDGFEL-TLVDTAGLRE-----GGDAIEREGMRRARAELQRAD
MNME_XYLFA      VTDVPGTTRDTLRESVHFHGLEF-VLVDTAGLRE-----EGDAIEREGMRRTLNELQRAD
MNME_XYLFT      VTDVPGTTRDTLRESVHFHGLEF-VLVDTAGLRG-----EGDAIEREGMRRTLNELQRAD
MNME_BLOFL      ISNISGTTRDILHEYIQLNGIAF-HIIDTAGFKKN----STNEIELIGMQKSKYELSKAD
MNME_BLOPB      ISTISGTTRDTLHEYIQLNGIAF-HITDTAGLQKK----SDNEIEQIGMKRTWEELSNAD
MNME_BAUCH      VTNIAGTTRDILREYIYLDGIPV-SIIDTAGLCNV----SHNEVEKIGIQRAWNEIKQAD
MNME_WIGBR      VTSIEGTTRDILHEHIYLDNIPL-HIYDTAGLRK-----TDDKIEKIGILRALKEIKTSD
MNME_BUCCC      VTNIPGTTRDVIHKNIWFNGVCC-EFLDTAGLQK-----SQDIIEVIGIKLAKKHIKSCN
MNME_BUCAI      VTDIPGTTRDLLYEDISINGVRC-ELIDTAGLRD-----TDDKVERIGIMRAWEMIRKSD
MNME_BUCMP      VTKIPGTTRDLLYENISINGISC-QLIDTAGLRD-----TKNEIERIGIFRAWEVIKKAD
MNME_BUCAP      VTDLPGTTRDVLYENINIHGISC-EIIDTAGLRE-----TEDKIEKIGIQRSWEMIKNSD
MNME_BUCBP      VTNFPGTTRDVIYENIIINGVLF-ILIDTAGLRI-----TNNPIENIGIERAWNEIKLAE
MNME_CAUVC      VTDVAGTTRDVIEVPLVLGGYKV-LVADTAGIR-----ETADVIEAEGVRRAKAWAEAAD
MNME_CAUSK      VTSTPGTTRDIIEVPLTLGGYKT-LLADTAGLR-----KTEDTIEAEGVRRARAWAAGAD
MNME_MARMM      VTDIPGTTRDIVEVQLTLGGFPV-VISDTAGLR-----EAVDAIEAEGVRRALDRAEHAD
MNME_RHORT      VSDIAGTTRDIVEVALDLGGYPL-VVADTAGLR-----ETSDGIEAEGVRRARARLAAAD
MNME_MAGSA      VSAQAGTTRDVIEVHLDLGGWPV-IVADTAGLR-----DSACEIESEGVRRAADRAAKAD
MNME_PARL1      VSDEAGTTRDVLEVRLDIGGVPV-TLADTAGLR-----EAAGAIEQEGVRRALARAEAAD
MNME_NITWN      VSPHAGTTRDIIEVYLDLDGYPV-TLIDTAGIR-----ETDDPVEQEGVRRARDRVAKAD
MNME_NITHX      VSPYAGTTRDVIEVHLDLDGYPV-TLIDTAGIR-----ETDDPVEQEGVRRARDRAASAD
MNME_BRASO      VSPQAGTTRDLIEVQLDLDGYPV-TVIDTAGIR-----ETDDPVEQEGVRRARDRAAHAD
MNME_BRASB      VSPHAGTTRDLIEVALDLDGYPV-TVIDTAGIR-----QTDDPVEQEGVRRARDRAAQAD
MNME_BRADU      VSPHAGTTRDVIEVQLDLDGYPV-TVIDTAGIR-----ETDDPVEQEGVRRARARAEDAD
MNME_RHOP5      VSPHAGTTRDVIEVHLDLDGYPV-TVIDTAGIR-----DSDDPVEQEGVRRAQARAAEAD
MNME_RHOPS      VSPHAGTTRDVIEVQLDLGGYPV-TVIDTAGIR-----ESNDPVEQEGVRRARARAAEAD
MNME_RHOP2      VSPHAGTTRDVIEVQLDLGGYPV-TLIDTAGIR-----ESEDSVEQEGVRRAKARAAEAD
MNME_RHOPA      VSPHAGTTRDVIEIQLDLDGYPV-TVIDTAGLR-----DSDDPVEQEGVRRARSRAAAAD
MNME_RHOPB      VSPHAGTTRDIIEVHLDLDGYPV-TVIDTAGIR-----EAIDPVEQEGVRRARSRAAEAD
MNME_METPB      VSDIPGTTRDAIEVRCDLGGLPV-VLVDTAGLR-----ETADVIEAEGVRRTHHRIRSAD
MNME_METRJ      VSDSPGTTRDAIEVRLDLGGLPV-LLVDTAGLR-----ETAEPIEAQGIVRTRARIDTAD
MNME_METS4      VSPIPGTTRDAIEVRCDLDGLPV-LLVDTAGLRD----EGADPIEAEGMARSRRRIEEAD
MNME_AZOC5      VSPVPGTTRDVLEVHLHLAGQAV-TLVDTAGLR-----ETDDLVEAEGVRRARVRAEGSD
MNME_BEII9      VSEIAGTTRDLIEVHLDLKGCAV-VLTDTAGLR-----DNADKIEQIGIARAYERGREAD
MNME_RHIEC      VTDIAGTTRDVLQVDLDIDGYLV-KLYDTAGLR-----QADDRVEMEGVRRARVALRDAD
MNME_RHIL3      VTEIAGTTRDVLQVDLDIDGYLI-KLFDTAGLR-----EADDKVEMEGVRRARVALRDAD
MNME_SINMW      VTEIAGTTRDVLSVDLSLAGFSV-KLFDTAGLR-----ETDEVVEREGIRRARQVIADAD
MNME_RHIME      VTEVAGTTRDVLSVDLSLAGFSV-KLFDTAGLR-----ETDELVEREGIRRARQVIADAD
MNME_AGRFC      VTDIAGTTRDVLSVDINLDGYLV-RIFDTAGIR-----ETQDVVEREGVRRAVLTAETAD
MNME_BRUC2      ISKEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSVVEKIGIERARARMAEAD
MNME_BRUSU      ISKEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSVVEKIGIERARARMAEAD
MNME_BRUA2      ISEEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSVVEKIGIERARARMAEAD
MNME_BRUAB      ISEEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSVVEKIGIERARARMAEAD
MNME_BRUME      ISEEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSVVEKIGIERARARMAEAD
MNME_BRUO2      ISEEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSVVEKIGIERARARMAEAD
MNME_BRUSI      ISEEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSLVEKIGIERARARMAEAD
MNME_OCHA4      ISEEAGTTRDLLEVKLDLGGIPV-YVTDTAGLR-----ETDSSVEKIGIERARARMADAD
MNME_BARHE      VTEEAGTTRDALEVRLVLGGLPV-FLIDTAGFR-----ETDNKIEQLGIEVAKQHVRDAD
MNME_BART1      VTEEAGTTRDALEMRLVLGGLPI-FLTDTAGFR-----KTENKIEQLGIEVAKQHVREAD
MNME_BARQU      VMEEAGTTRDALEIRLVLGGLPV-FLTDTAGLR-----ETENKIEQLGIEIAKQHIVDAD
MNME_BARBK      VTEEEGTTRDALEVRLILGGLPV-LVMDTAGFR-----ETESKIEQLGIDIAKQHVLDAD
MNME_CHESB      VTEEPGTTRDILEVSLDIDGTKV-VLADTAGIR-----EAAGRVEALGIERSLRRANEAD
MNME_RHILO      VTDEPGTTRDLLEVTLDLGGLRV-RLTDTAGLR-----EAPGKVEAIGIEKARAKADRAD
MNME_HYPNA      VTDIAGTTRDVVEVRLVLGGQVV-WIADTAGLR-----ETEDVVEAEGVRRARRAAAEAD
MNME_GRABC      VSSQPGTTRDTIEVRLVLAGVPV-TLIDTAGLRD-----SADSIEAEGVRRALARAESAD
MNME_ACICJ      VSDIPGTTRDAIGVRLDLGGVPV-RLVDTAGLRR-----SDDAIEAEGVRRAEAHARRAD
MNME_GLUOX      VTHRAGTTRDAIALDWVLDGVRL-RLIDTAGLRE-----TEDEIEAEGIRRALFHVKQAD
MNME_ERYLH      VSPIAGTTRDVLERPVAFGGTPF-TLIDTAGLHE----GGDDSIERIGIDRARAALRDAD
MNME_NOVAD      TAAEPGTTRDLLTHAAALDGVPF-TFVDTAGLRD----EGAGEIERIGIARARAAAEKAD
MNME_SPHWW      VTPIAGTTRDLIEAPVALGGIPF-LLTDTAGLHE----GTGDAVEAIGIDRAGQAIAAAD
MNME_SPHAL      VSPVAGTTRDVIETPLALDGIAM-RFSDTAGLRG----ESADAIEMIGIDRAKAAVEGAD
MNME_ZYMMO      TAPIAGTTRDVIEVSFALKGIPM-RFSDTAGLHE-----SDDLIEKAGIERAQRAIEEAD
MNME_RUEST      TSEYAGTTRDVIEVRMDLAGLPV-TLLDTAGLR-----ETDDHVEGIGIRLAQERAERAD
MNME_RUEPO      TSEVAGTTRDVIEVRMDLGGLPV-TLLDTAGLR-----ETGDLVEGMGIALARRRADQAD
MNME_ROSDO      TSEIAGTTRDVIEVRMDLGGLPV-TFLDTAGLR-----QSADEIETIGIERAIKRAQEAD
MNME_RHOS4      TSEIAGTTRDVIEVRMDLDGLPV-TFLDTAGLR-----DTSDLVESLGIERAVTRAKAAD
MNME_RHOS1      TSEIAGTTRDVIEVRMDLDGLPV-TFLDTAGLR-----DTSDLVESLGIERAVTRAKAAD
MNME_RHOS5      TSEVAGTTRDVIEVRMNLGGLAV-TLLDTAGLR-----ETHDPVEALGIDRALTRARAAD
MNME_DINSH      TSSIAGTTRDVVEVRLDLDGLPV-TVLDTAGLR-----ETQDEIEQIGISRAMARAESAD
MNME_JANSC      TSDVPGTTRDVIEARLDVSGLPV-TFLDTAGIR-----DTVDVIEKIGVQRAIDRALAAD
MNME_PARDP      VSEIAGTTRDILELHTDLRGLPV-TFLDTAGLR-----ESSDPVEAMGVARAVQRAAEAD
MNME_RICAH      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRE----ESSDIIEQEGIKRAINSAKTAD
MNME_RICFE      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRE----ESSDIIEQEGIKRAIHSAKTAD
MNME_RICRO      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRE----ESSDIIEQEGIKRAINSAKTAD
MNME_RICRS      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRE----ESSDIIEQEGIKRAINSAKTAD
MNME_RICCN      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRE----ESSDIIEQEGIKRAINSAKTAD
MNME_RICM5      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIGE----ESSDIIEQEGIKRAINSAKTAD
MNME_RICCK      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRE----ESSDIIEQEGIKRAINSAKTAD
MNME_RICPR      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRT----ESTDIIEQEGIKRAINSAKTAN
MNME_RICTY      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRA----ESTDIIEREGIKRAINSAKTAN
MNME_RICB8      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRG----ESNDVIEQEGIKRAIDSAKKAD
MNME_RICBR      VSNIAGTTRDIIEGHLDIGGYPI-ILQDTAGIRG----ESNDVIEQEGIKRAIDSAKKAD
MNME_ORITB      VSDIPGTTRDVIEAHLDIGGYPI-IVRDTAGIR-----ESDDPIEQEGIKRSLVAFKNSD
MNME_ANAMM      VSEYPGTTRDVLEAHVDIGGYPF-IVVDTAGIR-----ESTDFVEREGIMRAKSEAATAD
MNME_ANAPZ      VSEHPGTTRDVLEVAIDIGGYPY-IVLDTAGIR-----ESCDGIEQEGIKRAKMAAEEAD
MNME_EHRCJ      VSEYAGTTRDTLEAHIDVAGYPI-VIIDTAGIR-----DSADLIEQEGIRRAKLKAENAD
MNME_EHRCR      VSEYAGTTRDPLEAHIDVAGYPI-IIIDTAGIR-----ESTDPVEQEGIKRAKLKAENAD
MNME_EHRRW      VSEYAGTTRDVLETHIDIAGYPI-VIIDTAGIR-----DSNDPVEQEGIRRAKLKAESAD
MNME_EHRRG      VSEYAGTTRDVLETHIDIAGYPI-VIIDTAGIR-----DSNDPVEQEGIRRAKLKAESAD
MNME_WOLTR      VSEYVGTTRDILEAHIDIGGYPI-ILSDTAGIR-----ESSDPVESEGISRAKKRSCEAD
MNME_WOLPM      VSEYAGTTRDILEAHIDIGGYPI-ILSDTAGIR-----ESSDPIELEGISRAKKRSFEAD
MNME_NEOSM      VTDIPGTTRDILEVRLDCHGYPV-ILSDTAGIQ-----ETCDAIEKMGITRALKKATEAD
MNME_PELUB      VSEIAGTTRDVIETHLNIDGYPV-VVSDTAGIR-----DSKNEIEKKGIKLALDKADNAD
MNME_DEIRA      VTPLPGTTRDYLEAGLELAGVPV-TLVDTAGLR-----ETEDLIEAAGVRQAVALAGNAD
MNME_DEIGD      VTPIPGTTRDYLEAQLSLAGVPV-TLVDTAGLR-----ETGDEVEAAGVRQAVRLAESAD
MNME_THET8      VSPIPGTTRDYLEAPLELFGIPL-VAVDTAGVR-----ETEDPVERMGVERALGIAEEAD
MNME_THET2      VSPIPGTTRDYLEAPLELFGIPL-VAVDTAGVR-----ETEDPVERMGVERALRIAEEAD
MNME_HALHL      VSAQAGTTRDVVRQWAALGSRHA-ELLDTAGLRD---AEAQDEIEAEGARRARAAASEAD
MNME_MYXXD      VDDEPGTTRDALEARVEWDGLAV-TLFDTAGLR-----ETPGRVEALGIARTRALLTGVD
MNME_RHOBA      VTDQAGTTRDLVTVESSWGGHSF-QLIDTAGSESREESDPEAPISQEAQLQAAEAARGAD
MNME_AQUAE      VTDIAGTTRDFIEETLQIKGVPV-RLVDTAGIRE-----TKDLVERIGVERSKQKVKEAD
MNME_MAGMM      VTDLAGTTRDLNESNLEIHGLPI-LLVDTAGLRE-----SDDPVERIGIERAWQRVERAD
MNME_KORVE      VTAIPGTTRDLVTETVSLGGIPV-HLVDTAGIRE-----SHDEAESIGIQKSREAMADAD
MNME_SOLUE      VTEIPGTTRDVVSETAAIGGIPV-KLYDTAGIRE-----TEERVESLGIERSYQAIVDSD
MNME_CHLTR      VTDIPGTTRDILEENWVLQGKNL-RLIDSAGLR-----ETENLVEKEGIARAREAMSQAE
MNME_CHLTB      VTDIPGTTRDILEENWVLQGKNL-RLIDSAGLR-----ETENLVEKEGIARAREAMSQAE
MNME_CHLT2      VTDIPGTTRDILEENWVLQGKNL-RLIDSAGLR-----ETENLVEKEGIARAREAMSQAE
MNME_CHLTA      VTDIPGTTRDILEENWVLQGKNL-RLIDSAGLR-----ETENLVEKEGIARAREAMSQAE
MNME_CHLMU      VTDIPGTTRDILEENWVLQGKNL-RLIDSAGIR-----ETENIVEKEGIERARQAMSQAE
MNME_CHLCV      VTDIPGTTRDILEENWTLQGKRI-RLIDSAGQR-----ETDNLVEQEGIERAISAMEQSE
MNME_CHLFF      VTDIPGTTRDILEESWTLQGKRI-RLIDSAGQR-----ETDNPVEQEGIERAISAMKQAE
MNME_CHLAB      VTDIPGTTRDILEENWMLQGKRI-RLIDSAGQR-----ETHNPIEQEGIERAIAAMEASE
MNME_CHLPN      VTHIPGTTRDILEEQWLLQGKRI-RLLDTAGQR-----TTDNDIEKEGIERALSAMEEAD
MNME_PARUW      VSPIPGTTRDVLEDHLRLNGLHI-KLSDTAGIR-----EANESVEQEGIRRSKKAMQEAD
MNME_OPITP      VSAEPGTTRDFIEERIAVGEHCI-RLVDTAGLNV----SPAPL-EALGIHKSLEQLADAD
MNME_BDEBA      VTDIPGTTRDVIHGDTTFEGVKF-TFVDTAGLRD----EATDLVERIGIQKSYEAQNESD
MNME_DESHY      VTDIPGTTRDEIRESVTIGGILL-QLVDTAGLR-----ESEDLVEKLGIERSWKAMEKAE
MNME_ALKMQ      VTEVPGTTRDAIEEHFNIRGIPL-NLIDTAGIR-----ETEDIVEKIGVERSKAFFNKAD
MNME_ALKOO      VTDVPGTTRDIIEEHLNIKGIPL-RLIDTAGIR-----DTEDIVEKIGVERSKELFNLAD
MNME_CLOD6      VTDIPGTTRDVIEEFVNIKGIPL-KIVDTAGIR-----DTDDIVEKIGVEKSKESFTSAD
MNME_FINM2      VTDIPGTTRDVIEEYIDLDGISL-KINDTAGIR-----DTEDIVEKIGVEKSVSFISDSD
MNME_FUSNN      VTHIPGTTRDIIEEVININGIPL-LLVDTAGIR-----NTDDIVENIGVEKSKELINSAD
MNME_CLOB1      VTEIPGTTRDVIEEYINIDGIPI-KIVDTAGIR-----ETEDVVEKIGVEKSKEKIDEAD
MNME_CLOBK      VTEIPGTTRDVIEEYINIDGIPI-KIVDTAGIR-----ETEDVVEKIGVEKSKEKIDEAD
MNME_CLOBH      VTEIPGTTRDVIEEYINIDGIPI-KIVDTAGIR-----ETEDVVEKIGVEKSKEKIDEAD
MNME_CLOBL      VTEIPGTTRDVIEEYINIDGIPT-KIVDTAGIR-----ETEDVVEKIGVEKSKEKIDEAD
MNME_CLOBM      VTEIPGTTRDVIEEYINIDGIPI-KIVDTAGIR-----ETEDVVEKIGVEKSKEKIDEAD
MNME_CLOK5      VTDIPGTTRDVIEEYMNIGGIPI-KIVDTAGIR-----KTDDIVEKIGVEKSKEKIDESD
MNME_CLOTE      VTEIPGTTRDVIEEYINLDGIPI-KIIDTAGIR-----ETEDLVEKIGVERSKEKINEAD
MNME_CLONN      VTDVPGTTRDVIEEYMSIDGIPI-KIIDTAGIR-----DTDDVVEKIGVEKSREKINNSD
MNME_CLOAB      VTDIPGTTRDVIEEYINISGIPI-KIVDTAGIR-----ETEDVIEKMGVERSKEKMENAD
MNME_CLOPE      VTDIAGTTRDVIEEYINLDGIPV-RLVDTAGIR-----ETEDVVEKIGVEKSKEKINEAD
MNME_CLOP1      VTDIAGTTRDVIEEYINLDGIPV-RLVDTAGIR-----ETEDVVEKIGVEKSKEKINEAD
MNME_CLOPS      VTDIAGTTRDVIEEYINLDGIPV-RLVDTAGIR-----ETEDVVEKIGVEKSKEKINEAD
MNME_CLOB8      VTDVPGTTRDIIEEYINLDGIPV-KITDTAGIR-----DTEDVVEKIGVEKSKEKIEEAD
MNME_LACP7      VTEIAGTTRDTIEETVFLNGLCL-NLIDTAGIR-----ETSDLVEKLGVEKSLKSAKEAD
MNME_THEP3      VTDIPGTTRDIIEEYVNVKGIPI-KLIDTAGIR-----DTDELVEKIGVTKSKEVLAEAD
MNME_THEPX      VTDIPGTTRDIIEEYVNVKGIPI-KLIDTAGIR-----DTDELVEKIGVTKSKEVLAEAD
MNME_CALS4      VTDIPGTTRDVIEEYMNIKGIPI-KLIDTAGIR-----HTDELVEKIGVEKSKEVLAEAD
MNME_HUNT2      VTDIPGTTRDIIEEYININGIPL-RIIDTAGIR-----ETEDVVEKIGVEKTHRAIDEAD
MNME_CARHZ      VTDIPGTTRDVIEDYLNLKGIPV-KIVDTAGIR-----ETEDLVEKLGVEKTREYLNQAD
MNME_DESRM      VTDIPGTTRDVIEEILSIKGVPL-KIIDTAGLR-----ETQDLVEKIGVEKSRELLNQAD
MNME_PELTS      VTDIPGTTRDIIEEYINIRGIPL-KIIDTAGLR-----ETGDAVERIGVEKAREAVEQAD
MNME_CALS8      VTDIPGTTRDVIEEVLDIEGIPI-ILVDTAGVR-----QTEDIVERIGVERTLKSVERAD
MNME_SYNWW      VTSIPGTTRDIIEDYINIRGIPV-KLKDTAGIR-----STEDLVERIGIERSQEVISEAD
MNME_NATTJ      VTEIPGTTRDVLEEVINLKGIPL-RIIDTAGIR-----ESEDKVEQIGVKRTRDSMEQAD
MNME_DESPS      VTSIAGTTRDSIEEMVDILGMPV-RIVDTAGIR-----RQAGEVEALGIQRAKDLINSAD
MNME_MOOTA      VSNIPGTTRDTIEETLQLGGFTC-RLIDTAGLR-----ETADELESIGVARSKKAIAAAD
MNME_DESAP      VTDVPGTTRDVIEETVNIRGLPV-RLLDTAGLR-----ETADTVERLGVARTRDAVAGAD
MNME_ROSS1      VTPIPGTTRDTLEETASLGGVPV-VLTDTAGIV-----ESDDPVERLGVARSRQAVRLAD
MNME_ROSCS      VTPIPGTTRDTLEETANLGGVPV-VLTDTAGIV-----ESVDPVERLGVERSRQAVAQAD
MNME_CHLAA      VTPIPGTTRDTLEEMANLAGVPV-VLIDTAGMR-----TSTDPVEQIGVERAAAALAGAD
MNME_SYMTH      VTPIPGTTRDVIAEWVELGGVPV-QLFDTAGLR-----PTDDPVERIGVARTHEALAQAH
MNME_HELMI      VTEIPGTTRDAIEEYIDLGGIPL-RIVDTAGIR-----ETEDVVERIGVEKTREYLEKAD
MNME_GEOSL      VTSVPGTTRDIIEEVVNIRGLPL-RMIDTAGIR-----DTEDIVEKEGVRLTLEKIPEAD
MNME_GEOMG      VTSVPGTTRDIIEEVVNVRGLPL-RMLDTAGIR-----ETEDVVEQEGVRLTLEKIPQAD
MNME_GEOUR      VTSVPGTTRDLIEEVVTIKGLPV-KLLDTAGIR-----ESDDRVEREGIKLSLDKIPSAD
MNME_PELPD      VTHLPGTTRDIIEETINLGGLAV-RLLDTAGIR-----HTEDVIEQEGINRALEKIPQAD
MNME_PELCD      VTDIPGTTRDTIEEDLVLGGLPL-RIVDTAGIR-----NTLDPVEEEGVRRARSKVESAD
MNME_SYNAS      VTPVPGTTRDFIEEAISIQGVSV-RMIDTAGIH-----PTDDLIECEGIRMVWEKLATAD
MNME_SYNFM      VTPFPGTTRDVVEDTFLLSGILV-RVLDTAGLR-----HDPDEIESFGIARTIQSLEEAD
MNME_DESVH      VTDLPGTTRDFIEEPLNLSGLAI-RLADTAGLR-----ETGDIVEQEGVRMSRDLVAQAD
MNME_DESVV      VTDLPGTTRDFIEEPLNLSGLAI-RLADTAGLR-----ETGDIVEQEGVRMSRDLVAQAD
MNME_DESAG      VTDVPGTTRDFLEESITLDGLAV-RLVDTAGLR-----ETGDIVEQEGVRMSRDLAAQAD
MNME_LAWIP      VTEHPGTTRDFLEECIIVNSLSI-RLIDTAGLR-----VTSDPIEEQGIQKGREKIDEAD
MNME_NOSS1      VTDLPGTTRDVVESQLVVGGIPV-QVLDTAGIR-----ETSDQVEKIGVERSRQAANTAD
MNME_TRIV2      VTDLPGTTRDVVESQLVVGGIPV-QVLDTAGIR-----ETSDQVEKIGVERSRQAANTAD
MNME_TRIEI      VTDLPGTTRDVVESQLVVGGIPV-QVLDTAGIR-----ETEDRVEKIGVERSCQAAESAD
MNME_ACAM1      VTDLPGTTRDVVESQLVVGGIPI-QVLDTAGIR-----ETEDQVEQIGVTRSHQAAQSAD
MNME_SYNY3      VTDLPGTTRDVVESQLVVEGIPI-QVLDTAGIR-----ETADQVEQIGVERSRKAAQQAD
MNME_MICAN      VTDLPGTTRDIVESQLVVAGIPV-QVLDTAGIR-----SASDRVEQIGVERSRQTARSAD
MNME_SYNP2      VTDLPGTTRDVVESQLVVQGIPV-QVLDTAGIR-----DTEDAVEKIGVARSLAASQQAD
MNME_SYNE7      VTDLPGTTRDLVESQLIVGGIPV-QVLDTAGIR-----ETSDQVEQIGVERSRRAAQSAD
MNME_SYNP6      VTDLPGRTRDLVESQLIVGGIPV-QVLDTAGIR-----ETSDQVEQIGVERSRRAAQSAD
MNME_THEEB      VTDLPGTTRDIVESQLVVGGIPI-QVLDTAGIR-----ETDNLVEQIGVQRSRQAALSAD
MNME_SYNJA      VTDLPGTTRDVVESQLVVRGIPV-QLLDTAGIR-----ATDDPVERLGVERSQRLAQTAD
MNME_SYNJB      VTDLPGTTRDVVESHLVVKGIPV-QLLDTAGIR-----ATEDPVERLGVERSQRLAQAAD
MNME_GLOVI      VTDLPGTTRDVVESMLNVQGIPV-QVLDTAGIR-----EATDTVERIGIERSHAAAREAD
MNME_PROM1      VTDLPGTTRDILESEIVLEGIPV-TFIDTAGLR-----DTKDIIEKIGISRTKKTLIHAD
MNME_PROMT      VTDLPGTTRDILESEIILEGIPV-TFIDTAGLR-----DTKDIIEKIGISRTKKTLIHAD
MNME_PROMA      VTDLPGTTRDLLESEIILEGVPI-TLIDTAGIR-----ETNNEIEKIGVSLSQKTLFTAD
MNME_PROM3      VTDLPGTTRDVLESEIVLEGVPI-TLVDTAGIR-----ATKDALEQLGIDRSHQALAAAD
MNME_PROMM      VTDLPGTTRDVLESEIVLEGVPI-TLVDTAGIR-----ATQDALEQLGIDRSHQALAAAD
MNME_SYNSC      VTDLPGTTRDLLESEIVLEGVPI-TLLDTAGIR-----STDDAVEQLGIARSEQALATAD
MNME_SYNPX      VTELPGTTRDLLESEIVLEGVPI-TLLDTAGIR-----STDDAVEQLGIARSEEALATAD
MNME_SYNS9      VTELPGTTRDLLESEIVLDGVPI-TLMDTAGIR-----ATNDAVEQLGIARSEEALISAD
MNME_SYNPW      VTDLPGTTRDLLESEIVLEGVPI-TLLDTAGIR-----ATSDAVERLGIARSHDALASAD
MNME_SYNS3      VTDLPGTTRDLLESEIVLDGVPI-TLLDTAGIR-----ATSNAVEKLGIARSRDALASAD
MNME_SYNR3      VTDLPGTTRDLLDYDLVLQGVPI-TLLDTAGIR-----STADRVEQLGIERSRAAFASAD
MNME_PROMS      VTNIPGTTRDVIEVNLTINDIPM-KIIDTAGIR-----ETHEQIESIGIKKSFGKIKESD
MNME_PROM0      VTNIPGTTRDVIEVNLTINDIPM-KIIDTAGIR-----ETYEQIESIGIKKSFGKIKESD
MNME_PROM2      VTNIPGTTRDVIEINLTINDIPM-KIIDTAGIR-----ETSEQIERIGIKKSFRKIKESD
MNME_PROM9      VTNIPGTTRDVIEVNLTINDIPM-KIIDTAGIR-----ETHEQIESIGIKKSFRKIKESD
MNME_PROM5      VTNIPGTTRDMIEVNLTIKDIPI-KLVDTAGIR-----DTDEYIENIGIEKTFEMIQKSD
MNME_PROMP      VTSIPGTTRDIIEVNLTIKDIPI-KIIDTAGIR-----ETDEYIENIGIDKSFEMIQNSD
MNME_CYACA      VTNFPGTTRDIVSFETMLGNTLV-RLYDTAGIR-----QSVDEIEKIGISKTELFVDECQ
MNME_CYAM1      VTPIAGTTTDVVEATLQWQQICF-RFFDTAGLK-----EASSEIETKAMAKAQQIAKQCD
MNME_BACFR      VSDIHGTTRDVIEDTVNIGGITF-RFIDTAGIRE-----TSDTIESLGIERTFQKLDQAE
MNME_BACFN      VSDIHGTTRDVIEDTVNIGGITF-RFIDTAGIRE-----TSDTIESLGIERTFQKLDQAE
MNME_BACTN      VSDIHGTTRDVIEDTINIGGITF-RFIDTAGIRE-----TNDTIESLGIERTFQKLDQAE
MNME_BACV8      VSDIHGTTRDVIEDTINLQGVTF-RFIDTAGIRQ-----TNDTIENLGIERTFQKMDQAY
MNME_PARD8      VSDIHGTTRDVIEDTININGQLF-RFIDTAGIRE-----TSDAIEALGIERSFKALDQAQ
MNME_PORGI      VSDIHGTTRDTIEDTMHIGGYLF-RFVDTAGLRE-----TEDTIESLGIERSRSKIKEAD
MNME_FLAJ1      VSDIAGTTRDTIEDELVIGGIGF-RFIDTAGIRE-----TKDVVESIGIKKTFEKIDQAQ
MNME_FLAPJ      VSEIAGTTRDTIEDELVIGGIGF-RFIDTAGIRE-----TKDVVESIGIKKTFEKIEQSQ
MNME_GRAFK      VSEIAGTTRDTIEDEMSIGGVGF-RFIDTAGIRE-----TKDVVESIGIKKTFEKISQAQ
MNME_CYTH3      VSEIAGTTRDFIEDELNVEGITF-RFIDTAGLRE-----ATDAIEAMGVKRTREKMTQAS
MNME_SALRD      VSETPGTTRDEIEAEAEIEGVLF-RFVDTAGLRD-----TADEIEAEGVRRATESIEEAD
MNME_CHLTE      VSHMPGTTRDYIEECFIHDKTMF-RLTDTAGLRE-----AGEEIEHEGIRRSRMKMAEAD
MNME_CHLPD      VSHMPGTTRDYIEECFIHDKTMF-RLTDTAGLRE-----TGEEIEHEGVRRSRMKMAEAD
MNME_CHLPM      VSHMPGTTRDYIEECFIHEKTMF-RLTDTAGLRH-----SDEEVEHEGIRRSYRKISEAD
MNME_PELLD      VSHMPGTTRDYIEECFVYDKTMF-RLTDTAGLRE-----SEEDVEHEGIERSYRKISEAD
MNME_CHLCH      VSHQPGTTRDYIEEPLLLGSTLF-RLIDTAGLRE-----GEEEVEHEGIRRSYRKIAEAD
MNME_BORAP      VSSYPGTTRDYIEASFELDGILF-NLFDTAGLRD-----ADNFVERLGIEKSNSLIKEAS
MNME_BORBU      VSSYPGTTRDYIEASFELDGILF-NLFDTAGLRD-----ADNFVERLGIEKSNSLIKEAS
MNME_BORBP      VSSYPGTTRDYIEATFELDGILF-NLFDTAGLKD-----ADNFVERLGIEKSNSLIKEAS
MNME_TREPA      VSSVPGTTRDWLEADLDLSGIPV-RLCDTAGLRV-----TDNPIEAQGVVRSEQLLQGAD
MNME_TREDE      VSDIHGTTRDWLEASLNFNGIPV-SLYDTAGIRY-----TQDSIEAIGVERSLEMSRNAD
MNME_LEPBJ      ISEIPGTTRDYISEEILLEGIPV-RLVDTAGVRE-----TEDHIERLGIERSEKEFQSAD
MNME_LEPBL      ISEIPGTTRDYISEEILLEGIPV-RLVDTAGVRE-----TEDHIERLGIERSEKEFQSAD
MNME_LEPIN      ISEIPGTTRDYISEEILLEGIPV-RLVDTAGVRE-----TTDHIEKLGIERSEKEFQSAD
MNME_LEPIC      ISEIPGTTRDYISEEIFLEGIPV-RLVDTAGVRE-----TTDHIEKLGIERSEKEFQSAD
MNME_LEPBA      ISDVPGTTRDYIAEELSLDGIPI-RLVDTAGIRD-----TTDNIEQMGIERSKREADSAN
MNME_LEPBP      ISDVPGTTRDYIAEELSLDGIPI-RLVDTAGIRD-----TTDNIEQMGIERSKREADSAN
MNME_UNCTG      VTDIAGTTTDTVEETIDCCGIPL-IITDTAGIRE----HSENLIEILGQAKTREAVCKAD
MNME_SULMW      VSNIAGTTRNYIEDSLIINGIKF-RFIDTAGINN----NTKDYIEKLGIKKTYSKINKSD
MNME_CARRP      VTNIPGTTKNIISKKIKILSKKI-KMMDTAGLKI----RTKNLIEKIGIIKNINKIYQGN
                     * * :                 *:**             .  .            

MNME_THEMA      IVLFVLDASS-PLDEEDRKILERIK-----------------------------------
MNME_THESQ      IVLFVLDASS-PLDEEDRKILERIK-----------------------------------
MNME_THEP1      IVLFVLDASS-PLDEEDRKILERIK-----------------------------------
MNME_FERNB      VILFLLDATT-GFTNEDEYIYNLIK-----------------------------------
MNME_THEM4      VILFVLDATT-GFTKEDKLILRKIE-----------------------------------
MNME_PSELT      LILFVLDATT-PVDENDKKILSLIK-----------------------------------
MNME_PETMO      LILFVLDGTT-PFTQEDELIYNKLNEL---------------------------------
MNME_AYWBP      LILLVLDQSN-YLQEEDIQLLQLTQN----------------------------------
MNME_ONYPE      LILLVLDQNN-HLQEEDIQLLQLTKN----------------------------------
MNME_ACHLI      LVLLVLDLSQ-KLTKEDEMLLTLTEH----------------------------------
MNME_BACAN      LVLVVVNYSE-TLTNEDEELFRAVQG----------------------------------
MNME_BACHK      LVLVVVNYSE-TLTNEDEELFRAVQG----------------------------------
MNME_BACCZ      LVLVVVNYSE-ALTNEDEELFRAVQG----------------------------------
MNME_BACAH      LVLVVVNYSE-ALTNEDEELFRAVQG----------------------------------
MNME_BACC1      LVLVVVNYSE-ALTNEDEDLFRAVQG----------------------------------
MNME_BACCR      LVLVVVNYSE-ALTNEDEDLFRAVQG----------------------------------
MNME_BACMK      LVLIVVNYSE-ALTNEDEDLFRAVQG----------------------------------
MNME_BACCN      LVLIVVNYSE-PLTNEDEELFRAVQG----------------------------------
MNME_BACSU      LILLVLNYSE-ELSEEDVKLFEAVEG----------------------------------
MNME_BACVZ      LILLVLNHSE-ELSEEDVKLFEAVEG----------------------------------
MNME_BACP2      LILLVLNYSE-ELSEEDIKLFEAVSG----------------------------------
MNME_BACLD      LILLVLNYSE-SLSDEDIKLFEATKG----------------------------------
MNME_GEOKA      LILLVLNYHE-PLTEEDERLFAMIEG----------------------------------
MNME_GEOTN      LILLVLNYHE-PLTEEDERLFAMTEG----------------------------------
MNME_LYSSC      LILFVLNYAD-ELTAEDERLFETIEA----------------------------------
MNME_OCEIH      LILFVLNYNE-PLSEDDKKLFEAVDG----------------------------------
MNME_BACSK      LILLVLNYAE-KLSKEDEALFEAVKG----------------------------------
MNME_BACHD      LILLVLNFGE-ELSKEDEALFEAISG----------------------------------
MNME_EXIS2      LILLVLNGND-ALTEEDVLLFEAIRG----------------------------------
MNME_STAAC      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAE      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAT      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAA3      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAA2      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAA9      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAR      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAW      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAN      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAA8      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAA1      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAM      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAS      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAAB      LILFVLNNNE-ALTQEDYTLYEVVKN----------------------------------
MNME_STAES      LILFVLNNNE-PLTEDDQTLFEVIKN----------------------------------
MNME_STAEQ      LILFVLNNNE-PLTEDDQTLFEVIKN----------------------------------
MNME_STAHJ      LILFVLNNNE-PLTQEDRTLYEVIKN----------------------------------
MNME_STAS1      LILFVLNYNE-RLTDEDRKLYEVIKN----------------------------------
MNME_LISMO      FILLVLNQNE-ELTVEDEALFEAAAG----------------------------------
MNME_LISMF      FILLVLNQNE-ELTVEDEALFEAAAG----------------------------------
MNME_LISIN      FILLVLNQNE-ELTVEDEALFEAAAG----------------------------------
MNME_LISW6      FILLVLNQNE-ELTVEDEALFEAAAG----------------------------------
MNME_ENTFA      LILLVLNQSE-ELTEEDRQLLEATKG----------------------------------
MNME_LACP3      LILLVLDQSE-PLTDEDEQLIQATAN----------------------------------
MNME_LACSS      LILLVLNQSE-PLTIEDRELITATTD----------------------------------
MNME_LACS1      LVMLVLNASE-ELTDEDKELIQATSG----------------------------------
MNME_LACPL      LVLLVLDNSQ-PLTAEDRELLQETDQ----------------------------------
MNME_LACBA      LVMLVLNASE-PLTAEDEALLTATKD----------------------------------
MNME_PEDPA      LVILVLDSSV-PLRDEDRELLRETNH----------------------------------
MNME_LACLM      LVLLVLDASL-ELTDKDLELLELSKN----------------------------------
MNME_LACLS      LVLLVLDASL-ELTDKDLELLELSKN----------------------------------
MNME_LACLA      LVLLVLDASN-ELTDKDLELLELSKN----------------------------------
MNME_STRA1      LVLLVLNSSE-PLTLQDRSLLELSKE----------------------------------
MNME_STRA5      LVLLVLNSSE-PLTLQDRSLLELSKE----------------------------------
MNME_STRA3      LVLLVLNSSE-PLTLQDRSLLELSKE----------------------------------
MNME_STRAG      LVLLVLNSSE-PLTLQDRSLLELSKE----------------------------------
MNME_STRTD      LVLLVLNSSE-PLTDQDRTLLDISQN----------------------------------
MNME_STRT1      LVLLVLNSSE-PLTDQDRTLLDISQN----------------------------------
MNME_STRT2      LVLLVLNSSE-PLTDQDRTLLDISQN----------------------------------
MNME_STRMU      LVLLVLNSAE-KLTDQDRTLLEISQN----------------------------------
MNME_STRP8      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRPD      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRP6      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRP3      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRPG      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRP1      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRPC      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRPM      LVLLVLNASE-KLTDQDRALLNLSQG----------------------------------
MNME_STRPF      LVLLVLNASE-KLTDQDRALLNLSQD----------------------------------
MNME_STRGC      LVLLVLNASE-PLTDQDKQLLEISQD----------------------------------
MNME_STRSV      LVLLVLNASE-PLTDQDRQLLEISKD----------------------------------
MNME_STRR6      LVLLVLNASE-PLTAQDRQLLEISQD----------------------------------
MNME_STRP2      LVLLVLNASE-PLTAQDRQLLEISQD----------------------------------
MNME_STRPI      LVLLVLNASE-PLTAQDRQLLEISQD----------------------------------
MNME_STRPN      LVLLVLNASE-PLTAQDRQLLEISQE----------------------------------
MNME_STRSY      LILLVLNASE-PLTEQDRNLLAISDM----------------------------------
MNME_STRS2      LILLVLNASE-PLTEQDRNLLAISDM----------------------------------
MNME_LACGA      LVLLLLDASQ-DLTAEDKRLLDLTAN----------------------------------
MNME_LACJO      LVLLLLDASQ-DLTDEDKNLLNLTAN----------------------------------
MNME_LACAC      LVLLLIDASK-ELTAEDKSLINETDS----------------------------------
MNME_LACH4      LVLLLIDASQ-ELTAEDKALIEETKD----------------------------------
MNME_LACDB      LILLLLDGSQ-ELTEEDRQLLELTAG----------------------------------
MNME_LACDA      LILLLLDGSQ-ELTEEDRQLLELTAG----------------------------------
MNME_MYCGE      LVIYLLDATH-PKK--DLELISFFKK----------------------------------
MNME_MYCPN      LVIYLLDARQ-PEP--DPKIIARLKK----------------------------------
MNME_MYCGA      LVIYLIDLNK-YQNYDKTNIYKYLIN----------------------------------
MNME_UREPA      LILYLIPANE-QQD---LELYDLIKK----------------------------------
MNME_UREP2      LILYLIPANE-QQD---LELYDLIKK----------------------------------
MNME_MYCPE      LILFLIDDSK-KIDKKEKEILNLIKN----------------------------------
MNME_MYCMS      LVLFVVNKEN-INDLDNQEIFELLKN----------------------------------
MNME_MYCCT      LVLFVVNKEN-INDLDNQEIFELLKD----------------------------------
MNME_MESFL      LVLFVVDFKS-INDEENKMIFDKLEN----------------------------------
MNME_MYCPU      IIIHLVLENQ-DEDDFERKIKEL--S----------------------------------
MNME_MYCMO      IILHIIQPNE-AENDFDKQIEIK--S----------------------------------
MNME_MYCAP      VVLHIYDPSQ-NDNEFDSQIKNKAHS----------------------------------
MNME_MYCS5      IVLHLFDNLN-SEDEFDLDIKKIVQE----------------------------------
MNME_MYCHJ      LILHIIDASEKNRQNLDLKAKTR-------------------------------------
MNME_MYCH2      LILHIIDASEKNRQNLDLKAKTR-------------------------------------
MNME_MYCH7      LILHIIDASEKNRQNLDLKAKAR-------------------------------------
MNME_CAMJE      IILAVFDASR-VQDKEDEKIFDLLANT---------------------------------
MNME_CAMJJ      IILAVFDASR-VQDKEDEKIFDLLANT---------------------------------
MNME_CAMJR      IILAVFDASR-VQDKEDEKIFDLLANT---------------------------------
MNME_CAMJ8      IILAVFDASR-VQDKEDEKIFDLLANT---------------------------------
MNME_CAMJD      IILAVFDASR-VQDKEDEKIFELLANT---------------------------------
MNME_CAMC5      IVLAVFDSSS-ASDEQDERIVELVKNS---------------------------------
MNME_CAMC1      IILAVFDGSC-PSDEQDKEIIRLISNS---------------------------------
MNME_CAMHC      IILAVFDASR-EFDKEDEKIFEILQNQK--------------------------------
MNME_CAMFF      IIFCVFDSSQ-KASLEDRQILEFISNL---------------------------------
MNME_SULDN      IVIALFDASR-VADYEDEQILSLIESKA--------------------------------
MNME_ARCB4      IVIALFDNSK-ICDDEDKKILDLIKENS--------------------------------
MNME_NITSB      IVIAMFDASK-PLDAEDKKILELIESYK--------------------------------
MNME_SULNB      IIIALFDGSR-EFDSEDEKILAIVDALQ--------------------------------
MNME_HELHP      IIVAIFDGSR-PFDAEDKAIMEILKTQC--------------------------------
MNME_WOLSU      MVLALFDSSQ-SLSPEDEQIKELLRAHQ--------------------------------
MNME_HELPY      IILGVFDLSK-PLEKEDFNLIDTLNRA---------------------------------
MNME_HELPJ      IILGVFDLSK-PLEKEDFNLMDTLNRT---------------------------------
MNME_HELPH      IILGVFDLSK-PLEKEDFTIIDALNRA---------------------------------
MNME_HELAH      IILSVFDLSK-PLEKEDFNIIDALNRT---------------------------------
MNME_ECOLI      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECOLC      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHIBS      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECODH      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHIFL      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHIF8      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHIDS      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECO57      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECOUT      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECOL5      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECOK1      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECOL6      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECOSM      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECO24      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ECOHS      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHISS      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SALCH      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SALPB      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SALTY      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SALPA      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SALTI      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SALAR      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_CITK8      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_ENT38      RVLFMVDGTTT-----SAVDP---------------------------------------
MNME_KLEP7      RVLFMVDGTTT-----SAVDP---------------------------------------
MNME_CROS8      RVLFMVDGTTT-----DATDP---------------------------------------
MNME_YERPA      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_YERPN      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_YERPP      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_YERPE      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_YERPS      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_YERP3      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_YERPY      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_YERE8      RVLFMVDGTTT-----DATEP---------------------------------------
MNME_SERP5      RVLFMVDGTTT-----AATEP---------------------------------------
MNME_PECAS      RVLFMVDGTTT-----QATEP---------------------------------------
MNME_PHOLL      RVLFMVDSTTT-----NAVEP---------------------------------------
MNME_SODGM      HVLLMVDGAAT-----PLSDP---------------------------------------
MNME_ACTP2      HVLLMIDSTEQ-----TAEAF---------------------------------------
MNME_ACTPJ      HVLLMIDSTEQ-----TAEAF---------------------------------------
MNME_HAEDU      HVLLMLDSTEQ-----SAYAF---------------------------------------
MNME_HAEI8      RIILMLDSSDP-----ESADL---------------------------------------
MNME_HAEIE      RIILMLDSSDP-----ESADL---------------------------------------
MNME_HAEIN      RIILMLDSSDP-----ESADL---------------------------------------
MNME_HAEIG      RIILMLDSSDP-----ESVDL---------------------------------------
MNME_MANSM      RVILMLDSTDP-----DSKDL---------------------------------------
MNME_ACTSZ      RVLLMLDSSDP-----DSRQP---------------------------------------
MNME_PASMU      RILLMLDSTEA-----DNQDL---------------------------------------
MNME_HAES1      RILLILDSTE------NQVEL---------------------------------------
MNME_HISS2      RILLILDSTE------NQVEL---------------------------------------
MNME_AERHH      RVLFMVDGTTT-----AAVDP---------------------------------------
MNME_AERS4      RVLFMVDGTTT-----DAIDP---------------------------------------
MNME_SHEB8      RVLFMVDGTTT-----AAVDP---------------------------------------
MNME_SHEB9      RVLFMVDGTTT-----AAVDP---------------------------------------
MNME_SHEB5      RVLFMVDGTTT-----AAVDP---------------------------------------
MNME_SHEPC      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHESW      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHESA      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHESM      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHESR      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHEON      RVLFMVDGTTT-----TAVDP---------------------------------------
MNME_SHEFN      RVLFMVDGTTT-----DAVNP---------------------------------------
MNME_SHEDO      RVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHEHH      RVLFMVDGTTT-----PAVDP---------------------------------------
MNME_SHEPA      RVLFMVDGTTT-----AAIDP---------------------------------------
MNME_SHESH      QVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHEWM      QVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHELP      QVLFMVDGTTT-----DAVDP---------------------------------------
MNME_SHEAM      RVLFMVDGTDT-----AAVDP---------------------------------------
MNME_VIBCH      RVLFMVDGTTT-----EATDP---------------------------------------
MNME_VIBC3      RVLFMVDGTTT-----EATDP---------------------------------------
MNME_VIBCB      RVLFMVDGTTT-----DATDP---------------------------------------
MNME_VIBPA      RVLFMVDGTTT-----DATDP---------------------------------------
MNME_VIBVU      RVLFMVDGTTT-----DATDP---------------------------------------
MNME_VIBVY      RVLFMVDGTTT-----DATDP---------------------------------------
MNME_ALIF1      RVLFMVDGTTT-----DATDP---------------------------------------
MNME_PHOPR      RVLFMVDGTTT-----NDTDP---------------------------------------
MNME_PSYIN      RILFMLDATTT-----SAEDP---------------------------------------
MNME_PSEA6      RVLFMLDSTET-----HENDP---------------------------------------
MNME_PSEHT      RVLFMLDGTDT-----IDTDP---------------------------------------
MNME_IDILO      RVLFMVDSQET-----SAIHP---------------------------------------
MNME_COLP3      RVLLMVDASED-----HSILEDDQDI----------------------------------
MNME_CHRSD      RVLLLVDATTT-----TQTDP---------------------------------------
MNME_MARMS      RILMMVDSQSI-----DSKDP---------------------------------------
MNME_MARHV      RILLMVDATTT-----DKTEP---------------------------------------
MNME_HAHCH      RILFLVDATQT-----NEVSP---------------------------------------
MNME_PSEAE      RVLLVVDATAP-----EAADP---------------------------------------
MNME_PSEAB      RVLLVVDATAP-----EAADP---------------------------------------
MNME_PSEA7      RVLLVVDATAP-----EAADP---------------------------------------
MNME_PSEPU      RVLLVVDSTAP-----EASDP---------------------------------------
MNME_PSEP1      RVLLVVDSTAP-----EASDP---------------------------------------
MNME_PSEPK      RVLLVVDSTAP-----EASDP---------------------------------------
MNME_PSEPG      RVLLVVDSTAP-----EASDP---------------------------------------
MNME_PSEPW      RVLLVVDSTAP-----EASDP---------------------------------------
MNME_PSEE4      RVLLVVDSTAP-----EASDP---------------------------------------
MNME_PSEF5      RVLLVVDATAA-----EAADP---------------------------------------
MNME_PSEPF      RVLLVVDATAP-----EAADP---------------------------------------
MNME_PSE14      RILLVVDATAP-----EAADP---------------------------------------
MNME_PSEU2      RILLVVDATAP-----EAADP---------------------------------------
MNME_PSESM      RILLVVDATAP-----EAADP---------------------------------------
MNME_PSEMY      RVLLVVDSTAP-----EAADP---------------------------------------
MNME_PSEU5      RILLVVDASAP-----EASDP---------------------------------------
MNME_SACD2      RILLLIDTTDN-----SQLDV---------------------------------------
MNME_HYDCU      RILVMVQANEA-----IHPED---------------------------------------
MNME_LEGPC      CVLLVVDINNP-----DQQNS---------------------------------------
MNME_LEGPH      CVLLVVDINNP-----DQQNS---------------------------------------
MNME_LEGPA      CVLLVVDINNR-----DQQNS---------------------------------------
MNME_LEGPL      CVLLVVDINNP-----DQQNS---------------------------------------
MNME_ALCBS      RLLVMVDSRDPLDDI-HNLHD---------------------------------------
MNME_METCA      CILLVCDARH--------------------------------------------------
MNME_NITOC      HVLLVADDQSGL------------------------------------------------
MNME_ALKEH      RVLLIQDIRE--------------------------------------------------
MNME_COXBU      LLLLMIDASKP------TEDF---------------------------------------
MNME_COXBN      LLLLMIDASKP------TEDF---------------------------------------
MNME_COXBR      LLLLMIDASKP------TEDF---------------------------------------
MNME_PSYCK      MLLMVYDVTRDLEEESTPLQLA--------------------------------------
MNME_PSYA2      ILLMVYDVTCDLEEEITPLQLA--------------------------------------
MNME_PSYWF      LLLLVYDLSQEVD----PLKLA--------------------------------------
MNME_ACIBY      LLLLVYDLNQGDD----PLKLA--------------------------------------
MNME_ACIBT      LLLLVYDLNQGDD----PLKLA--------------------------------------
MNME_ACIAD      LLLLVYDLSEGAD----PLALA--------------------------------------
MNME_DICNV      IVLLLADGSARDN---DARAE---------------------------------------
MNME_BORBR      LILHLQDV-------TQPPD----------------------------------------
MNME_BORPA      LILHLQDV-------TQPPD----------------------------------------
MNME_BORPE      LILHLQDV-------TQPPD----------------------------------------
MNME_BORPD      VILHLQDA-------TQPAD----------------------------------------
MNME_BORA1      LILHLQDA-------TAPGD----------------------------------------
MNME_CUPPJ      IVLHLVDATDY---LRHGLS----------------------------------------
MNME_CUPNH      IVLHLVDATDY---LRHGLS----------------------------------------
MNME_CUPMC      IVLHLIDAADY---IEHGIS----------------------------------------
MNME_RALSO      VVLHLLDAADY---RAHGLS----------------------------------------
MNME_BURM7      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURMA      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURP6      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURP0      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURMS      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURM9      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURPS      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURP1      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURTA      VVLHLLDA-------RSGLG----------------------------------------
MNME_BURCA      VVLHLLDS-------RTGMT----------------------------------------
MNME_BURCH      VVLHLLDS-------RTGMT----------------------------------------
MNME_BURCC      VVLHLLDS-------RTGMT----------------------------------------
MNME_BURL3      VVLHLLDS-------RNGMT----------------------------------------
MNME_BURCM      VVLHLLDS-------RTGMT----------------------------------------
MNME_BURA4      VVLHLLDS-------RTGMT----------------------------------------
MNME_BURVG      VVLHLLDS-------RTGMT----------------------------------------
MNME_PARXL      VVLHLLDA-------RTGMT----------------------------------------
MNME_JANMA      VIIHMLDA-------NRGPT----------------------------------------
MNME_HERAR      VIVHMLDA-------SRGPT----------------------------------------
MNME_ACISJ      AVLFLHDLT------RWGSA----------------------------------------
MNME_ACIAC      AVLFLHDLT------RAGQP----------------------------------------
MNME_VEREI      AVLFLHDLA------RAQTP----------------------------------------
MNME_RHOFT      AVLFLHDLT------RKNAT----------------------------------------
MNME_POLSJ      AVLFLHDLS------RRDAALPAQDTI---------------------------------
MNME_POLNA      AVLFLHDLA------RHDATENPLYAI---------------------------------
MNME_LEPCP      AVLLLHDLT------REHEP----------------------------------------
MNME_METPP      AVIFLHDLT------RAGDP----------------------------------------
MNME_NEIMA      VALVLVDP-------REGLNEK--------------------------------------
MNME_NEIMB      VALVLVDP-------REGLNEK--------------------------------------
MNME_NEIM0      VALVLVDP-------REGLNEK--------------------------------------
MNME_NEIMF      VALVLVDP-------REGVNDK--------------------------------------
MNME_NEIG1      VALVLVDP-------REGLNEK--------------------------------------
MNME_CHRVO      LALLLVDS-------REGLTAE--------------------------------------
MNME_AZOSB      VVLRVIDS-------EGAEEDAL-------------------------------------
MNME_AROAE      VILRIVDA-------RVGPQPG--------------------------------------
MNME_DECAR      VVLLLVDA-------RTGVSES--------------------------------------
MNME_NITEU      LVLLLVDS-------RHGVTE---------------------------------------
MNME_NITEC      LVLLLVDG-------RYGVTK---------------------------------------
MNME_NITMU      IVLLLVDS-------RVGITP---------------------------------------
MNME_THIDA      VALLLVDA-------AHGVGA---------------------------------------
MNME_METFK      VALLLVDA-------AHGIGK---------------------------------------
MNME_POLAQ      LVIFLGAPN-----AEPGHE----------------------------------------
MNME_FRATF      QVLFVTDDYTN-----SQVKFSDI------------------------------------
MNME_FRATH      QVLFVTDDYTN-----SQVKFSDI------------------------------------
MNME_FRATO      QVLFVTDDYTN-----SQVKFSDI------------------------------------
MNME_FRATT      QVLFVTDDYTN-----SQVKFSDI------------------------------------
MNME_FRAT1      QVLFVTDDYTN-----SQVKFSDI------------------------------------
MNME_FRATW      QVLFVTDDYTN-----SQVKFSDI------------------------------------
MNME_FRATN      QVLFVTDDYTN-----SQVKFSDI------------------------------------
MNME_FRAP2      QILFVTDDYTN-----SQVKFSDI------------------------------------
MNME_RUTMC      VVLMVFDAQDD-----KPD-----------------------------------------
MNME_VESOH      VVLMVFDAQDD-----KPD-----------------------------------------
MNME_XANAC      LALVVLDARDL-------------------------------------------------
MNME_XANC5      LALVVLDARDP-------------------------------------------------
MNME_XANOM      LALVVLDARDP-------------------------------------------------
MNME_XANOR      LALVVLDARDP-------------------------------------------------
MNME_XANCP      LALIVLDARDP-------------------------------------------------
MNME_XANC8      LALIVLDARDP-------------------------------------------------
MNME_XANCB      LALIVLDARDP-------------------------------------------------
MNME_XYLFA      LALVVLDACDP-------------------------------------------------
MNME_XYLFT      LALVVLDACDP-------------------------------------------------
MNME_BLOFL      HILWVIDSTDY-----SHNNSYNNII----------------------------------
MNME_BLOPB      HILWVIDPNDV-----TNKENDITLK----------------------------------
MNME_BAUCH      HILLVVDSSTT-----KLSEQ---------------------------------------
MNME_WIGBR      HILLIVDSNID-----KSNDI---------------------------------------
MNME_BUCCC      HIFLMFDVTKK-----KMINN---------------------------------------
MNME_BUCAI      HVLFVIDKTLS-----KSKQK---------------------------------------
MNME_BUCMP      HVLFVIDKTTK-----QSEQK---------------------------------------
MNME_BUCAP      HVLYVMDKTIS-----LEDQK---------------------------------------
MNME_BUCBP      HILFVIDGSRS-----VQNQL---------------------------------------
MNME_CAUVC      LR------LWVVDG---------FHV----------------------------------
MNME_CAUSK      LR------LWVIDAAM-------FHV----------------------------------
MNME_MARMM      LR------IGVADAR---------SD----------------------------------
MNME_RHORT      LT------LAVSDGT--------VEN----------------------------------
MNME_MAGSA      LR------LCVFDGT--------LYP----------------------------------
MNME_PARL1      LR------IVMVAPG--------VSG----------------------------------
MNME_NITWN      LV------LWLSDDHGGE------------------------------------------
MNME_NITHX      LV------LWLADDDNGVG-----------------------------------------
MNME_BRASO      LV------LWLSEHD---------------------------------------------
MNME_BRASB      LV------LWLTEDD---------------------------------------------
MNME_BRADU      LV------LWLVEGEQAADPASMRSL----------------------------------
MNME_RHOP5      LV------LWLLADDQV-------------------------------------------
MNME_RHOPS      LV------LWLGEGE---------------------------------------------
MNME_RHOP2      LV------LWLGADE---------------------------------------------
MNME_RHOPA      LV------LWLSTAT---------------------------------------------
MNME_RHOPB      LR------LWLVDAQAAGDGED--------------------------------------
MNME_METPB      LV------LHLVPADG--------------------------------------------
MNME_METRJ      LV------VALVPPGG--------------------------------------------
MNME_METS4      LV------LWLVPPEG--------------------------------------------
MNME_AZOC5      LV------LWLSDDGT--------------------------------------------
MNME_BEII9      LV------LWLSEAEA--------------------------------------------
MNME_RHIEC      LA------LLLVDMSNP-------------------------------------------
MNME_RHIL3      LV------LLLVDMTKP-------------------------------------------
MNME_SINMW      LV------LLLSEKPSD-------------------------------------------
MNME_RHIME      LV------LLLSEKPGH-------------------------------------------
MNME_AGRFC      LI------LILQDNDS--------------------------------------------
MNME_BRUC2      LV------LSLEDMSGP-------------------------------------------
MNME_BRUSU      LV------LSLEDMSGP-------------------------------------------
MNME_BRUA2      LV------LSLEDMSGP-------------------------------------------
MNME_BRUAB      LV------LSLEDMSGP-------------------------------------------
MNME_BRUME      LV------LSLEDMSGP-------------------------------------------
MNME_BRUO2      LV------LSLEDMSGP-------------------------------------------
MNME_BRUSI      LV------LSLEDMSGP-------------------------------------------
MNME_OCHA4      LV------LLLEDMNDP-------------------------------------------
MNME_BARHE      LV------ILVYDMQNP-------------------------------------------
MNME_BART1      LV------ILVYDIVNP-------------------------------------------
MNME_BARQU      LV------ILVYDMGNP-------------------------------------------
MNME_BARBK      LV------ILVDDMKNP-------------------------------------------
MNME_CHESB      LV------LLLEDVTNP-------------------------------------------
MNME_RHILO      LL------LLLEDILAP-------------------------------------------
MNME_HYPNA      LR------IHVIDGTDP-------------------------------------------
MNME_GRABC      LVLRTVDISTATEADF--------------------------------------------
MNME_ACICJ      LL-----ILCGAAPDF--------------------------------------------
MNME_GLUOX      VV------LHLIGPDE--------------------------------------------
MNME_ERYLH      IV------LWLGPEGE--------------------------------------------
MNME_NOVAD      LI------LWLGPEGL--------------------------------------------
MNME_SPHWW      IV------LWLGDPGC--------------------------------------------
MNME_SPHAL      IL------LWLGAPKE--------------------------------------------
MNME_ZYMMO      IL------LWLGQAEE--------------------------------------------
MNME_RUEST      IR------VFLAEED---------------------------------------------
MNME_RUEPO      LR------VFLTEDV---------------------------------------------
MNME_ROSDO      LR------VFLSGPD---------------------------------------------
MNME_RHOS4      LR------VFLLDDSG--------------------------------------------
MNME_RHOS1      LR------VFLLDDSG--------------------------------------------
MNME_RHOS5      LR------IFLLDQSG--------------------------------------------
MNME_DINSH      LR------IILIEDGR--------------------------------------------
MNME_JANSC      VR------ILLEIDDW--------------------------------------------
MNME_PARDP      LR------IHLSVDGV--------------------------------------------
MNME_RICAH      IKIIMFDAKKLDSSINEDITGLIDE-----------------------------------
MNME_RICFE      IKIIMFDAEKLDSSINEDIMNLINE-----------------------------------
MNME_RICRO      IKIIMFDAEKLDSSINEDIINLIDE-----------------------------------
MNME_RICRS      IKIIMFDAEKLDSSINEDIINLIDE-----------------------------------
MNME_RICCN      IKIIMFDAEKLDSSINEDIINLIDE-----------------------------------
MNME_RICM5      IKIIMFDAEKLDSSINEDIINLIDE-----------------------------------
MNME_RICCK      IKIIMFDAEKLDSSINEGIIDLIDE-----------------------------------
MNME_RICPR      IKIVMFDAEKLDSSINNDITGLIDE-----------------------------------
MNME_RICTY      IKIIMFDAEKLDLSINNDIIDLIDE-----------------------------------
MNME_RICB8      IKIVMFDAETLDSAVNEDITGLIDE-----------------------------------
MNME_RICBR      IKIVMFDAETLDSAVNEDITGLIDE-----------------------------------
MNME_ORITB      IRILMIDATNINSVNQTIAHLLNDV-----------------------------------
MNME_ANAMM      IRIMLFPHSEAGNLGVHEAIEGGDDG----------------------------------
MNME_ANAPZ      IKIVMYPYETTSMQGIDPICDLQDE-----------------------------------
MNME_EHRCJ      FKIVMLPYEKRNVFNNEIMNLID-------------------------------------
MNME_EHRCR      FKIVMLPYEKRDIFNREIMSLID-------------------------------------
MNME_EHRRW      FKIIMLPYEKKDALNNEIIDLID-------------------------------------
MNME_EHRRG      FKIIMLPYEKKDALNNEIIDLID-------------------------------------
MNME_WOLTR      LRIELFPFEQRYNINCNVI-----------------------------------------
MNME_WOLPM      LRIELFPFEQRHDVNYQATGNIPSVVDTQLCKYCNQQTVSSQCLTLGSRYKNTCKLCNRQ
MNME_NEOSM      VIVFLRDITELHLTNVRREDVANSVIERHLDRQVAALGSREHIQIDQRHVDKLIGSSDWA
MNME_PELUB      LKLIVIDAKSIDFKGVLKELMDE-------------------------------------
MNME_DEIRA      LVLVLEDGS---------------------------------------------------
MNME_DEIGD      LVLVLEDGS---------------------------------------------------
MNME_THET8      LVLYVVDRS---------------------------------------------------
MNME_THET2      LVLYVVDRS---------------------------------------------------
MNME_HALHL      LLLVVIEAG---------------------------------------------------
MNME_MYXXD      LAVLVLPPG---------------------------------------------------
MNME_RHOBA      VHVWCIDATGGDG-----------------------------------------------
MNME_AQUAE      LILFVIDASQE-------------------------------------------------
MNME_MAGMM      GIVFVAEAQLG-------------------------------------------------
MNME_KORVE      LVLVVVDAHAE-------------------------------------------------
MNME_SOLUE      LALVVLDLTRP-------------------------------------------------
MNME_CHLTR      GILWVVDASQPLP-EFPTILYQKP------------------------------------
MNME_CHLTB      GILWVVDASQPLP-EFPTILYQKP------------------------------------
MNME_CHLT2      GILWVVDASQPLP-EFPTILYQKP------------------------------------
MNME_CHLTA      GILWVVDASQPLP-EFPTILYQKP------------------------------------
MNME_CHLMU      GILWVMDASQPVP-EFPAILYQKP------------------------------------
MNME_CHLCV      GILWVMDATQPPP-SLPEILFQKP------------------------------------
MNME_CHLFF      GILWVMDATQPPP-PLPEILFQKP------------------------------------
MNME_CHLAB      AILWVMDASQPPP-PLPEILMRKP------------------------------------
MNME_CHLPN      GILWVIDATQPLE-DLPKILFTKP------------------------------------
MNME_PARUW      LILLVLDAHKGLEKEDQELLKQVPF-----------------------------------
MNME_OPITP      LVLAIVDLSDPEPSLPPELAKRLDP-----------------------------------
MNME_BDEBA      VVFFVYDIEKGLGAEELQILESLDP-----------------------------------
MNME_DESHY      LILLIIQAGQELKAEELKILSQYD------------------------------------
MNME_ALKMQ      LIILMLDASRELTPEDLQ-IMELVK-----------------------------------
MNME_ALKOO      LIIVMLDASRELTEEDLR-IIELIE-----------------------------------
MNME_CLOD6      LIVMVLDASRKLSEEDIE-ILEKLK-----------------------------------
MNME_FINM2      LIIAIFDSSREFDDEDRK-ILDLIR-----------------------------------
MNME_FUSNN      LILYVIDTSREIDEEDFR-IYDIIN-----------------------------------
MNME_CLOB1      LVIFMLDLSRKIDEEDIE-IMDFIK-----------------------------------
MNME_CLOBK      LVIFMLDLSRKIDEEDIE-IMDFIK-----------------------------------
MNME_CLOBH      LVIFMLDLSRKIDEEDIE-IMDFIK-----------------------------------
MNME_CLOBL      LVIFMLDLSKKIDEEDIE-IMDFIK-----------------------------------
MNME_CLOBM      LVIFMLDLSRKIDEEDIE-IMDFIK-----------------------------------
MNME_CLOK5      LVILMLDSSKELDEEDKE-IINYVN-----------------------------------
MNME_CLOTE      LVILVLDSSNKLNDEDYE-IIEYIK-----------------------------------
MNME_CLONN      LTVLVLDNSRGLDDEDKE-IINFIK-----------------------------------
MNME_CLOAB      LIIFMIDSSKKIDAEDLE-IIDYIK-----------------------------------
MNME_CLOPE      LVILMLDTSRELDEEDKE-IIDYIK-----------------------------------
MNME_CLOP1      LVILMLDTSRELDEEDKE-IIDYIK-----------------------------------
MNME_CLOPS      LVILMLDTSRELDEEDKE-IIDYIK-----------------------------------
MNME_CLOB8      LIILMLDASRYIDEEDSR-IINKIK-----------------------------------
MNME_LACP7      LIICVIDASTPLNQDDKE-ILEFIK-----------------------------------
MNME_THEP3      LILFVLDASRELTKEDYE-IFDILT-----------------------------------
MNME_THEPX      LILFVLDASRELTKEDYE-IFDILT-----------------------------------
MNME_CALS4      LILFVLDASRDLTKEDYE-IFDILS-----------------------------------
MNME_HUNT2      LVIMMIDAKRGMDEDDNR-ILTMLG-----------------------------------
MNME_CARHZ      VTLFVVDVSIGIDEDDEK-ILSLIN-----------------------------------
MNME_DESRM      IVLFVLDATTGISDEDRK-VIDLIK-----------------------------------
MNME_PELTS      LVLLVLDAARGLTEEDYA-IIEKVG-----------------------------------
MNME_CALS8      LVIFMIE-SDGITKEDIE-IFSSIK-----------------------------------
MNME_SYNWW      LVLFILDVGTGIDQEDRK-IYEKIE-----------------------------------
MNME_NATTJ      IILVVIDSSQELSQEDKQ-ILTMAQ-----------------------------------
MNME_DESPS      LVLFMVDGSRQLDQSDLE-LYEDIA-----------------------------------
MNME_MOOTA      LVLVVVDLQTGIQDEDRR-VLESVR-----------------------------------
MNME_DESAP      MVLVVLDAASGLEDEDRR-VLALAR-----------------------------------
MNME_ROSS1      LALLVVDVSLPVADDDRE-IVALTE-----------------------------------
MNME_ROSCS      LLLLVVEGVSQPVDDDRE-IVALTR-----------------------------------
MNME_CHLAA      LALLVFDSSQPFTPEDEA-MLVATA-----------------------------------
MNME_SYMTH      LVLVVVDAAAGLGPEDREWISQLPQ-----------------------------------
MNME_HELMI      LALVVLDGSDSLTAEDET-LLLSLA-----------------------------------
MNME_GEOSL      LVLLVIDGSRPLDEDDRM-ILSALA-----------------------------------
MNME_GEOMG      LILFVLDGSRPFDDDDRM-ILAALA-----------------------------------
MNME_GEOUR      LVLFIIDSSLPFSSEDQA-ILDVLA-----------------------------------
MNME_PELPD      LILFVLDGSRPFGPEDRL-ILDALQ-----------------------------------
MNME_PELCD      LVLLVIDGSQEMGEDDLL-ALEFCR-----------------------------------
MNME_SYNAS      GVILLLDGSKDLTDEDRK-ILKRLQ-----------------------------------
MNME_SYNFM      IVLCVMDRSRPLSAEDDA-VVEAVA-----------------------------------
MNME_DESVH      LVLLVTDATQGLQGPELE-LLRHAG-----------------------------------
MNME_DESVV      LVLLVTDATQGLQGPELE-LLRHAG-----------------------------------
MNME_DESAG      LVLLVVDSRLGTGPHEQE-LMAAME-----------------------------------
MNME_LAWIP      VILFIIDGTVGVTEESKL-LINNFG-----------------------------------
MNME_NOSS1      LVLLTIDAATGWTTGDQE-IYEQVK-----------------------------------
MNME_TRIV2      LVLLTIDAATGWTTGDQE-IYEQVK-----------------------------------
MNME_TRIEI      IVLLTIDAQVGWTELDEV-IYQQVK-----------------------------------
MNME_ACAM1      LVLLTIDASVGWTSDDQQ-LYQAFQ-----------------------------------
MNME_SYNY3      LVLLTVDAHQGWTEADQL-IYEQVK-----------------------------------
MNME_MICAN      LVLLTVSAESGWTQEDEE-IYRSVS-----------------------------------
MNME_SYNP2      LILFTIDAAVGWTAADQE-IFQRIVATK--------------------------------
MNME_SYNE7      LVLLTIDASAGWSAEDQT-IWEAVS-----------------------------------
MNME_SYNP6      LVLLTIDASAGWSAEDQT-IWEAVS-----------------------------------
MNME_THEEB      LILLVIDASQGWTAADQA-IYDQLQLKQRRQQ----------------------------
MNME_SYNJA      VLVLVIDAQAGWTEADAA-IYASIR-----------------------------------
MNME_SYNJB      VLVLVIDAQAGWTAADAA-IYESIR-----------------------------------
MNME_GLOVI      LVLLVIDRTEGWTCADSD-IFAQVR-----------------------------------
MNME_PROM1      LIILIFDYSSGWTNEDES-ILKQLP-----------------------------------
MNME_PROMT      LIILIFDYSSGWTNEDES-ILKQLP-----------------------------------
MNME_PROMA      IVVLIFDLSKGWNKNDQN-LLEKIP-----------------------------------
MNME_PROM3      VAVLVFDLSLGWTADDAA-LLAQIP-----------------------------------
MNME_PROMM      VAVLVFDLSLGWTADDAA-LLAQIP-----------------------------------
MNME_SYNSC      VVLLVLDGHAGWTAEDAA-LLARIP-----------------------------------
MNME_SYNPX      VVLLVLDGHAGWTAEDAA-LLARIP-----------------------------------
MNME_SYNS9      VVVLIVDGHAGWTETDAQ-LLARIP-----------------------------------
MNME_SYNPW      LVLLLFDLSVGWTPDDEA-LRQRIP-----------------------------------
MNME_SYNS3      LVLLLFDLAQGWSDDDQA-LFALIP-----------------------------------
MNME_SYNR3      AVVLLYDLSRGWSPDDSA-LRNEVP-----------------------------------
MNME_PROMS      FIIYIYSLEEGFNEEDKK-IIQEIP-----------------------------------
MNME_PROM0      FIIYIYSLEEGFNEEDKK-IIQEIP-----------------------------------
MNME_PROM2      FIIYIYSLEEGFNEEDKK-IIQEIP-----------------------------------
MNME_PROM9      FIIYIYSLEEGFNKEDKK-IIQEIP-----------------------------------
MNME_PROM5      YIIYLYSLEDGFNKDDEE-IISKIP-----------------------------------
MNME_PROMP      YIIYLYSLEEGLNKDDEK-IISKIP-----------------------------------
MNME_CYACA      IVFFVLDAIQGLSSEDSV-IFNKLNL----------------------------------
MNME_CYAM1      LILWIIDATSPNLPIPPY-LLN--------------------------------------
MNME_BACFR      IVLWMIDSAD-AISQL--------------------------------------------
MNME_BACFN      IVLWMIDSAD-AISQL--------------------------------------------
MNME_BACTN      IVLWMVDSSD-ASSQI--------------------------------------------
MNME_BACV8      VILWMIDSTD-AQRRF--------------------------------------------
MNME_PARD8      IVILMYDLTR-DLKDF--------------------------------------------
MNME_PORGI      IILAVVDGTRISEANQ--------------------------------------------
MNME_FLAJ1      VVIYLFDGLKFKASS---------------------------------------------
MNME_FLAPJ      VVVFLFDSSEFKISG---------------------------------------------
MNME_GRAFK      VVVYLVDSSQIAVNRERL------------------------------------------
MNME_CYTH3      LVIYLFDVKSTSERE---------------------------------------------
MNME_SALRD      VLFYLYDLTVGLDSQE--------------------------------------------
MNME_CHLTE      LILYLLDLGTERLDDE--------------------------------------------
MNME_CHLPD      LLLYLLDLSREGMAEE--------------------------------------------
MNME_CHLPM      LMLYIIDSSEGDMQQE--------------------------------------------
MNME_PELLD      LILYMLDVSGEGFREE--------------------------------------------
MNME_CHLCH      VVLYLLDVSHPDYCNE--------------------------------------------
MNME_BORAP      LVIYVIDISSNLTRDD--------------------------------------------
MNME_BORBU      LVIYVIDVSSNLTKDD--------------------------------------------
MNME_BORBP      LVIYVIDVSSNLPRED--------------------------------------------
MNME_TREPA      CVFYIINGR-----AG--------------------------------------------
MNME_TREDE      LILYLCDPKDILSAGS--------------------------------------------
MNME_LEPBJ      IRLFLIDVSKKEEWKKFIAKAKGR------------------------------------
MNME_LEPBL      IRLFLIDVSKKEEWKKFIAKAKGR------------------------------------
MNME_LEPIN      IRLFLVDVSKKENWKEFINKSRER------------------------------------
MNME_LEPIC      VRLFLVDVSKKENWKEFINKSRER------------------------------------
MNME_LEPBA      VKLFLIDTSLPFEKQSFLLKHKDR------------------------------------
MNME_LEPBP      VKLFLIDTSLPFEKQSFLLKHKDR------------------------------------
MNME_UNCTG      ILIWLFDSSSEPDCNDAKIADFLKKSD---------------------------------
MNME_SULMW      LILYVFDDLNEKFILKKVK-SLQEKYP---------------------------------
MNME_CARRP      LILYMIDKFNIKNIFFNIPIDFIDKIK---------------------------------
                                                                            

MNME_THEMA      -------------------------NKRYLVVINKVDVVEKINEEEI--KNKLGTD----
MNME_THESQ      -------------------------NKRYLVVINKVDVVEKINEEEI--KNKLGTD----
MNME_THEP1      -------------------------NKRYLVVINKVDVVEKINEEEI--KNKLGTD----
MNME_FERNB      -------------------------DCNFIPVWNKIDIAEKVDKD-------IVFL----
MNME_THEM4      -------------------------GGNYIPVWNKCDEGNNFNK----------IF----
MNME_PSELT      -------------------------EKKYIVVINKIDATDLIDREEL--KKILGTN----
MNME_PETMO      ------------------------GDKTVIIILNKSDSPNFTENNYL--SLKQKNP----
MNME_AYWBP      ------------------------YP--RIIIGNKVDLKSDKLISSLCDYSSQLTP----
MNME_ONYPE      ------------------------HP--RIIIGNKADLKSDKLISSLSNNSSQLAP----
MNME_ACHLI      ------------------------KN--RIIIGNKKDL------------PSYLEI----
MNME_BACAN      ------------------------KD--FIVIVNKTDLPQAIDMER---VIELAAG----
MNME_BACHK      ------------------------KD--FIVIVNKTDLPQAIDMER---VIELAAG----
MNME_BACCZ      ------------------------KD--FIVIVNKTDLPQAIDMER---VIELAAG----
MNME_BACAH      ------------------------KD--FIVIVNKTDLPQAIDMER---VIELAAG----
MNME_BACC1      ------------------------KD--FIVIVNKTDLPQAIDMER---VIELAAG----
MNME_BACCR      ------------------------KD--FIVIVNKTDLPQAIDMER---VTELAAG----
MNME_BACMK      ------------------------KD--FIVIVNKTDLPQEIDMER---VTDLAVG----
MNME_BACCN      ------------------------KD--FIVIVNKTDLPQKIEMER---VTELASE----
MNME_BACSU      ------------------------MD--VIVILNKTDLEPKIDTER---VRELANG----
MNME_BACVZ      ------------------------MD--VIVIMNKTDLEAKIDAER---VKELAKG----
MNME_BACP2      ------------------------MD--IIVIVNKTDLEPKLDVEK---VKQLAKD----
MNME_BACLD      ------------------------MD--IIVIVNKTDLEQKLDLDR---VRELAGN----
MNME_GEOKA      ------------------------MD--AIVIVNKTDLPRRIDMER---VKELAAG----
MNME_GEOTN      ------------------------MD--VIVIVNKTDLPQNIDIER---VKELAAG----
MNME_LYSSC      ------------------------MD--YIVIINKTDLPQKINLAR---VKELAGK----
MNME_OCEIH      ------------------------LE--YIVIINKTDLEQQLDLDE---VREFAKD----
MNME_BACSK      ------------------------LD--VVVIVNKIDQTGRIDMER---VRQLAGE----
MNME_BACHD      ------------------------ME--AIVIVNKTDVEQKIDLTR---VRELAAG----
MNME_EXIS2      ------------------------MN--AIIIVNKSDLTQAIDLTR---VSELADG----
MNME_STAAC      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAE      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAT      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAA3      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAA2      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAA9      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAR      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAW      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAN      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAA8      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAA1      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAM      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAS      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAAB      ------------------------ED--VIVIVNKMDLEQNIDINE---VKDMIGD----
MNME_STAES      ------------------------ED--VIVIINKTDLEQRLDVSE---LREMIGD----
MNME_STAEQ      ------------------------ED--VIVIINKTDLEQRLDVSE---LREMIGD----
MNME_STAHJ      ------------------------ED--AIVIVNKTDLEQNLDINE---VKEMIGD----
MNME_STAS1      ------------------------ED--AIVIVNKMDLDKHLDLDE---VKDMIGD----
MNME_LISMO      ------------------------HN--YVVVLNKTDLETKLDIDR---VRELAGE----
MNME_LISMF      ------------------------HN--YVVVLNKTDLETKLDIDR---VRELAGE----
MNME_LISIN      ------------------------HN--YVVVLNKTDLETKLDINR---VRELAGE----
MNME_LISW6      ------------------------HN--YVVVLNKTDLETKLDINK---VRELAGE----
MNME_ENTFA      ------------------------LK--RVILLNKMDLPTKLDPNE---LQELVPA----
MNME_LACP3      ------------------------KK--RIIVLNKQDLPAQLDTTA---LLKLVSP----
MNME_LACSS      ------------------------KK--RIIILNKTDLPNQLDLDE---LQTLVRA----
MNME_LACS1      ------------------------KK--RIVILNKTDLPQKLNMDE---VRELVPE----
MNME_LACPL      ------------------------SK--RIVILNKTDLPARLDQAE---LAQLVDL----
MNME_LACBA      ------------------------TQ--RILILNKTDLPLQLDLAA---VRQVAGD----
MNME_PEDPA      ------------------------MQ--RIVVLNKSDLEVKINLNE---LQEYVDD----
MNME_LACLM      ------------------------AN--RIVLLNKTDLPEKLDINQ---ISG--------
MNME_LACLS      ------------------------AN--RIVLLNKTDLPEKLDINQ---ISG--------
MNME_LACLA      ------------------------SN--RIVLLNKTDLPEKIDSTQ---ISG--------
MNME_STRA1      ------------------------SN--RIVLLNKTDLPQKIEVNE---LPK--------
MNME_STRA5      ------------------------SN--RIVLLNKTDLPQKIEVNE---LPK--------
MNME_STRA3      ------------------------SN--RIVLLNKTDLPQKIEVNE---LPE--------
MNME_STRAG      ------------------------SN--RIVLLNKTDLPQKIEVNE---LPE--------
MNME_STRTD      ------------------------SN--RIILLNKTDLPQAIQTEE---LPE--------
MNME_STRT1      ------------------------SN--RIILLNKTDLPQAIQTEE---LPE--------
MNME_STRT2      ------------------------SN--RIILLNKTDLPQAIQTEE---LPE--------
MNME_STRMU      ------------------------SN--RLILLNKTDLPEQIETDQ---LPE--------
MNME_STRP8      ------------------------SN--RIILLNKTDLEQKIELEQ---LPD--------
MNME_STRPD      ------------------------SN--RIILLNKTDLEQKIELEQ---LPD--------
MNME_STRP6      ------------------------SN--RIILLNKTDLEQKIELEQ---LPD--------
MNME_STRP3      ------------------------SN--RIILLNKTDLEQKIELEQ---LPD--------
MNME_STRPG      ------------------------SN--RIILLNKTDLEQKIELEQ---LPD--------
MNME_STRP1      ------------------------SN--RIILLNKTDLEQKIELEQ---LPD--------
MNME_STRPC      ------------------------SN--RIILLNKTDLEQKIELEQ---LPA--------
MNME_STRPM      ------------------------SN--RIILLNKTDLEQKIELEQ---LPA--------
MNME_STRPF      ------------------------SN--RIILLNKTDLEQKIELEQ---LPA--------
MNME_STRGC      ------------------------SN--RIVLLNKTDLEEKIELDQ---LPT--------
MNME_STRSV      ------------------------SN--RIVLLNKTDLEEKIELDL---LPT--------
MNME_STRR6      ------------------------TN--RIILLNKTDLPETIETSK---LPE--------
MNME_STRP2      ------------------------TN--RIILLNKTDLPETIETSK---LPE--------
MNME_STRPI      ------------------------TN--RIILLNKTDLPETIETSK---LPE--------
MNME_STRPN      ------------------------TN--RIILLNKTDLPETIETSE---LPE--------
MNME_STRSY      ------------------------AN--RIVLLNKTDLEEQIEVDQ---LPE--------
MNME_STRS2      ------------------------AN--RIVLLNKTDLEEQIEVDQ---LPE--------
MNME_LACGA      ------------------------KK--RIIILNKQDLGTKISQEM---IKDITD-----
MNME_LACJO      ------------------------KK--RIIILNKQDLGTKISQEM---IREITD-----
MNME_LACAC      ------------------------KK--RIIILNKSDLGQKITVEQ---MKKLTG-----
MNME_LACH4      ------------------------KK--RIIVLNKSDLGQKITVDE---MKKQTG-----
MNME_LACDB      ------------------------KK--RIIVLNKTDLGQKLTAAE---IAKESG-----
MNME_LACDA      ------------------------KK--RIIVLNKTDLGQKLTAAE---IAKESG-----
MNME_MYCGE      ------------------------NKKDFFVFYNKKD---------------LITN----
MNME_MYCPN      ------------------------LKKDFFLVHNKAD---------------LVQQ----
MNME_MYCGA      ------------------------KKKQFVLVGNKVDEVDPT----------LNTG----
MNME_UREPA      ------------------------QK--HLLVYTKKDLVD-------------QYD----
MNME_UREP2      ------------------------QK--HLLVYTKKDLVD-------------QYD----
MNME_MYCPE      ------------------------KN--YIIVKNKSD-LKVN----------ANSE----
MNME_MYCMS      ------------------------KT--YILIVNKAEKLSKTEKQN-----LEKKY----
MNME_MYCCT      ------------------------KT--YILIVNKAEKLSQTEKQN-----LEKKY----
MNME_MESFL      ------------------------KN--YILVFNKSEFINDIERNK-----IKDLH----
MNME_MYCPU      ------------------------EGKKYIRVINKKDLIS-----------KDKIK----
MNME_MYCMO      ------------------------KNKIYLKILNKKDLIK-----------NHNKQ----
MNME_MYCAP      ------------------------LNKIYVPVINKKDLLE-----------TTN------
MNME_MYCS5      ------------------------NNKNYIKVVNKSDLKS-----------DIKWS----
MNME_MYCHJ      ------------------------PDQIYLKIYNKSDLLE-----------NQEEF----
MNME_MYCH2      ------------------------PDQIYLKIYNKSDLLE-----------NQEEF----
MNME_MYCH7      ------------------------PDQVYLKIYNKSDLLE-----------NQEEF----
MNME_CAMJE      -------------------------DKKIFWILNKSDLENVFKNT---QNK---------
MNME_CAMJJ      -------------------------DKKIFWILNKSDLENVFKNT---QNK---------
MNME_CAMJR      -------------------------DKKIFWILNKSDLENVFKNT---QNK---------
MNME_CAMJ8      -------------------------DKKIFWILNKSDLENVFKNT---QNK---------
MNME_CAMJD      -------------------------DKKIFWILNKSDLENVFKNT---RNK---------
MNME_CAMC5      -------------------------GKKVFFILNKSDLAFKFDL----DLS---------
MNME_CAMC1      -------------------------NKKAFFILNKSDLAFKFDI----ELD---------
MNME_CAMHC      -------------------------DKKIIKILNKIDLALKFKAG---NSD---------
MNME_CAMFF      -------------------------NKKTIYVLNKSDLEFKFDI-----SL---------
MNME_SULDN      ------------------------GSKNVLHVKNKIDLEEKFYRSSL-EFD---------
MNME_ARCB4      -------------------------DKKVIVVLNKSDLQNQFDKNVL-DSF---------
MNME_NITSB      ------------------------DQKEFIVVANKVDKGKHLDLSDF-DA----------
MNME_SULNB      -------------------------DKHIIVAINKSDLEMKLDGDRI-NSY---------
MNME_HELHP      ------------------------QNKYILVIINKSDLPLQCEEELL-HNLLRLHN----
MNME_WOLSU      ------------------------ENRRILVLFNKSDLSRELQDSEL-ESYPHRY-----
MNME_HELPY      -------------------------KKPCIVVLNKNDLAPKLELEIL-KSYLKIPY----
MNME_HELPJ      -------------------------KKPCIVVLNKNDLAPKLELEIL-KSYLKIPY----
MNME_HELPH      -------------------------KKPCIVVLNKNDLAPKLELEIL-KSHLKIPY----
MNME_HELAH      -------------------------KKPCIVVLNKNDLSPKLELEVL-KSHLQIPY----
MNME_ECOLI      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECOLC      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_SHIBS      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECODH      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_SHIFL      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_SHIF8      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_SHIDS      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGISEVNG-----
MNME_ECO57      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECOUT      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECOL5      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECOK1      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECOL6      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECOSM      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECO24      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_ECOHS      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_SHISS      --------AEIWPEFIARLPA----KLPITVVRNKADITGET-----LGMSEVNG-----
MNME_SALCH      --------ADIWPDFIARLPK----NLPITVVRNKADITGET-----LGISEVNG-----
MNME_SALPB      --------ADIWPDFIARLPK----NLPITVVRNKADITGET-----LGISEVNG-----
MNME_SALTY      --------ADIWPDFIARLPK----NLPITVVRNKADITGET-----LGISEVNG-----
MNME_SALPA      --------ADIWPDFIARLPK----NLPITVVRNKADITGET-----LGISEVNG-----
MNME_SALTI      --------ADIWPDFIARLPK----NLPITVVRNKADITGET-----LGISEVNG-----
MNME_SALAR      --------GDIWPDFIARLPK----NLPITVVRNKADITGEM-----LGISEVNG-----
MNME_CITK8      --------AEIWPDFIARLPA----KLPITVVRNKADITGET-----LGISEVNG-----
MNME_ENT38      --------ADIWPDFIARLPA----KLPITVVRNKADMTGET-----LGLSDVNG-----
MNME_KLEP7      --------AEIWPDFIERLPA----KLPITVVRNKADVTGEA-----LGISEVNG-----
MNME_CROS8      --------AQIWPDFIARLPA----KLPITVVRNKADVTGEQ-----PGISEVNG-----
MNME_YERPA      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTKVNG-----
MNME_YERPN      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTKVNG-----
MNME_YERPP      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTKVNG-----
MNME_YERPE      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTKVNG-----
MNME_YERPS      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTKVNG-----
MNME_YERP3      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTEVNG-----
MNME_YERPY      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTEVNG-----
MNME_YERE8      --------AAIWPEFMARLPA----TLPITVVRNKADITGET-----LGLTEVNG-----
MNME_SERP5      --------AEIWPEFMARLPH----RLPITVVRNKADITGET-----LGMTEVNG-----
MNME_PECAS      --------EQIWPEFMARLPK----TLPITVVRNKADVTGET-----LGIADVNT-----
MNME_PHOLL      --------VEIWPEFMARLPK----SLPITVVRNKTDMTDEE-----TSIAEVSG-----
MNME_SODGM      --------DMLWPAFIARLPS----GMPVTVVRNKADLTGES-----VAISDISG-----
MNME_ACTP2      --------KTEWADFLAKLPQ----SIPVTVIRNKVDLSGEA-----EGLQELDG-----
MNME_ACTPJ      --------KTEWADFLAKLPQ----NIPVTVIRNKVDLSGEA-----EGLQELDG-----
MNME_HAEDU      --------KTEWAEFLAKLPP----KMPITIIRNKVDLSGEV-----EGLTQLDG-----
MNME_HAEI8      --------SKVRSEFLAKLPS----TLPVTIVRNKIDLNGEQ-----ASESEQGG-----
MNME_HAEIE      --------SKVRSEFLAKLPS----TLPVTIVRNKIDLNGEQ-----ASESEEGG-----
MNME_HAEIN      --------SKVRSEFLAKLPS----TLPVTIVRNKIDLNGEQ-----ASESEQGG-----
MNME_HAEIG      --------SKVRSEFLAKLPS----TLPVTIVRNKIDLNGEQ-----ASESEQSG-----
MNME_MANSM      --------DQAKAEFLSKLPG----NIPVTIVRNKSDLSGEK-----ESIEEQEG-----
MNME_ACTSZ      --------EKVRSEFLAKLPS----HIPVTIIRNKTDLSGEN-----EGVTQENG-----
MNME_PASMU      --------EKVRSEFLTKLPS----NIPVTIVRNKADLSGEN-----EGIVEQNG-----
MNME_HAES1      --------DLVQSEFMAKLPP----HIPLTIVRNKADLSGEA-----EVLDEQNG-----
MNME_HISS2      --------DLVRSEFMAKLPP----HIPLTIVRNKADLSGEA-----EVLNEQNG-----
MNME_AERHH      --------REIWPEFVDRLPK----KIGLTVVRNKADLTGED-----LAPSQELG-----
MNME_AERS4      --------REIWPEFVDRLPK----DIGLTVVRNKADLTGED-----LAPSQELG-----
MNME_SHEB8      --------HTIWPDFVDRLPS----NLGVTVIRNKADLTGED-----LMMTEEQG-----
MNME_SHEB9      --------HTIWPDFVDRLPS----NLGVTVIRNKADLTGED-----LMMTEEQG-----
MNME_SHEB5      --------HAIWPDFVDRLPS----NLGVTVIRNKADLTGED-----LMMTEEQG-----
MNME_SHEPC      --------HDIWPDFINRLPA----NLGVTVIRNKADLTGEN-----LDMTEEKG-----
MNME_SHESW      --------HDIWPDFINRLPA----NLGVTVIRNKADLTGEN-----LDMTEEKG-----
MNME_SHESA      --------HDIWPDFINRLPA----NLGVTVVRNKADLTGEN-----LAMTEEKG-----
MNME_SHESM      --------HDIWPDFIDRLPA----NLGVTVVRNKADLTGEN-----LAMTEEKG-----
MNME_SHESR      --------HDIWPDFINRLPA----NLGVTVVRNKADLTGEN-----LAMTEEKG-----
MNME_SHEON      --------HDIWPDFINRLPT----NLGVTVIRNKADLTGEN-----LEMTEEKG-----
MNME_SHEFN      --------HEIWPDFIDRLPA----KLGVTVVRNKADLTGET-----LDKTEEQG-----
MNME_SHEDO      --------HDIWPDFIDRLPT----RLGVTVVRNKADLTGES-----LEKSQEQG-----
MNME_SHEHH      --------HEIWPDFIDRLPN----NLGVTVVRNKADLTGED-----LAITTEAG-----
MNME_SHEPA      --------HEIWPDFIDRLPS----NLGVTVVRNKADLTGED-----LSVTQEAG-----
MNME_SHESH      --------HEIWPDFIDRLPE----KLGITVVRNKADITGEA-----LTVTQDHG-----
MNME_SHEWM      --------REIWPDFIDRLPK----NLGITVVRNKADITGEP-----LTVTQDHG-----
MNME_SHELP      --------HDIWPDFIDRLPK----NLGVTVVRNKADLTGES-----LDATDEQG-----
MNME_SHEAM      --------HEIWPDFIDRLPK----AMGVTVVRNKADLTGEP-----LEATEEQG-----
MNME_VIBCH      --------QDIWPDFVDKLPE----NIGITVIRNKADQTGEP-----LGICHVNQ-----
MNME_VIBC3      --------QDIWPDFVDKLPE----NIGITVIRNKADQTGEP-----LGICHVNQ-----
MNME_VIBCB      --------KDIWPDFVDRLPN----SIGMTVIRNKADQTGEE-----MGICHVND-----
MNME_VIBPA      --------KEIWPDFVDRLPE----SIGMTVIRNKADQTGED-----MGICHVND-----
MNME_VIBVU      --------KEIWPDFIDRLPE----QIGITVIRNKADQTQES-----LGICHVSQ-----
MNME_VIBVY      --------KEIWPDFIDRLPE----QIGITVIRNKADQTQES-----LGICHVSQ-----
MNME_ALIF1      --------KLIWPEFLDRLPK----NMGMTVIRNKADQTGED-----LGICHVND-----
MNME_PHOPR      --------KDIWPDFIERLPE----SMGLTVIRNKVELTGEA-----AGICHVNN-----
MNME_PSYIN      --------RQIWPDFIDKLPK----SVGLTVVRNKADLTGEA-----FSMTENHD-----
MNME_PSEA6      --------YKIWPEFMRRLPK----NMGLTVIRNKADLSGEN-----VGKVQYDD-----
MNME_PSEHT      --------HKIWPEFMAKLPV----GLGVTVIRNKADLSGDV-----VGMDQNQQ-----
MNME_IDILO      --------DDIWPEFFAQLPE----DMPYTVIRNKVDLSEEP-----TGIDEHNN-----
MNME_COLP3      --------KDFYPEFFAKLPE----KIGLTLIRNKADVNDAK-----TGFTEFTDTDG--
MNME_CHRSD      --------MQLWPEFVARLPH----PERLTLVRNKIDESGE-------TEQSDLS-----
MNME_MARMS      --------NEIWPEFMEKLGD----TKHLTLVRNKVDLTKE-------GTGIETV-----
MNME_MARHV      --------HEIWPDFIDQLPR----SAPVTVIRNKVDLSGEP-----LGISAESH-----
MNME_HAHCH      --------ERIWPEFYARIEH----HDHITVVRNKIDLSEE-------AQGIDLS-----
MNME_PSEAE      --------FSLWPEFLDQRPE----PGKVTLIRNKADLSTES-----IGLEE-SA-----
MNME_PSEAB      --------FSLWPEFLDQRPE----PGKVTLIRNKADLSTES-----IGLEE-SA-----
MNME_PSEA7      --------FSLWPEFLDQRPE----PGKVTLIRNKADLSTEA-----IGLEE-SA-----
MNME_PSEPU      --------FALWPEFLAQRPD----PAKVTLIRNKADLSGER-----VALEQ-CD-----
MNME_PSEP1      --------FALWPEFLAQRPD----PAKVTLIRNKADLSGER-----VALEQ-CD-----
MNME_PSEPK      --------FALWPEFLAQRPD----PAKVTLIRNKADLSGER-----VALEQ-CD-----
MNME_PSEPG      --------FALWPEFLDQRPD----PAKVTLIRNKADLSGEH-----VGLEQ-CD-----
MNME_PSEPW      --------FALWPEFLDQRPD----PGKVTLIRNKADLSGEP-----VGLEQ-CD-----
MNME_PSEE4      --------FALWPEFLDQRPD----VAKVTLIRNKADLSGEH-----VGMEQ-SD-----
MNME_PSEF5      --------FALWPEFLEQRPD----PAKVTLIRNKADLTGEP-----IALET-CD-----
MNME_PSEPF      --------FALWPEFLETRPD----PAKVTLIRNKADLTGEP-----IALEV-SD-----
MNME_PSE14      --------FALWPEFLEQRPD----PAKVTLIRNKADLSGDP-----IDLQT-SV-----
MNME_PSEU2      --------FALWPEFLEQRPD----PSKVTLIRNKADLSGDP-----INLQT-SV-----
MNME_PSESM      --------FALWPEFLEQRPD----PAKVTLIRNKADLSGDS-----IALQT-SA-----
MNME_PSEMY      --------FALWPEFLEQRPD----PARVTLIRNKADLSGEA-----VTLQT-SA-----
MNME_PSEU5      --------SALWPEFLDFSPE----PGKVTLIRNKADLTGEA-----IVLRC-DN-----
MNME_SACD2      --------NVHWPEFTSNAAY----AKKLTVIYNKIDESGFS-----TTNHT-SD-----
MNME_HYDCU      --------QAILEKMPSHIP--------VTLIHNKIDLIEKS-----PELSE-ND-----
MNME_LEGPC      ----------LLNELRLTLPN----KIPIITVYNKIDTTKL------TAKCDEHT-----
MNME_LEGPH      ----------LLNELRLTLPN----KIPIITVYNKIDTTKL------TAKCDEHT-----
MNME_LEGPA      ----------LLNELRLTLPN----KIPIITVYNKIDTTKL------TAKCDEHT-----
MNME_LEGPL      ----------LHNELKLTLPD----KIPIITVYNKIDTTKL------TAKCDEHT-----
MNME_ALCBS      ----------LLPQSQQQLENL---DLPVTVVLNKADLSGLS-----TGPRADGA-----
MNME_METCA      --------TEAGDALPADLPE----TIPLIRIFNKIDLTGAP-----ASLTVERE-----
MNME_NITOC      --------TEAEQAILDELPD----DVTYTLIFNKIDLSGAP-----AGRWEELQ-----
MNME_ALKEH      ---------PPIDPAALALPG----DIPLTRVYNKVDLSDEA-----PGPRRAGD-----
MNME_COXBU      --------KKIIAQWFSENDN----KIPTLIVENKIDLIGEA-----PRKENKEY-----
MNME_COXBN      --------KKIIAQWFSENDN----KIPTLIVENKIDLIGEA-----PRKENKEY-----
MNME_COXBR      --------KKIIAQWFSENDN----KIPTLIVENKIDLIGEA-----PRKENKEY-----
MNME_PSYCK      --------EQLFGELPEAK--------RLLIIANKSDLLNNN-----SSKEITSISQQEI
MNME_PSYA2      --------EQLFGELPEAK--------CLLIIANKSDLLNHN-----SSKGMTSISQEEI
MNME_PSYWF      --------SELFGEGIDGTPNF--DPSKLLLIGNKRDLVEDK-----GESANKLADKADI
MNME_ACIBY      --------QEYFSEHIEPR--------RLMLIGNKCDLTGQS-----AEISDYQ------
MNME_ACIBT      --------QEYFSEHIEPR--------RLMLIGNKCDLTGQS-----AEISDYQ------
MNME_ACIAD      --------QEYFAEHLEPR--------RLILIGNKCDLMTGH-----PELAQYQ------
MNME_DICNV      --------FVSLQEELHQLAP----HAQFLVVYNKADLVDEQ-----TAGDG--------
MNME_BORBR      ---------HLDAQIVRRL----PARTPVLNVFNKVDLLDAA---------------FQG
MNME_BORPA      ---------HLDAQIVRRL----PARTPVLNVFNKVDLLDAA---------------FQG
MNME_BORPE      ---------HLDAQIVRRL----PARTPVLNVFNKVDLLDAA---------------FQG
MNME_BORPD      ---------ELDAQIVARL----PARTPLLTVFNKVDLLDQP---------------FQA
MNME_BORA1      ---------ILDVDITARL----PARTPVLAVFNKIDLLTST---------------AQL
MNME_CUPPJ      ---------EIDDAIDDRLSGQLPPGAPIVRVVNKIDVAPTVGGMMFSGNRPHVVAANGP
MNME_CUPNH      ---------ETDDAIDDQLSGQLPPGSPIVRIVNKIDKAPAVGDVVFGGNRPHVVAANGP
MNME_CUPMC      ---------ETDDHIDDRLSGQLPPGSPIVRVINKIDLAPSVGAMGFGGNRPHVVAANGP
MNME_RALSO      ---------AEDAAIDARIAEHVPPGVPTLRVINKIDLA--------GAAVPGRVDAQ--
MNME_BURM7      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURMA      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURP6      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURP0      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURMS      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURM9      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURPS      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURP1      ---------PGDEAIAARF----PDGVPVVRVLNKTDLTGAP-----ASVTRTGGGAARA
MNME_BURTA      ---------PDDEAIAARF----PAGVPVVRVLNKTDLTEAP-----ASVARVGSGAERA
MNME_BURCA      ---------ADDETIAARF----PAGVPVVRVLNKTDLTGVP-----ACVEHP---AAEG
MNME_BURCH      ---------ADDETIAARF----PAGVPVVRVLNKTDLTGVP-----ACVEHP---AAEG
MNME_BURCC      ---------PDDETIAARF----PAGVPVVRVLNKTDLTGVP-----ACVEHP---AAEG
MNME_BURL3      ---------ADDETIAARF----PGGVPVVRVLNKTDLTGVA-----ACVEHP---AAEG
MNME_BURCM      ---------ADDEVIAARF----PGGVPVVRVLNKTDLTGVP-----ACVEHP---AAAG
MNME_BURA4      ---------ADDEVIAARF----PGGVPVVRVLNKTDLTGVP-----ACVEHP---AAAG
MNME_BURVG      ---------PEDETIAARF----PDGVPVVRVLNKTDLTGVP-----ACVEHP---AAAG
MNME_PARXL      ---------VEDEAIAGRF----PAGVPVVRVLNKTDLTGLA-----PATRAL---DADL
MNME_JANMA      ---------RADEQIVERF----PENIPVMRIWNKIDLSGHR-----PAIDRM------P
MNME_HERAR      ---------RADEQITERF----PANVPVMRVWNKIDLSGHR-----PAIDRM------P
MNME_ACISJ      ------QYQDDDAAIAHTLSNRLPAGVPVVDVWNKADAAPQAAAPAR--------EGESQ
MNME_ACIAC      ------DYEAADAEIAARLARMAPAHVPVVDVWNKSDRAEGSAAAGQGGVATASASGRAA
MNME_VEREI      ------KYIADDAEIERALARKLPPGVAVIDVWNKLDCVAAPAELAAPTAPTESAAVPPA
MNME_RHOFT      ------DYIAADAVIAEAIAGKLSASVPVIEIWNKADVIDRPCQQAG-------------
MNME_POLSJ      ------NYIAADDRIARTLANKLPENTAIIDVWNKSDLTSPAGLQQVQG-----------
MNME_POLNA      ------NYIADDARLQSALALKLPKNTAIIDVWNKSDMAGPELLRQVNG-----------
MNME_LEPCP      ----------AYSAADTAIAQRLPADVGLIHVHNKADAAPEQAARVAARLAARQAGDAA-
MNME_METPP      ----------GYDAAERDIEQRLPAGVHVLDVHNKADAAAAGAAALAPQ-----------
MNME_NEIMA      -----------TRAILDAL----PLELKRIEIHSKSDLHAHA-----AGGFGTGA-----
MNME_NEIMB      -----------TRAILDAL----PPELKRIEIHSKSDLHAHA-----AGGFGTGA-----
MNME_NEIM0      -----------TRAILDAL----PSELKRIEIHSKSDLHAHA-----AGGFGTGA-----
MNME_NEIMF      -----------TRAILDAL----PPELKRIEIHSKSDLHAHA-----AGGFGTGA-----
MNME_NEIG1      -----------TRMILDTL----PSDLKRIEIHSKSDLHAHA-----AGGFGTGA-----
MNME_CHRVO      -----------VQSILERL----PPALPRVQVFNKVDLSGEA-----AGLAEQDG-----
MNME_AZOSB      -----------EAELAARC----PSAAARITVVNKIDLLGLA-----PERTETAG-----
MNME_AROAE      -----------DDAIDAAL----PEGVERITIFNKIDLCGLE-----PARLQHDD-----
MNME_DECAR      -----------DREILARL----PDRLQRITVYNKIDLTHRA-----AERHDEAN-----
MNME_NITEU      ----------EDRSVLTRL----PERLPVLTVHNKIDLSAQP-----PRLEENTS-----
MNME_NITEC      ----------EDHSVLARL----PKELPVLTVHNKIDLSGQL-----SRIEEDTS-----
MNME_NITMU      ----------EDQAILASL----PPGLRLIVVHNKTDLLESPPN---STVSTATA-----
MNME_THIDA      ----------HEAQILAKL----PDVV-RLTVHNKIDVAGEA-----PRATADE------
MNME_METFK      ----------VEKSILARL----PQFLPKIWIHNKIDLESTP-----PKIEEQDG-----
MNME_POLAQ      ---------SLREEILGAL----PAKCPILDVINKSDLIEGG-----LAVSSSNE-----
MNME_FRATF      --------KEIIPEFYDQIPK----DIDITYVHNKIDLLKEV------PHNHANH-----
MNME_FRATH      --------KEIIPEFYDQIPK----DIDITYVHNKIDLLKEV------PHNHANH-----
MNME_FRATO      --------KEIIPEFYDQIPK----DIDITYVHNKIDLLKEV------PHNHANH-----
MNME_FRATT      --------KEIIPEFYDQIPK----DIDITYVHNKIDLLKEV------PHNHANH-----
MNME_FRAT1      --------KEIIPEFYDQIPK----DIDITYVHNKIDLLKEV------PHNHANH-----
MNME_FRATW      --------KEIIPEFYDQIPK----DIDITYVHNKIDLLKEV------PHNHANH-----
MNME_FRATN      --------KEIIPEFYDQIPK----DIDITYVHNKIDLLKEV------PHNHANH-----
MNME_FRAP2      --------KDIIPEFYHQIPK----DIDITYVHNKIDLLKEV------PLNHDNH-----
MNME_RUTMC      --------FSILPKNIDDQPL----LLIKNKVDLISGAVKKE------MINNIVQ-----
MNME_VESOH      --------LSILPKNINDQSL----LLIKNKVDLTSGAIKRE------VINDIVQ-----
MNME_XANAC      --------QAARDAIGDAIDT----VPRQLWIHNKCDLLGNA------ASLDANA-----
MNME_XANC5      --------QAARDAIGDAIDA----VPRQLWIHNKCDLLGNA------VSLDANA-----
MNME_XANOM      --------QAARAAIGDAIDA----VPRQLWIHNKCDLLSDA------APLDVNA-----
MNME_XANOR      --------QAARAAIGDAIDA----VPRQLWIHNKCDLLSDA------APLDVNA-----
MNME_XANCP      --------QAARDALGDAIDA----VPRRLWIHNKCDLLAVA------GPMDADA-----
MNME_XANC8      --------QAARDALGDAIDA----VPRRLWIHNKCDLLAVA------GPMDADA-----
MNME_XANCB      --------QAARDALGDAIDA----VPRRLWIHNKCDLLAVA------GPMDADA-----
MNME_XYLFA      --------QIGSLALADALTS----VPRVLWIHNKLDLLTEPP-----SALDTDV-----
MNME_XYLFT      --------QIGSLALADALTS----VPRVLWIHNKLDLLTEPP-----SVLDTDV-----
MNME_BLOFL      --------NSLKKELSSNNI----EAVFITIIRNKSDLSFEH-----NGIDT-TNKYA--
MNME_BLOPB      --------HVEKVLFCKN------KKTPITIIHNKSDLTKNQ-----IGISI-INNYT--
MNME_BAUCH      --------DKLCNTLIANFP----YKTPVTIIRNKADITGEK-----IGETL-NNNYS--
MNME_WIGBR      ---------NLIWPKFNSNI----KNK-ITIIRNKIDLSKEI-----PEIKI-FKKNN--
MNME_BUCCC      ---------NFIKNIVNNLK----KNQNITFIFNKIDLINKK-----PYISIIYKKFE--
MNME_BUCAI      ---------KICDDFMKNILNN--KTQ-VTFVLNKNDLIKDE-----FGIKE-IDGTA--
MNME_BUCMP      ---------KICNEFIQNISVN--NIQ-ITFILNKNDLVQDK-----FNTEK-IESLL--
MNME_BUCAP      ---------KTSIQFMKQISSY--NIQEVTFVLNKNDLVEDF-----CGITK-IENLL--
MNME_BUCBP      ---------KNYNNFIKSLS----KTSCITIVFNKSDLSKFK-----INSDL-RNLNN--
MNME_CAUVC      ---------------KQADARPEAIRVGDWLILNKTDIADADASAHVAERW---------
MNME_CAUSK      ---------------KQDDE-LAVIQRGDWAVINKIDLVDAGRLAELRATF---------
MNME_MARMM      ---------------EELVDLEGRLTDGDLLVLNKLDLGLVSERDG--------------
MNME_RHORT      ---------------GADDPAADLTGEAVLRVVTKRDLLDPRAVERWLAR----------
MNME_MAGSA      ---------------NLDAATLEMIDDATLVVLNKRDLMTGETPASINGR----------
MNME_PARL1      ---------------IGNGFALARPDD--LRVLNKVDL------GAEVPD----------
MNME_NITWN      -----------------PDQTIRSGETSLWLIRNKIDLAGPENDGAKPGR----------
MNME_NITHX      -----------------PSQTIGEGGVPLWLVRNKIDVSGAESDGANPRQ----------
MNME_BRASO      -----------------GAEVERQGETPLWLVRTKTDLDGAERA----------------
MNME_BRASB      -----------------QAELERQTDGPIWFVRNKIDLMITEQSG---------------
MNME_BRADU      ---------------WTSGDGSHPSGGSVWIVRNKIDLGEFGDEG---------------
MNME_RHOP5      -----------------AAPAAIESDAPVWLVRNKVDLAGAATGVKP-------------
MNME_RHOPS      -----------------MTGDAVAASAPVWRVRNKIDLRGGEGDGGPVGLPVEPL-----
MNME_RHOP2      -----------------AIDVAVEGSAPVWRVRNKIDLVP-QADTVGADSGGAGL-----
MNME_RHOPA      -----------------DASDPDVKGPEVWRVRNKIDLATGEVAESGPSQP---------
MNME_RHOPB      ----------------ALRAWMAQGQNGFWVVRNKVDVAGEPTGEL--------------
MNME_METPB      -----------------EAGPEDFAEVPVLRVRTKSDLPSGAP-----------------
MNME_METRJ      -----------------AVPDLGPGCRPILIVRTKADLFAGSQPAG--------------
MNME_METS4      -----------------GAA----APKGALVVHTKRDLGRDPG-GG--------------
MNME_AZOC5      -----------------APPT---DMPAPLRVRTKADVTGAEG-----------------
MNME_BEII9      -----------------PVAPPENLGMEVWPVFTKADRVEPLE-----------------
MNME_RHIEC      ---------------MIPGDLDQ--TLPHVTVGTKKD--LVETG----------------
MNME_RHIL3      ---------------LIPDDLEQ--SSPHVTVGTKKD--LTEVN----------------
MNME_SINMW      ---------------FRLDEWQPGKSVPVIRVATKVDRPMPRWK----------------
MNME_RHIME      ---------------FRIDEVLP-ENVPVIRVATKVDRPSPSWA----------------
MNME_AGRFC      ---------------TPKQSIGSFDNQRSLRVRTKTLL-RSRAS----------------
MNME_BRUC2      ---------------VSVT--VEKIEAETWLIGTKADLGGS-------------------
MNME_BRUSU      ---------------VSVT--VEKIEAETWLIGTKADLGGS-------------------
MNME_BRUA2      ---------------VSVT--VEKIEAETWLIGTKADLGGS-------------------
MNME_BRUAB      ---------------VSVT--VEKIEAETWLIGTKADLGGS-------------------
MNME_BRUME      ---------------VSVT--VEKIEAETWLIGTKADLGGS-------------------
MNME_BRUO2      ---------------VSVT--VEKIEAETWLIGTKADLGGS-------------------
MNME_BRUSI      ---------------VSVT--VEKIEAETWLIGTKADLGGS-------------------
MNME_OCHA4      ---------------IAVA--SDEIPEALWKIGTKADLNAE-------------------
MNME_BARHE      ---------------KEVY--LPETSAEIWRVGNKFDLYEE-------------------
MNME_BART1      ---------------KQVD--LPETSAEIWRVGNKLDLYEK-------------------
MNME_BARQU      ---------------KEVN--LPETSAEIWHVGNKLDLYEEE------------------
MNME_BARBK      ---------------QKIS--LPNTSAEIWRVGNKLDICEG-------------------
MNME_CHESB      ---------------STPE--VPQGK-PVITIGNKADLITD----T--------------
MNME_RHILO      ---------------GVLG--PLPGKAPLLRVGTKLDLLDEGSARE--------------
MNME_HYPNA      ------------------SPPPEQVETQDIIVFNKADQRPAILA----------------
MNME_GRABC      ----------------SAEQWPGSSEARSLMIGTKSDLPYTPPSSP--------------
MNME_ACICJ      ----------------VVPDAP--ADVPALRIATKADLGGAVPAA---------------
MNME_GLUOX      ----------------SLDTLS----GQEIPIRTKIDIAPAPPGM---------------
MNME_ERYLH      ----------------GPD--------NAWEIDAQSDIDERTAKSA--------------
MNME_NOVAD      ----------------GPAGR------TLWEIAARADDPGAGRKSQ--------------
MNME_SPHWW      ----------------APA--------GSVRIGAQAD-RRTHDSAA--------------
MNME_SPHAL      ----------------APEHP------RTILIAAQADRWRGDAAAEAEAA----------
MNME_ZYMMO      ----------------APKTDG-----EVLVLYPQIDLPERHPIPE--------------
MNME_RUEST      ------------------ESFSIQMREGDLRLLPKADERRSAK-----------------
MNME_RUEPO      ------------------DAMGVELQPDDLHVLPKADQRPDTA-----------------
MNME_ROSDO      ------------------ERLLIEPLEDDIRLTPKVDLAPGSQ-----------------
MNME_RHOS4      ------------------PLSGITVQADDLVVQGKADLRPGQG-----------------
MNME_RHOS1      ------------------PLPGITVQADDLVVQGKADLRPGHG-----------------
MNME_RHOS5      ------------------EVVGLEPEADDLIVQGKADTRLTRG-----------------
MNME_DINSH      ------------------LPSGLGVADDDILVQAKSDILPSSSE----------------
MNME_JANSC      ------------------ILPDVLSDTIDFRYRAKADLSDGEG-----------------
MNME_PARDP      ------------------PEETLVL--GDIIVRSKADLGRGEE-----------------
MNME_RICAH      ---------------------------NTIVIINKIDLIEPSKVFSIEDKYK--------
MNME_RICFE      ---------------------------NTITIINKIDLIEPNKIFSIENKYK--------
MNME_RICRO      ---------------------------NTITIINKIDLIEASKIFSIENKYK--------
MNME_RICRS      ---------------------------NTITIINKIDLIEASKIFSIENKYK--------
MNME_RICCN      ---------------------------NTITIINKIDLIEASKIFSIENKYK--------
MNME_RICM5      ---------------------------NTITIINKIDLIEASKIFSIENKYK--------
MNME_RICCK      ---------------------------NTIIIINKIDLIEPSKIFLIEDKYK--------
MNME_RICPR      ---------------------------NTIVIINKIDLIEPNKTFAIENRYK--------
MNME_RICTY      ---------------------------NTIVIINKIDLIEPSQIFPIEKKYK--------
MNME_RICB8      ---------------------------NTIVIINKIDLIPENRIFNIENKYR--------
MNME_RICBR      ---------------------------NTIVIINKIDLIPENRIFNIENKYR--------
MNME_ORITB      ---------------------------YTIIVINKIDLVNYKYDSSILPCDKP-------
MNME_ANAMM      ---------------------------KTIYVLSKADSAKEGETRIIEGKQF--------
MNME_ANAPZ      ---------------------------KTILVLSKADNVDLPESKCIDGKEF--------
MNME_EHRCJ      --------------------------EKSICVLSKADNITEHELISIFNFSF--------
MNME_EHRCR      --------------------------DKSICILSKADNITDQKLIPVFDFSF--------
MNME_EHRRW      --------------------------DRSICVLSKSDSIITQNLININNINF--------
MNME_EHRRG      --------------------------DRSICVLSKSDSIITQNLININDINF--------
MNME_WOLTR      -------------------------SSNTIYVLSKADDVINDHDIKISDIDF--------
MNME_WOLPM      WILETCAENNVHSWIPVSATCMTSDQNDTIYVLSKADDVINNHNIKINGIDL--------
MNME_NEOSM      QEMQLNEAGVRSK-----NMNYPDIEERDLNLRDILDERHEEKDRSVMCHDMMQEHDPDN
MNME_PELUB      ---------------------------NAILVINKSDLLNKDLNSEIKNYEH--------
MNME_DEIRA      ----------QPREPLPTELPPT---ATVLRLRTKADLP---------------------
MNME_DEIGD      ----------QPRDHLPAELPRE---TRMLRVRTKADLP---------------------
MNME_THET8      ----------QPK-PAPPPLPW----ARTLKVATKSDLP---------------------
MNME_THET2      ----------QPK-PAPPPLPW----ARTLKVATKSDLP---------------------
MNME_HALHL      ----------KTLDEELRARIAEQAPRPVVVIVNKIDASGDEAGWE--------------
MNME_MYXXD      ----------VT-QAEVEAWTRDVGGTPVLVVDGKCDVA---------------------
MNME_RHOBA      ---------FESLKSPNAVLAEAKRSAQLICVATKRDLMPTDWN----------------
MNME_AQUAE      -----------ITEE-DLRIYEEIKEKDHIVVANKVDL---GIRANLEKFKG--------
MNME_MAGMM      -----------VTLE-DKALLQRLPKEKALWVWNKLDQLEGALPECLQDWPE--------
MNME_KORVE      -----------TGHELDHQLISAAAERSAILVENKIDL----GRHSVANGKS--------
MNME_SOLUE      -----------VTAE-DASLIARAGAR-ALIVANKCDL----PAAGDVPAEA--------
MNME_CHLTR      ----------------------------TILLWNKCDIVSP--PQIEVPFQQISVS----
MNME_CHLTB      ----------------------------TILLWNKCDIVSP--PQIEVPFQQISVS----
MNME_CHLT2      ----------------------------TILLWNKCDIVSP--PQIEVPFQQISVS----
MNME_CHLTA      ----------------------------TILLWNKCDIVSP--PQIEVPFQQISVS----
MNME_CHLMU      ----------------------------TILLWNKCDVASP--PQLEVPFQQIFVS----
MNME_CHLCV      ----------------------------SLLLWNKSDLASP--PQLDTSLPQLAIS----
MNME_CHLFF      ----------------------------SLLLWNKSDLASP--PRIDTSLPQLAIS----
MNME_CHLAB      ----------------------------SLLLWNKSDLATP--PHLETTLPQLAVS----
MNME_CHLPN      ----------------------------SFLLWNKADLTPP--PFLDTSLPQFAIS----
MNME_PARUW      --------------------------HKTIVIWNKIDLNPRNLPCLEVPF-LVHLS----
MNME_OPITP      --------------------------KNTLLVANKIDLCAGKCVLDTVDQWFGMVF----
MNME_BDEBA      --------------------------AKTYILANKTDKIGGSKPLETVEKTLKNSK----
MNME_DESHY      --------------------------QSVIVLINKMDLLAGKERGEEVLENYPTQQG---
MNME_ALKMQ      -------------------------SKKALILVNKTDLTSQIDYDR---IIEIVGE----
MNME_ALKOO      -------------------------NKRALVIINKTDLQQKLNLTP---IQEIIQD----
MNME_CLOD6      -------------------------DKQTIVLLNKNDLKQEIEEEK---ILKYVEN----
MNME_FINM2      -------------------------DKKSIVLLNKIDLDGEFDVDE---NLEGIE-----
MNME_FUSNN      -------------------------TDKVIGILNKIDIKKEINLSK---FPKIEK-----
MNME_CLOB1      -------------------------NKKYIVLLNKLDLNKDLNEENH--FIKELDS----
MNME_CLOBK      -------------------------NKKYIVLLNKLDLNKDLNEENH--FIKELDS----
MNME_CLOBH      -------------------------NKKYIVLLNKLDLNKDLNEENH--FIKELDS----
MNME_CLOBL      -------------------------NKKYIVLLNKLDLNKDLNEENH--FIKELDS----
MNME_CLOBM      -------------------------NKKYIVLLNKLDLNKDLNEENH--FIKELDS----
MNME_CLOK5      -------------------------HRKYIILLNKTDIGDKIDLND----ICNLNS----
MNME_CLOTE      -------------------------DKKYITLLNKSDLESKINKSD----LEDLKL----
MNME_CLONN      -------------------------DKKYIVLLNKMDLESKIDKEA----LKELNS----
MNME_CLOAB      -------------------------DKKYIVLLNKVDLKNREDKSK----LDLLNK----
MNME_CLOPE      -------------------------DRKYIVLLNKVDL--DRKLSSE--IVDNLE-----
MNME_CLOP1      -------------------------DRKYIVLLNKVDL--DRKLSSE--IVDNLE-----
MNME_CLOPS      -------------------------DRKYIVLLNKVDL--DRKLSSE--IVDNLE-----
MNME_CLOB8      -------------------------NRKYIVLLNKMDLK-DIKIQEE--ILKNLS-----
MNME_LACP7      -------------------------DRKAIVLLNKSDLDSVIEEEK----INLLTN----
MNME_THEP3      -------------------------GKNIIFVLNKIDLPK-KIDEKE--LKDLTKD----
MNME_THEPX      -------------------------GKNIIFVLNKIDLPK-KIDEKE--LKDLTKD----
MNME_CALS4      -------------------------GKNIIFVLNKVDLPK-KIDEEE--LKKLVGN----
MNME_HUNT2      -------------------------DKKLIILINKIDLVD-EKQINE--IESLLKG----
MNME_CARHZ      -------------------------KDKSLLVINKIDLLQGKVNFEQ--YAVKTGI----
MNME_DESRM      -------------------------DKKVLILINKIDITKNKIDSHE--IRQLINF----
MNME_PELTS      -------------------------GKKVIFIVNKADVREKKISSEG--AARIAGG----
MNME_CALS8      -------------------------NKKYIILVNKTDKGINISQDE----IKKLFG----
MNME_SYNWW      -------------------------KKNKIVLVNKEDLEEKNISEAE--LEQLFPG----
MNME_NATTJ      -------------------------DKTSLLVLNKTDLHEKLDIDE---IDKLVSQ----
MNME_DESPS      -------------------------HKPMIAVINKLDLLAEDGTAAAALLDFVPAS----
MNME_MOOTA      -------------------------DKVLIIIGNKLDLVAHDINKKLADLES--------
MNME_DESAP      -------------------------GKPLVVLINKVDLAPAGID---PDAVR--------
MNME_ROSS1      -------------------------EKRTILTLNKIDLIDADRSIIAARQ---REYEQIR
MNME_ROSCS      -------------------------DKRTVLIVNKIDLIDGADAVQECMKFLKCAYENLR
MNME_CHLAA      -------------------------DRPTIIVWNKCDDPDVPPPPAPPHP----------
MNME_SYMTH      -------------------------GAARVGVANKIDLNPAFELSALREA----------
MNME_HELMI      -------------------------GRPAVVLVNKSDLAVRRLDEKRLRS----------
MNME_GEOSL      -------------------------GKRLILVENKCDLPRAVQIPDELVLM---------
MNME_GEOMG      -------------------------ERRVIVVTNKSDLPVTLRIPGELEGV---------
MNME_GEOUR      -------------------------PCNFIVVMNKSDICRSFDMP-QLPDV---------
MNME_PELPD      -------------------------GNRFVAAISKADLPRVLELPSECCNL---------
MNME_PELCD      -------------------------NREVLVVINKCDLA-TLPISSALDGL---------
MNME_SYNAS      -------------------------GYNLLPVINKADLDHSLKEEDIIACFP--------
MNME_SYNFM      -------------------------SRPFVIVLNKEDLPPAISTGKIRERYG--------
MNME_DESVH      -------------------------PERVLVVFNKTDLLEGRILPS---TPEGCRS----
MNME_DESVV      -------------------------PERVLVVFNKTDLLEGRILPS---APEGCRS----
MNME_DESAG      -------------------------AGSVLVVLNKTDAATEDELDRCVRSLAGRPH----
MNME_LAWIP      -------------------------VERTILVWNKVDLKVPPSNWTELYTSSQVSG----
MNME_NOSS1      -------------------------HRPLILVMNKID---LVEKQLITSLEYP-------
MNME_TRIV2      -------------------------HRPLILVMNKID---LVDKKLITSLEYP-------
MNME_TRIEI      -------------------------HRFLILIINKVDQVDLVHSELIRSIFYP-------
MNME_ACAM1      -------------------------DLPLILIVNKVD---LVPQE---QVVYP-------
MNME_SYNY3      -------------------------DRPLILVINKID---LGRAD---LVSYP-------
MNME_MICAN      -------------------------DRRLILVINKID---LANPE---TVIYP-------
MNME_SYNP2      ------------------------ANQPLILILNKID---IGQPE---AIEIP-------
MNME_SYNE7      -------------------------DRPILLVINKRDR--LSEAERHAIALPQ-------
MNME_SYNP6      -------------------------DRPILLVINKRDR--LSEAERHAIALPQ-------
MNME_THEEB      ------------------------APQSVLVVLNKADL--LSETTEVKDIPLP-------
MNME_SYNJA      -------------------------HRPLILVINKTD---LAPAD---KIRLP-------
MNME_SYNJB      -------------------------HRPLILVINKTD---LAPPE---GIPLP-------
MNME_GLOVI      -------------------------ERPVIVVVNKSD---LEGPP---VYTPS-------
MNME_PROM1      ------------------------VNIPLLIVGNKSD---LMNDQSFEKV-----PK--Y
MNME_PROMT      ------------------------INIPLLIVGNKSD---LTNDQSFEKV-----PK--Y
MNME_PROMA      ------------------------KGTPTLIIGNKAD---LKSQS---------------
MNME_PROM3      ------------------------DDLPRLLVGNKAD---LQPASMTASL-----SN--E
MNME_PROMM      ------------------------DDLPRLLVGNKAD---LQPASMAASLMVASLGN--E
MNME_SYNSC      ------------------------AQIPRILVANKAD---LPAGAFPQPV----------
MNME_SYNPX      ------------------------EHIPRILVANKAD---LPAGALPQPV----------
MNME_SYNS9      ------------------------NDVPRVVVANKSD---LDGPPLPGLV----------
MNME_SYNPW      ------------------------AAVPHLLVGNKVD---VAVSDARAG-----------
MNME_SYNS3      ------------------------EGVPCLRVGNKAD---LPLKAEPVAE---------T
MNME_SYNR3      ------------------------DGTPLLVVGNKSD---LAAEPATTQG----------
MNME_PROMS      ------------------------KEKLITILGNKKD---LIDCKNINSN----------
MNME_PROM0      ------------------------KEKLITILGNKKD---LIDCKNINSN----------
MNME_PROM2      ------------------------KEKLITILGNKKD---LIDCKNINSN----------
MNME_PROM9      ------------------------KEKLITILGNKKD---LIDCKNINSN----------
MNME_PROM5      ------------------------REKLITILGNKKD---LIDSKKNDQK----------
MNME_PROMP      ------------------------QEKLITILGNKKD---LIDSKKVNKK----------
MNME_CYACA      ------------------------MNKNFVILINKIDKKVQRKIDEIYETLKCSNR----
MNME_CYAM1      -------------------------SKPLLVVYNKIDVDSSDVLDHVLDHTSYPT-----
MNME_BACFR      -------------TLLSDKILPRCEHKQLILVFNKVELINETQKNELASQFSEHIG----
MNME_BACFN      -------------TLLSDKILPRCEHKQLILVFNKVELINETQKNELASQFSEHIG----
MNME_BACTN      -------------KQLSEKIIPRCEEKQLIVVFNKADLIEEMQKEELSALLKNFPK----
MNME_BACV8      -------------EELKADILPHCEGKKMIILFNKSDLLLATQKEELSAIFADM------
MNME_PARD8      -------------EAFYQEIAPRLTNKSVILAMNKCDVLPTSSLPTFSFPTEGW------
MNME_PORGI      -------------LDYIKSIWDEREERTLILLVNKSESLAEADRIGLSETLQTKLS----
MNME_FLAJ1      ----------SEFVSEIEQIKNKYPLKPLLIVVNKKDILSEDEVLNITQKLENLN-----
MNME_FLAPJ      ----------LKLKVALEKIKNQFPLKPLIIIGNKSDKLSETEIQNIKTEI---------
MNME_GRAFK      ----------QQVRIEIEKIKNKFPQKPLLIIANKTDRLADEEIHNLKTKLEEISSHA--
MNME_CYTH3      ------------LIRDLEELKALKA--PFLVVGNKIDKR-EDAIITTFRNI---------
MNME_SALRD      -------------IAFLQDLADDGSDVQPVVIGNKADRAPDLPVATLDGLTSLK------
MNME_CHLTE      ------------LTEIREL-KAAHPAAKFLTVANKLDRAANADALIRAIADG--------
MNME_CHLPD      ------------IKEIVAL-KAAHASSKFLVVANKIDLVPDATTLLCRLGEE--------
MNME_CHLPM      ------------AAAAREL-RQRHPESRMIVVANKTDLAPDAGGMIAQLQSE--------
MNME_PELLD      ------------AVSAAAL-CAGHPEARMILLANKTDLVKDSALRIAALETA--------
MNME_CHLCH      ------------LSDITSLLEQASPNVQLLLVANKCDAITNPTERLAQLQAAM-------
MNME_BORAP      -------------LLFIDS---NKSNSKILFVLNKIDLKINKSTEEFVRSSVLNS-----
MNME_BORBU      -------------FLFIDS---NKSNSKILFVLNKIDLKINKSTEEFVRSKVLNS-----
MNME_BORBP      -------------FLFIDS---NKSNSKILFVLNKIDLNINKSTEEFVRSSVLNS-----
MNME_TREPA      -------------VQAADCAFLSDCAVPLVVVVTHNDLMSMS--ERIQVCQAVQPF----
MNME_TREDE      -------------LNKDDSEFIKNAKAPVITVITKEDLLDTESKEKIKEILKAEKI----
MNME_LEPBJ      -------------------------LEGSILVANKIDIRDSSWNPNLFSDVKD-------
MNME_LEPBL      -------------------------LEGSILVANKIDIRDSSWNPNLFSDVKD-------
MNME_LEPIN      -------------------------LEGSILIANKIDILNSSWDRNLFSDVKD-------
MNME_LEPIC      -------------------------LEGSILIANKIDILNSSWDRNLFSDVKD-------
MNME_LEPBA      -------------------------LFGSLIVANKIDSKHPSWHTESIHDIQEEFQ----
MNME_LEPBP      -------------------------LFGSLIVANKIDSKHPSWHTESIHDIQEEFQ----
MNME_UNCTG      ------------------------LNIPIICVLNKSDLPPLFSSSLLNRENK--------
MNME_SULMW      -------------------------KKKIFIIINKYDLIKKKIK----------------
MNME_CARRP      -------------------------LNELIILVNKSDILGKEEG----------------
                                                                            

MNME_THEMA      ---------------------------------------------RHMVKISALKGEGLE
MNME_THESQ      ---------------------------------------------RHMVKISALKGEGLE
MNME_THEP1      ---------------------------------------------RHMVKISALKGEGLE
MNME_FERNB      ---------------------------------------------RNSVVISAETGRGMR
MNME_THEM4      ---------------------------------------------DGEIKISALNGEGLK
MNME_PSELT      ---------------------------------------------THVLTISALKKEGIQ
MNME_PETMO      ---------------------------------------------NDFVIISAKNG-AIK
MNME_AYWBP      ---------------------------------------------QEIISVSSLDKTGFF
MNME_ONYPE      ---------------------------------------------QEIISVSSLDKTGFL
MNME_ACHLI      ---------------------------------------------DTNVQISTLEKEGLS
MNME_BACAN      ---------------------------------------------NRVITTSLIEEQGID
MNME_BACHK      ---------------------------------------------NRVITTSLIEEQGID
MNME_BACCZ      ---------------------------------------------NRVITTSLIEEQGID
MNME_BACAH      ---------------------------------------------NRVITTSLIEEQGID
MNME_BACC1      ---------------------------------------------NRIITTSLIEEQGID
MNME_BACCR      ---------------------------------------------NRVITTSLIEEQGID
MNME_BACMK      ---------------------------------------------NRVITTSLIEEQGID
MNME_BACCN      ---------------------------------------------KRVITTSLIEEKGVD
MNME_BACSU      ---------------------------------------------RPVVTTSLLKEEGIN
MNME_BACVZ      ---------------------------------------------RPVVTTSLLKEEGIQ
MNME_BACP2      ---------------------------------------------RPVVTTSLLQEKGID
MNME_BACLD      ---------------------------------------------QPVVTTSLLKEEGID
MNME_GEOKA      ---------------------------------------------RPVVGTSLLHEQGID
MNME_GEOTN      ---------------------------------------------RPIVATSLLCERGID
MNME_LYSSC      ---------------------------------------------HRIVTTSLLQEEGVT
MNME_OCEIH      ---------------------------------------------RPVVTTALLEEQGVD
MNME_BACSK      ---------------------------------------------NPVVATSFLQEEGVD
MNME_BACHD      ---------------------------------------------RPVITTSIVQDQGID
MNME_EXIS2      ---------------------------------------------RPVVTTSLLEEAGVT
MNME_STAAC      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAE      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAT      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAA3      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAA2      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAA9      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAR      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAW      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAN      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAA8      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAA1      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAM      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAS      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAAB      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAES      ---------------------------------------------MPLIQTSMLKQEGID
MNME_STAEQ      ---------------------------------------------MPLIQTSMLKQEGID
MNME_STAHJ      ---------------------------------------------TPLIQTSMLKQEGID
MNME_STAS1      ---------------------------------------------MPLIQTSMLKQEGID
MNME_LISMO      ---------------------------------------------NPIVSTSLVNDEGLE
MNME_LISMF      ---------------------------------------------NPIVSTSLVNDEGLE
MNME_LISIN      ---------------------------------------------NPIVSTSLVNDEGLE
MNME_LISW6      ---------------------------------------------NPIVSTSLVNDEGLE
MNME_ENTFA      ---------------------------------------------EEILSVSVLSNTGLD
MNME_LACP3      ---------------------------------------------DEIIKTAIPTSAGMD
MNME_LACSS      ---------------------------------------------DEVIQTSILTSEGVT
MNME_LACS1      ---------------------------------------------DELITTSVLKKTGVD
MNME_LACPL      ---------------------------------------------SDVLSMSVLEQSGVT
MNME_LACBA      ---------------------------------------------SPIIETSILQSTGMD
MNME_PEDPA      ---------------------------------------------KEIIKSSAVSPLGTK
MNME_LACLM      ----------------------------------------------DFIRISALKNENLS
MNME_LACLS      ----------------------------------------------DFIRISALKNENLS
MNME_LACLA      ----------------------------------------------DFIRISALKNENLN
MNME_STRA1      ----------------------------------------------NVIPISVLENENID
MNME_STRA5      ----------------------------------------------NVIPISVLENENID
MNME_STRA3      ----------------------------------------------NVIPISVLENENID
MNME_STRAG      ----------------------------------------------NVIPISVLENENID
MNME_STRTD      ----------------------------------------------DLIPISVLKNENID
MNME_STRT1      ----------------------------------------------DLIPISVLKNENID
MNME_STRT2      ----------------------------------------------DLIPISVLKNENID
MNME_STRMU      ----------------------------------------------DCIKISVIKNQNID
MNME_STRP8      ----------------------------------------------DYIPISVLTNQNIN
MNME_STRPD      ----------------------------------------------DYIPISVLTNQNIN
MNME_STRP6      ----------------------------------------------DYIPISVLTNQNIN
MNME_STRP3      ----------------------------------------------DYIPISVLTNQNIN
MNME_STRPG      ----------------------------------------------DYIPISVLTNQNIN
MNME_STRP1      ----------------------------------------------DYIPISVLTNQNIN
MNME_STRPC      ----------------------------------------------DLIPISVLTNQNIN
MNME_STRPM      ----------------------------------------------DLISISVLTNQNIN
MNME_STRPF      ----------------------------------------------DLISISVLTNQNIN
MNME_STRGC      ----------------------------------------------DIIKISVLHNQNID
MNME_STRSV      ----------------------------------------------DVIKISVLHNQNID
MNME_STRR6      ----------------------------------------------DVIRISVLKNQNID
MNME_STRP2      ----------------------------------------------DVIRISVLKNQNID
MNME_STRPI      ----------------------------------------------DVIRISVLKNQNID
MNME_STRPN      ----------------------------------------------DVIRISVLKNQNID
MNME_STRSY      ----------------------------------------------DVIRISVLQNQNID
MNME_STRS2      ----------------------------------------------DVIRISVLQNQNID
MNME_LACGA      ---------------------------------------------NPIIVTSILKQKNMD
MNME_LACJO      ---------------------------------------------NPIIVTSILKQENMA
MNME_LACAC      ---------------------------------------------SEVISTSILKEDNMD
MNME_LACH4      ---------------------------------------------SDVILTSILKEKNLD
MNME_LACDB      ---------------------------------------------SEVISTSIMMKENLD
MNME_LACDA      ---------------------------------------------SEVISTSIMMKENLD
MNME_MYCGE      ---------------------------------------------KFENSISAKQKD-IK
MNME_MYCPN      ---------------------------------------------SFQVSISAKQKQ-IQ
MNME_MYCGA      ---------------------------------------------EIQIKISAKNND-IS
MNME_UREPA      ---------------------------------------------DKQIYINAKNND-IQ
MNME_UREP2      ---------------------------------------------DKQIYINAKNND-IQ
MNME_MYCPE      ---------------------------------------------LKGISISALKKD-VK
MNME_MYCMS      ---------------------------------------------QNIVFTSAINHD-ID
MNME_MYCCT      ---------------------------------------------ENIVFTSAINHD-ID
MNME_MESFL      ---------------------------------------------NNFVYTSAINND-ID
MNME_MYCPU      ---------------------------------------------KDQIYISALKGE-IS
MNME_MYCMO      ---------------------------------------------NHMIKISTLNKD-II
MNME_MYCAP      ---------------------------------------------DEFLYVSAKLND-LD
MNME_MYCS5      ---------------------------------------------DDFIKISAKNND-IK
MNME_MYCHJ      ---------------------------------------------KDEILISAKYQK-IE
MNME_MYCH2      ---------------------------------------------KDEILISAKYQK-IE
MNME_MYCH7      ---------------------------------------------KDEILISAKYQK-IE
MNME_CAMJE      --------------------------------------------------NFIKLSAQKD
MNME_CAMJJ      --------------------------------------------------NFIKLSAQKD
MNME_CAMJR      --------------------------------------------------NFIKLSAQKD
MNME_CAMJ8      --------------------------------------------------NFIKLSAQKD
MNME_CAMJD      --------------------------------------------------NFIKLSAQKD
MNME_CAMC5      --------------------------------------------------PSIKISAKKG
MNME_CAMC1      --------------------------------------------------GAIKISAKND
MNME_CAMHC      --------------------------------------------------NFLKISAKND
MNME_CAMFF      --------------------------------------------------NAVLVSAKLD
MNME_SULDN      ----------------------------------------------------IEINSKEG
MNME_ARCB4      ----------------------------------------------------IELSTKED
MNME_NITSB      ----------------------------------------------------LYMSVKKE
MNME_SULNB      --------------------------------------------------DPIEVSAKKG
MNME_HELHP      ---------------------------------------------KALLCMPLHLSTKYE
MNME_WOLSU      ------------------------------------------------------ISAKEG
MNME_HELPY      ---------------------------------------------TL---LETNTLNSKA
MNME_HELPJ      ---------------------------------------------SI---LETNTLNSKA
MNME_HELPH      ---------------------------------------------SI---LETNTLNSKA
MNME_HELAH      ---------------------------------------------SM---LETNTLNSKA
MNME_ECOLI      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECOLC      --------------------------------------------HALIRLSARTGE-GVD
MNME_SHIBS      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECODH      --------------------------------------------HALIRLSARTGE-GVD
MNME_SHIFL      --------------------------------------------HALIRLSARTGE-GVD
MNME_SHIF8      --------------------------------------------HALIRLSARTGE-GVD
MNME_SHIDS      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECO57      --------------------------------------------HALIRLSAKTGE-GVD
MNME_ECOUT      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECOL5      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECOK1      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECOL6      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECOSM      --------------------------------------------HALIRLSARTGE-GVD
MNME_ECO24      --------------------------------------------HALIRLSARTGE-GVE
MNME_ECOHS      --------------------------------------------HALIRLSARTGE-GVE
MNME_SHISS      --------------------------------------------HALIRLSARTGE-GVE
MNME_SALCH      --------------------------------------------HSLVRLSARTGE-GVD
MNME_SALPB      --------------------------------------------HSLVRLSARTGE-GVD
MNME_SALTY      --------------------------------------------HSLVRLSARTGE-GID
MNME_SALPA      --------------------------------------------HSLVRLSARTGE-GVD
MNME_SALTI      --------------------------------------------HSLVRLSARTGE-GVD
MNME_SALAR      --------------------------------------------HSLVRLSARTGE-GVD
MNME_CITK8      --------------------------------------------HSLVRLSARTGE-GVD
MNME_ENT38      --------------------------------------------HSLIRLSARTGE-GVE
MNME_KLEP7      --------------------------------------------HSLIRLSARTGD-GVE
MNME_CROS8      --------------------------------------------HSLIRLSARTNE-GVD
MNME_YERPA      --------------------------------------------HSLIRLSARTGE-GID
MNME_YERPN      --------------------------------------------HSLIRLSARTGE-GID
MNME_YERPP      --------------------------------------------HSLIRLSARTGE-GID
MNME_YERPE      --------------------------------------------HSLIRLSARTGE-GID
MNME_YERPS      --------------------------------------------HSLIRLSARTGE-GID
MNME_YERP3      --------------------------------------------HSLIRLSARTGE-GID
MNME_YERPY      --------------------------------------------HSLIRLSARTGE-GID
MNME_YERE8      --------------------------------------------HSLIRLSARTGE-GID
MNME_SERP5      --------------------------------------------HSLIRLSARTGE-GID
MNME_PECAS      --------------------------------------------HSLIRLSARTGE-GVD
MNME_PHOLL      --------------------------------------------YSLIRLSARSGE-GID
MNME_SODGM      --------------------------------------------YLLITLSAQSGV-GMD
MNME_ACTP2      --------------------------------------------FTLIRLSAQTKV-GVD
MNME_ACTPJ      --------------------------------------------FTLIRLSAQTKV-GVD
MNME_HAEDU      --------------------------------------------FTLIRLSAQTKI-GVD
MNME_HAEI8      --------------------------------------------YQIISLSAQTHD-GVK
MNME_HAEIE      --------------------------------------------YQIISLSAQTHD-GVK
MNME_HAEIN      --------------------------------------------YQMISLSAQTHD-GVQ
MNME_HAEIG      --------------------------------------------YQMISLSAQTHD-GVK
MNME_MANSM      --------------------------------------------FTVIRLSAQTQQ-GVS
MNME_ACTSZ      --------------------------------------------FTVIRLSAQTRQ-GID
MNME_PASMU      --------------------------------------------YTVITLSAKTQQ-GIA
MNME_HAES1      --------------------------------------------LAVISLSAKTQK-GVD
MNME_HISS2      --------------------------------------------LTVISLSAKTQK-GVD
MNME_AERHH      --------------------------------------------HAVYRISAKTEL-GLS
MNME_AERS4      --------------------------------------------HAVYRISAKTEL-GLP
MNME_SHEB8      --------------------------------------------YSVYRISAKTGL-GVE
MNME_SHEB9      --------------------------------------------YSVYRISAKTGL-GVE
MNME_SHEB5      --------------------------------------------YSVYRISAKTGL-GVE
MNME_SHEPC      --------------------------------------------YSVYRISAKTGL-GVD
MNME_SHESW      --------------------------------------------YSVYRISAKTGL-GVD
MNME_SHESA      --------------------------------------------YSVYRISAKTGL-GVE
MNME_SHESM      --------------------------------------------YSVYRISAKTGL-GVE
MNME_SHESR      --------------------------------------------YSVYRISAKTGL-GVE
MNME_SHEON      --------------------------------------------YSVYRISAKTGL-GVD
MNME_SHEFN      --------------------------------------------SCVYRISAKTGL-GID
MNME_SHEDO      --------------------------------------------FDVYRISAKTGL-GVE
MNME_SHEHH      --------------------------------------------HSVYRISAKTGL-GVD
MNME_SHEPA      --------------------------------------------HSVYRISAKTGL-GVE
MNME_SHESH      --------------------------------------------HNVFRISAKTGL-GVE
MNME_SHEWM      --------------------------------------------HSVFKISAKTGL-GVE
MNME_SHELP      --------------------------------------------HKVFRLSAKTGS-GVD
MNME_SHEAM      --------------------------------------------YSVYRISAKTGL-GVD
MNME_VIBCH      --------------------------------------------PTLIRLSAKTGQ-GVD
MNME_VIBC3      --------------------------------------------PTLIRLSAKTGQ-GVD
MNME_VIBCB      --------------------------------------------PTLIRLSAKTGA-GVD
MNME_VIBPA      --------------------------------------------PTLIRLSAKTGA-GVD
MNME_VIBVU      --------------------------------------------PTLIRLSAKTGQ-GVD
MNME_VIBVY      --------------------------------------------PTLIRLSAKTGQ-GVE
MNME_ALIF1      --------------------------------------------PTLIRLSAKTGE-GVD
MNME_PHOPR      --------------------------------------------PPLIRLSARTGE-GID
MNME_PSYIN      --------------------------------------------HPVYRISAKTGQ-GVD
MNME_PSEA6      --------------------------------------------YPVFQLSASHKQ-GIE
MNME_PSEHT      --------------------------------------------YPVISLSAKNAD-GIE
MNME_IDILO      --------------------------------------------IPVIHLSAKTGH-GIE
MNME_COLP3      ------------------------------------------TQHAIITLSAKTGK-GVD
MNME_CHRSD      ------------------------------------------TSPPIVRLSAKTGL-GVD
MNME_MARMS      ------------------------------------------SGVPVVSLSAKTGE-GVT
MNME_MARHV      ------------------------------------------QTAPVIRLAAKAAE-GLE
MNME_HAHCH      ------------------------------------------LSHPVIRLSAKAGN-GID
MNME_PSEAE      ------------------------------------------DGHVTITLSARTGA-GLE
MNME_PSEAB      ------------------------------------------DGHVTITLSARTGA-GLE
MNME_PSEA7      ------------------------------------------DGHVTITLSARTNA-GLE
MNME_PSEPU      ------------------------------------------DGHVTITLSAKGDDTGLQ
MNME_PSEP1      ------------------------------------------DGHVTITLSAKGDDTGLQ
MNME_PSEPK      ------------------------------------------DGHVTITLSAKGDDTGLQ
MNME_PSEPG      ------------------------------------------DGHVTITLSAKGDDTGLQ
MNME_PSEPW      ------------------------------------------DGHVTITLSAKGDDQGLL
MNME_PSEE4      ------------------------------------------DGHVTITLSAREDDMGLD
MNME_PSEF5      ------------------------------------------DGHVTISLSAMAAGSGLE
MNME_PSEPF      ------------------------------------------DGHVTISLSAKSAGEGLD
MNME_PSE14      ------------------------------------------DGHVTISLSARSGGAGLE
MNME_PSEU2      ------------------------------------------DGHVTISLSARSGGEGLE
MNME_PSESM      ------------------------------------------DGHVTISLSARSGGEGLE
MNME_PSEMY      ------------------------------------------DGHVTLSLSAKSAD-GLE
MNME_PSEU5      ------------------------------------------DGQATLSLCARSGE-GLE
MNME_SACD2      ------------------------------------------APYQTLPLSAKTGA-GLD
MNME_HYDCU      ------------------------------------------GE-TEIWLSAKHHL-GLD
MNME_LEGPC      -----------------------------------------------VYLSAKTGE-GLD
MNME_LEGPH      -----------------------------------------------VYLSAKTGE-GLD
MNME_LEGPA      -----------------------------------------------VYLSAKTGE-GLD
MNME_LEGPL      -----------------------------------------------VYLSAKTGE-GLD
MNME_ALCBS      -----------------------------------------------FVISAANGE-GLD
MNME_METCA      --------------------------------------------TTVIHLSARTGE-GVD
MNME_NITOC      --------------------------------------------GIALRLSALTGA-GMD
MNME_ALKEH      --------------------------------------------EVAIAVSALTGV-GLP
MNME_COXBU      ---------------------------------------------PHIKLSVKTRA-GVE
MNME_COXBN      ---------------------------------------------PHIKLSVKTRA-GVE
MNME_COXBR      ---------------------------------------------PHIKLSVKTRA-GVE
MNME_PSYCK      HN----------------------------------------RGYEQVNVSCETGA-GID
MNME_PSYA2      YN----------------------------------------RGYEQVNVSCETGA-GID
MNME_PSYWF      L------------------------------------------GYEQVNVSCETSQ-GIP
MNME_ACIBY      -------------------------------------------GFRHITVSAKQEM-GVQ
MNME_ACIBT      -------------------------------------------GFRHITVSAKQEM-GVQ
MNME_ACIAD      -------------------------------------------NFRHVTVSAKMDM-GVQ
MNME_DICNV      -----------------------------------------------LWISAKTGA-GIE
MNME_BORBR      Q-------------------------------------------PDSLAISARGGI-GLD
MNME_BORPA      Q-------------------------------------------PDSLAISARGGI-GLD
MNME_BORPE      Q-------------------------------------------PDSLAISARGGI-GLD
MNME_BORPD      Q-------------------------------------------AGQLGISAREGA-GLD
MNME_BORA1      A-------------------------------------------ENSIGISAKQGL-GLE
MNME_CUPPJ      N-------------------------------------------PTEIWISARTGS-GIE
MNME_CUPNH      N-------------------------------------------PTEIWISARTGA-GIE
MNME_CUPMC      N-------------------------------------------PTEIWISARTGA-GID
MNME_RALSO      --------------------------------------------PPEVWLSARDGS-GIE
MNME_BURM7      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURMA      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURP6      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURP0      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURMS      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURM9      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURPS      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURP1      D-------------------------------------------VCEVRLSAKRGD-GID
MNME_BURTA      D-------------------------------------------LCEVRLSAKRGD-GID
MNME_BURCA      D-------------------------------------------LTEVHLSAKRGD-GID
MNME_BURCH      D-------------------------------------------LTEVHLSAKRGD-GID
MNME_BURCC      D-------------------------------------------LTEVHLSAKRGD-GID
MNME_BURL3      D-------------------------------------------LTEVHLSAKRGD-GID
MNME_BURCM      D-------------------------------------------LTEVHLSAKRGD-GID
MNME_BURA4      D-------------------------------------------LTEVHLSAKRGD-GID
MNME_BURVG      D-------------------------------------------LTEVHLSAKRGD-GID
MNME_PARXL      D-------------------------------------------LSEVRLSAKQGD-GVA
MNME_JANMA      D-------------------------------------------STHIYVSATDLQ-GMD
MNME_HERAR      D-------------------------------------------ATHIYLSATGLL-GMD
MNME_ACISJ      ----------------------------------------------AVLLSARTGQ-GLD
MNME_ACIAC      ----------------------------------------------AVRLSARTGE-GLD
MNME_VEREI      SARPAP------------------------------------APRPAVQLSARTGQ-GLD
MNME_RHOFT      -----------------------------------------------LQLSAKTGA-GLD
MNME_POLSJ      ----------------------------------------------GVLISAKTGA-GLQ
MNME_POLNA      ----------------------------------------------GVLISAKTGA-GLQ
MNME_LEPCP      ----------------------------------------------GVVLSARTHD-GID
MNME_METPP      ----------------------------------------------ALRLSARTGE-GLD
MNME_NEIMA      --------------------------------------------ETVIALSAKTGD-GLD
MNME_NEIMB      --------------------------------------------ETVIALSAKTGD-GLD
MNME_NEIM0      --------------------------------------------ETVIALSAKTGD-GLD
MNME_NEIMF      --------------------------------------------ETVIALSAKTGD-GLD
MNME_NEIG1      --------------------------------------------ETVIALSAKTGD-GLD
MNME_CHRVO      --------------------------------------------HPLVRLSARTHD-GVD
MNME_AZOSB      --------------------------------------------AVRLRLSARSGD-GVD
MNME_AROAE      --------------------------------------------GVVIQLSAQLAL-GVD
MNME_DECAR      --------------------------------------------GTAISLSAKANQ-GIE
MNME_NITEU      --------------------------------------------GPTIYLSAINGE-GIE
MNME_NITEC      --------------------------------------------GTAIYLSVKSGE-GIE
MNME_NITMU      --------------------------------------------TADIWVSAKTGA-GIG
MNME_THIDA      -----------------------------------------------IWLSAKSGE-GVD
MNME_METFK      --------------------------------------------ETHIHLSARTGD-GVH
MNME_POLAQ      --------------------------------------------ASPLLISAKTGA-GID
MNME_FRATF      -----------------------------------------------IYISAENNI-GID
MNME_FRATH      -----------------------------------------------IYISAENNI-GID
MNME_FRATO      -----------------------------------------------IYISAENNI-GID
MNME_FRATT      -----------------------------------------------IYISAENNI-GID
MNME_FRAT1      -----------------------------------------------IYISAENNI-GID
MNME_FRATW      -----------------------------------------------IYISAENNI-GID
MNME_FRATN      -----------------------------------------------IYISAENNI-GID
MNME_FRAP2      -----------------------------------------------IYISAESNI-GID
MNME_RUTMC      -----------------------------------------------LSISAKHSK-GME
MNME_VESOH      -----------------------------------------------LSVSAKYSE-GIK
MNME_XANAC      -----------------------------------------------IAVSAVTGQ-GLE
MNME_XANC5      -----------------------------------------------IAVSAVTGQ-GLE
MNME_XANOM      -----------------------------------------------IAVSAVTGQ-GLE
MNME_XANOR      -----------------------------------------------IAVSAVTGQ-GLE
MNME_XANCP      -----------------------------------------------IAVSAVTGQ-GLE
MNME_XANC8      -----------------------------------------------IAVSAVTGQ-GLE
MNME_XANCB      -----------------------------------------------IAVSAVTGQ-GLE
MNME_XYLFA      -----------------------------------------------IPVSAMTGA-GLE
MNME_XYLFT      -----------------------------------------------IPVSAMTGA-GLD
MNME_BLOFL      ----------------------------------------------CITLSALLNH-GID
MNME_BLOPB      ----------------------------------------------IITLSALFND-GTD
MNME_BAUCH      ----------------------------------------------VITISALSSL-GIE
MNME_WIGBR      ----------------------------------------------IISLSAYTGE-GVD
MNME_BUCCC      ----------------------------------------------CIYLSLKKNI-GIE
MNME_BUCAI      ----------------------------------------------FISISARTGE-GVN
MNME_BUCMP      ----------------------------------------------FINISARTGQ-GID
MNME_BUCAP      ----------------------------------------------FISISALTGQ-GID
MNME_BUCBP      ----------------------------------------------GVLVSSKTGV-GIE
MNME_CAUVC      ----------------------------------------AGEGLTVLHIAGTSAE-GPE
MNME_CAUSK      ----------------------------------------SEQGLKVVELAARKPG-GAE
MNME_MARMM      ----------------------------------------------AYRLSAKSGD-GVE
MNME_RHORT      ---------------------------------------------GALPVSTLTGE-GLD
MNME_MAGSA      ---------------------------------------------PVLTLSAKAGE-GVD
MNME_PARL1      ---------------------------------------------GVIGISALTGQ-GID
MNME_NITWN      ----------------------------------FETKAGQSAPPWRFRISASRGD-GVD
MNME_NITHX      ----------------------------------LEAKPGQGILPRHFWISASRGD-GVD
MNME_BRASO      -------------------------------------TRPDTKASRTFGISARSGA-GMG
MNME_BRASB      -------------------------------------AISVSPESPVFAISARSGA-GMS
MNME_BRADU      -------------------------------------PQGE------FGISASRGD-GIR
MNME_RHOP5      -------------------------------AKNLEANLGQNVPQPSFAISAKRGD-GIA
MNME_RHOPS      -------------------------------AAALRQTDGAWGGNAAFEISALRGQ-GLG
MNME_RHOP2      -------------------------------AANLWQTEGNVAAREAFGISAKRGD-GVG
MNME_RHOPA      ----------------------------------------------VFRISAATGE-GFA
MNME_RHOPB      ----------------------------------------SATGWPCFSISAANGR-GVA
MNME_METPB      -------------------------------------------GEGGLAVSAVTGA-GLD
MNME_METRJ      -------------------------------------------DSADVTVSAHTGA-GMD
MNME_METS4      -------------------------------------------VDGALAISALTGE-GLA
MNME_AZOC5      -------------------------------------------EEDEIVISAQTGA-GIN
MNME_BEII9      -------------------------------------------NREGLAISATSGL-HLG
MNME_RHIEC      ------------------------------------------SGRYDLQISTLTGD-GLS
MNME_RHIL3      ------------------------------------------SGRYDLQISTATGD-GLP
MNME_SINMW      ------------------------------------------TSEADVFLSTRTGE-GMD
MNME_RHIME      ------------------------------------------PSDADIFLSTRTGE-GMA
MNME_AGRFC      ------------------------------------------DDDFDLSISAKEGI-GLD
MNME_BRUC2      -----------------------------------------ASGLWKYHISTMTGS-GLE
MNME_BRUSU      -----------------------------------------ASGLWKYHISTMTGS-GLE
MNME_BRUA2      -----------------------------------------ASGLWKYHISTMTGS-GLE
MNME_BRUAB      -----------------------------------------ASGLWKYHISTMTGS-GLE
MNME_BRUME      -----------------------------------------ASGLWKYHISTMTGS-GLE
MNME_BRUO2      -----------------------------------------ASGLWKYHISTMTGS-GLE
MNME_BRUSI      -----------------------------------------ASGLWKYHISTMTGS-GLE
MNME_OCHA4      -----------------------------------------SADCWTYRISTKTGE-GLD
MNME_BARHE      -----------------------------------------NKEPWLIQFSALTGL-NFD
MNME_BART1      -----------------------------------------NDPCWSIQFSALTGL-NFD
MNME_BARQU      -----------------------------------------NKKTWTIQFSALTGL-NFD
MNME_BARBK      -----------------------------------------DKTRWPIQFSALNGL-NFD
MNME_CHESB      -----------------------------------------PAASYNCLISAKTGL-GLD
MNME_RHILO      -----------------------------------------AAGRYDVAISVVGGT-GVE
MNME_HYPNA      -------------------------------------------PDGALPISVITGE-GID
MNME_GRABC      ---------------------------------------------DIVLVSTLTGD-GME
MNME_ACICJ      ----------------------------------------------MLAVSARTGA-GLA
MNME_GLUOX      -----------------------------------------------LGISTQSGE-GLA
MNME_ERYLH      ---------------------------------------------PRLRLSAKTGE-GID
MNME_NOVAD      ---------------------------------------------CAFHLSAVTGE-GMA
MNME_SPHWW      ---------------------------------------------HDLLVSARSGT-GMD
MNME_SPHAL      --------------------------------------------HCDLILSAATGE-GMD
MNME_ZYMMO      --------------------------------------------KIDIAVSAVTGE-GID
MNME_RUEST      -----------------------------------------------GAISGRTGQ-GVD
MNME_RUEPO      -----------------------------------------------NAISGVTGQ-GVD
MNME_ROSDO      -----------------------------------------------TGISGKTGQ-GIP
MNME_RHOS4      -----------------------------------------------LRLSGRTGE-GVP
MNME_RHOS1      -----------------------------------------------LRLSGRTGE-GVP
MNME_RHOS5      -----------------------------------------------LSVSGLTGD-GIQ
MNME_DINSH      -----------------------------------------------FAISSVTGR-GID
MNME_JANSC      -------------------------------------------------ISGRTGV-GID
MNME_PARDP      -----------------------------------------------TAISGLTGE-GVA
MNME_RICAH      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICFE      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICRO      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICRS      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICCN      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICM5      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICCK      ----------------------------------------------CLRVSIKNNI-ALN
MNME_RICPR      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICTY      ----------------------------------------------CLRVSVKNNI-ALS
MNME_RICB8      ----------------------------------------------CLKVSIKNNI-ALP
MNME_RICBR      ----------------------------------------------CLKVSIKNNI-ALP
MNME_ORITB      ----------------------------------------------IVAVSLLKQV-GLD
MNME_ANAMM      -----------------------------------------------YLVSVHTNL-GVD
MNME_ANAPZ      -----------------------------------------------HLISVHQDR-GIG
MNME_EHRCJ      -----------------------------------------------VPISVCCNR-GIE
MNME_EHRCR      -----------------------------------------------IPISVYCNI-GIE
MNME_EHRRW      -----------------------------------------------IPVSVCCNL-GIE
MNME_EHRRG      -----------------------------------------------IPVSVCCNL-GIE
MNME_WOLTR      -----------------------------------------------LPVSILKGI-GTE
MNME_WOLPM      -----------------------------------------------LPISILKEI-GTN
MNME_NEOSM      GECSDDVDRRFNELFTAAKKLEIPVVKVVTKGDIAPTQLSFWQDKGYICISVYKGE-GMQ
MNME_PELUB      -----------------------------------------------VLISVKNNL-NLE
MNME_DEIRA      ---------------------------------------AAWTDPAALDVSAVTGA-GLP
MNME_DEIGD      ---------------------------------------AAWTDPGALDVSAVTGQ-GLS
MNME_THET8      ---------------------------------------PAWEDPEFLPVSSLTGE-GLD
MNME_THET2      ---------------------------------------PAWEDPEFLPVSSLTGE-GLG
MNME_HALHL      ------------------------------------GESEVGAHVRRARVSAHTGA-GIE
MNME_MYXXD      ---------------------------------------EVSSSPRQ-RVSGLTGE-GVD
MNME_RHOBA      ----------------------------------------GESMRADLAVSSESGT-GVD
MNME_AQUAE      --------------------------------------------EKIVKVSALKGT-GLE
MNME_MAGMM      --------------------------------------------EQICGVSCHTGE-GLE
MNME_KORVE      --------------------------------------------IPVVRTSAVSGE-GIA
MNME_SOLUE      --------------------------------------------IPV---SALTGQ-GVP
MNME_CHLTR      ---------------------------------------------------AKTGE-GLL
MNME_CHLTB      ---------------------------------------------------AKTGE-GLL
MNME_CHLT2      ---------------------------------------------------AKTGE-GLL
MNME_CHLTA      ---------------------------------------------------AKTGE-GLL
MNME_CHLMU      ---------------------------------------------------AKTGK-GFS
MNME_CHLCV      ---------------------------------------------------AKTGE-GIF
MNME_CHLFF      ---------------------------------------------------AKTGD-GIL
MNME_CHLAB      ---------------------------------------------------AKTGA-GMI
MNME_CHLPN      ---------------------------------------------------AKTGE-GLT
MNME_PARUW      ---------------------------------------------------AKEKI-GLE
MNME_OPITP      -------------------------------------------------CSAKIGV-GLD
MNME_BDEBA      -------------------------------------------------FFQKLAD-PAA
MNME_DESHY      ---------------------------------------------VWIPFSVKENL-GFK
MNME_ALKMQ      --------------------------------------------KKVIKISLIEES-GLE
MNME_ALKOO      --------------------------------------------KKIIKVSLIEEI-GLE
MNME_CLOD6      --------------------------------------------NSIIKISALQQE-GIE
MNME_FINM2      ----------------------------------------------VIHTSIKNNE-GIE
MNME_FUSNN      ----------------------------------------------WIEISALSKL-GID
MNME_CLOB1      --------------------------------------------KYIIKTSVKNNS-GLN
MNME_CLOBK      --------------------------------------------KYIIKTSVKNNS-GLN
MNME_CLOBH      --------------------------------------------KYIIKTSVKNNS-GLN
MNME_CLOBL      --------------------------------------------KYIIKTSVKNNS-GLN
MNME_CLOBM      --------------------------------------------KYIIKTSVKNNS-GLN
MNME_CLOK5      --------------------------------------------RFIIKTSIKNGE-GLD
MNME_CLOTE      --------------------------------------------YNIIEISAKMGF-GLE
MNME_CLONN      --------------------------------------------KYIIEISAKTGS-GLD
MNME_CLOAB      --------------------------------------------DNIIEFSVKEKV-GLE
MNME_CLOPE      ---------------------------------------------NKIELSAKTGF-GID
MNME_CLOP1      ---------------------------------------------NKIELSAKTGF-GID
MNME_CLOPS      ---------------------------------------------NKIELSAKTGF-GID
MNME_CLOB8      ---------------------------------------------NIINISAKTGQ-GID
MNME_LACP7      --------------------------------------------KPILKISAIDQT-GIK
MNME_THEP3      --------------------------------------------GIIIEVSTVEKI-GLE
MNME_THEPX      --------------------------------------------GIIIEVSTVEKI-GLE
MNME_CALS4      --------------------------------------------GIIVEVSTVERT-GLD
MNME_HUNT2      --------------------------------------------RKCIRTSVKEGT-GIS
MNME_CARHZ      --------------------------------------------KNFVPFSARNFE-GLE
MNME_DESRM      --------------------------------------------SEIIEISAQKEI-GLD
MNME_PELTS      --------------------------------------------RPVLWISALEGT-GLD
MNME_CALS8      --------------------------------------------KEGIFISIAKDE-NLE
MNME_SYNWW      --------------------------------------------VKIVRGSIIEET-GLE
MNME_NATTJ      --------------------------------------------IPKVRISALKEE-GLD
MNME_DESPS      --------------------------------------------VPRLAISAREGE-GLE
MNME_MOOTA      F----------------------------------------AGNYPRVAVSALKGK-GLD
MNME_DESAP      A----------------------------------------LVDGPVLMAAIIEGR-GLN
MNME_ROSS1      G----------------------------------------KAFDAMVTVSALTGQ-GLD
MNME_ROSCS      G----------------------------------------VPFDATIAVSALTGQ-GLD
MNME_CHLAA      ------------------------------------------KAMAVVACSARYGH-GID
MNME_SYMTH      -----------------------------------------LGGAPVVGVSAETGE-GFD
MNME_HELMI      L----------------------------------------VGEMPIISVSAKEGW-GLK
MNME_GEOSL      ---------------------------------------------PRVTVSTSRGD-GID
MNME_GEOMG      ---------------------------------------------HTVAISTATGA-GID
MNME_GEOUR      ---------------------------------------------PIIAVSTLTGD-GID
MNME_PELPD      ---------------------------------------------PQVSFSAESGE-GVD
MNME_PELCD      ---------------------------------------------PYVRTSVLEKN-GLD
MNME_SYNAS      ------------------------------------------GTDPLW-VSAKFGE-GIA
MNME_SYNFM      ------------------------------------------ENVPIMAISALRPP-DVE
MNME_DESVH      -----------------------------------------------VHVAAASGD-GVE
MNME_DESVV      -----------------------------------------------VHVAAASGD-GVE
MNME_DESAG      -----------------------------------------------VAVSAREGK-GMD
MNME_LAWIP      -----------------------------------------------ICVSAKTGS-GIE
MNME_NOSS1      -----------------------------------------ENITQIVHTAAAQKQ-GID
MNME_TRIV2      -----------------------------------------KNITQIVHTAAAQKQ-GID
MNME_TRIEI      -----------------------------------------ETIKNVVATAAINNQ-GIE
MNME_ACAM1      -----------------------------------------EAIAQVVSTIAAQNQ-GIS
MNME_SYNY3      -----------------------------------------PEITNTVLTAAAANL-GIE
MNME_MICAN      -----------------------------------------AEIKRVVKLSAAQNQ-GIE
MNME_SYNP2      -----------------------------------------PQVQGVVKTAAAQHQ-GVD
MNME_SYNE7      -----------------------------------------QEFKAIVWTAAAQQQ-GIE
MNME_SYNP6      -----------------------------------------QEFKAIVWTAAAQQK-GIE
MNME_THEEB      -----------------------------------------IAPIPTVLLSALSQR-GIE
MNME_SYNJA      -----------------------------------------PEIAYRVPAVAAQGQ-GIP
MNME_SYNJB      -----------------------------------------PEIAHRVPAVAAQGK-GIP
MNME_GLOVI      -----------------------------------------RGVLATVPTAAPVGD-GID
MNME_PROM1      I----------------------------------------LKKENLVILSAKTGN-GED
MNME_PROMT      I----------------------------------------LKKENLVIISAKTGN-GED
MNME_PROMA      -----------------------------------------TNIQPHATMTAITGE-GEK
MNME_PROM3      V----------------------------------------DGKTVDVMLSALTGQ-GEE
MNME_PROMM      V----------------------------------------DGKTVDVMLSALTGQ-GEE
MNME_SYNSC      ----------------------------------------------DVQLSALEGM-GEA
MNME_SYNPX      ----------------------------------------------DVQLSALEGT-GEE
MNME_SYNS9      ----------------------------------------------DVQFSALNGA-GED
MNME_SYNPW      T----------------------------------------SGSAADIRLSASTGA-GEA
MNME_SYNS3      V----------------------------------------AASVADVRLSAVTGD-GEQ
MNME_SYNR3      -----------------------------------------------LAISARSGL-GLA
MNME_PROMS      -----------------------------------------ELKHT-ILMSIKNND-GER
MNME_PROM0      -----------------------------------------ELKNT-ILMSIKNND-GEK
MNME_PROM2      -----------------------------------------ELKNT-ILMSIKNND-GER
MNME_PROM9      -----------------------------------------ELKNT-ILMSIKNND-GER
MNME_PROM5      -----------------------------------------TFSSDIVLMSIKNNE-GEK
MNME_PROMP      -----------------------------------------NLSNS-VLMSIKNDE-GEK
MNME_CYACA      ---------------------------------------------RIIEVSAIKNI-GLE
MNME_CYAM1      -----------------------------------------------VKVSALYAT-NLS
MNME_BACFR      ------------------------------------------SEIESIFISAKQRL-HTD
MNME_BACFN      ------------------------------------------SEIESIFISAKQRL-HTD
MNME_BACTN      ------------------------------------------EYTKSIFISAKERR-QTD
MNME_BACV8      -------------------------------------------KVEKLFISAKKRE-NIT
MNME_PARD8      ---------------------------------------------HQIAISAKSKL-HIA
MNME_PORGI      ------------------------------------------TPTKPIFISAREGR-GID
MNME_FLAJ1      --------------------------------------------AKLLLISAKQKI-GVE
MNME_FLAPJ      --------------------------------------------PEILLISAKEKL-GVE
MNME_GRAFK      ------------------------------------------ERAQFLLLSAKTNL-GVE
MNME_CYTH3      --------------------------------------------DGIIYISAKQNI-GIE
MNME_SALRD      --------------------------------------------LSALEAREDADE-VQP
MNME_CHLTE      ------------------------------------------TGTEVIGISALNGD-GID
MNME_CHLPD      ------------------------------------------AGCEAIGISARQKL-GID
MNME_CHLPM      ------------------------------------------TACPVIAMAASKGD-GLN
MNME_PELLD      ------------------------------------------AGSPVVPMAARSGE-GIE
MNME_CHLCH      ------------------------------------------PQATVCGIAAKEGD-GLE
MNME_BORAP      --------------------------------------------SNLIMISIKNLE-GID
MNME_BORBU      --------------------------------------------SNLIMISTKNLE-GID
MNME_BORBP      --------------------------------------------SNLIMISTKNLE-GID
MNME_TREPA      --------------------------------------------ISAPVLSCARSQ-DAR
MNME_TREDE      --------------------------------------------AEPIIISSKASN-GIK
MNME_LEPBJ      --------------------------------------------LIICEISCKTKE-GIP
MNME_LEPBL      --------------------------------------------LIICEISCKTKE-GIP
MNME_LEPIN      --------------------------------------------LIVLEISCKTKE-GIS
MNME_LEPIC      --------------------------------------------LIVLEISCKTKE-GIS
MNME_LEPBA      --------------------------------------------LTISEISCKTKQ-GIP
MNME_LEPBP      --------------------------------------------LTISEISCKTKQ-GIP
MNME_UNCTG      ---------------------------------------------VKVKISAKTGV-GIA
MNME_SULMW      -----------------------------------------EFNYKKIFKISAKYGYGVN
MNME_CARRP      -----------------------------------------VFKIKNILIILISSKNG--
                                                                            

MNME_THEMA      KLEESIYRETQ--EIFE---------------------------------RGSDSLITNL
MNME_THESQ      KLEESIYRETQ--EIFE---------------------------------RGSDSLITNL
MNME_THEP1      KLEEAIYRETQ--EIFE---------------------------------RGSDSLITNL
MNME_FERNB      ELEEKILESVK--VLVE---------------------------------DGELSHVTSK
MNME_THEM4      NLENKIVSKVK--NIIE---------------------------------SGTASHVITQ
MNME_PSELT      RLEEEIIKSVK--DLIQ---------------------------------Q-TDGYITTQ
MNME_PETMO      NLENKIYEKFF--EKVN---------------------------------I-EEPTLTNQ
MNME_AYWBP      ELQQTILKKFQLNDIK----------------------------------PKDFNYFSNA
MNME_ONYPE      ELQQTILKKFQLNDIQ----------------------------------PKDFNYFSNA
MNME_ACHLI      VLESEILKTLKLDNLV----------------------------------DKDFNYLSNV
MNME_BACAN      ELEKAIADLFFEGTID----------------------------------SADVTYVSNA
MNME_BACHK      ELEKAIADLFFEGTID----------------------------------SADVTYVSNA
MNME_BACCZ      ELEKAIADLFFEGTID----------------------------------SADVTYVSNA
MNME_BACAH      ELEKAIADLFFEGTID----------------------------------SADVTYVSNA
MNME_BACC1      ELETAIADLFFEGTID----------------------------------SADVTYVSNA
MNME_BACCR      ELEKAIADLFFEGTID----------------------------------SADMTYVSNA
MNME_BACMK      ELEKAIADLFFEGTID----------------------------------SADMTYVSNA
MNME_BACCN      ELEKAIADLFFEGTIE----------------------------------SADMTYVSNA
MNME_BACSU      DLEEAIQSLFYTGAIE----------------------------------SGDLTYVSNT
MNME_BACVZ      DLEEAIQSLFYTGAIE----------------------------------SGDLTYVSNT
MNME_BACP2      ELEMAIQSLFFTGSIE----------------------------------SGDLTYVSNT
MNME_BACLD      ELEEAIQSLFFTGAIE----------------------------------SGDLTYVSNT
MNME_GEOKA      ELEKAIADLFFGGELE----------------------------------AGDLTYVSNS
MNME_GEOTN      ELEKAIADLFFGGELE----------------------------------AGDLTYVSNS
MNME_LYSSC      ELEEAIAALFFEGQIE----------------------------------AGDLTYVSNA
MNME_OCEIH      ELEKAIADTFFTGDID----------------------------------TGDMTYVSNV
MNME_BACSK      QLEEAISRLFFAGGVE----------------------------------GADLTYVSNA
MNME_BACHD      ELEAAIASLFFESGIE----------------------------------SGDVTYVSNS
MNME_EXIS2      DLEAAIASLFFEQGVE----------------------------------GQDMTYVSNA
MNME_STAAC      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAE      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAT      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAA3      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAA2      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAA9      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAR      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAW      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAN      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAA8      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAA1      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAM      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAS      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAAB      ELEIQIRDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAES      ELEIQIKDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAEQ      ELEIQIKDLFFGGEVQ----------------------------------NQDMTYVSNS
MNME_STAHJ      QLELQIRDLFFGGDVQ----------------------------------NQDMTYVSNS
MNME_STAS1      QLEIQIRDLFFGGDVQ----------------------------------NQDMTYVSNS
MNME_LISMO      ALEEAIKTLFFAGDID----------------------------------AGDATYVSNV
MNME_LISMF      ALEEAIKTLFFAGDID----------------------------------AGDATYVSNV
MNME_LISIN      ALEEAIKALFFAGDID----------------------------------AGDATYVSNV
MNME_LISW6      ALEEAIKTLFFAGDID----------------------------------AGDATYVSNV
MNME_ENTFA      QLEAKIADLFFGGQTG----------------------------------EKDATYISNT
MNME_LACP3      ALDERIAKLFF-GGIEN---------------------------------SQTTVMVSNA
MNME_LACSS      DLEAQIAKLFF-GGIEN---------------------------------SQSTVMITNA
MNME_LACS1      KLEEKIAELFF-GGIEN---------------------------------SQSTIMVTNA
MNME_LACPL      QLEQRIAKMFFNEGIES---------------------------------SQNNVMVTNA
MNME_LACBA      QLEETIAHLFFDEGIES---------------------------------SQNTVMVTNA
MNME_PEDPA      DLEDRIAAMFFAGSIEN---------------------------------TSNNIMVTNA
MNME_LACLM      AVEEKINQIFFAGE-IE---------------------------------AKDATVLSNA
MNME_LACLS      AVEEKINQIFFAGE-IE---------------------------------AKDATVLSNA
MNME_LACLA      AVEEKINQIFFAGE-IE---------------------------------AKDATVLSNA
MNME_STRA1      KIEERINDIFFDNAGMV---------------------------------EHDATYLSNA
MNME_STRA5      KIEERINDIFFDNAGMV---------------------------------EHDATYLSNA
MNME_STRA3      KIEERINDIFFDNAGMV---------------------------------EHDATYLSNA
MNME_STRAG      KIEERINDIFFDNAGMV---------------------------------EHDATYLSNA
MNME_STRTD      KIEDRINQLFFDNAGLV---------------------------------EKDATYLSNA
MNME_STRT1      KIEDRINQLFFDNAGLV---------------------------------EKDATYLSNA
MNME_STRT2      KIEDRINQLFFDNAGLV---------------------------------EKDATYLSNA
MNME_STRMU      VIEERINKLFFDNAAIV---------------------------------EKDATYLSNA
MNME_STRP8      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRPD      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRP6      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRP3      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRPG      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRP1      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRPC      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRPM      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRPF      LIEDRINQLFFDNAGLV---------------------------------EQDATYLSNA
MNME_STRGC      KIEERINQLFFENAGIV---------------------------------EQDATYLSNA
MNME_STRSV      KIEERINQLFFENAGIV---------------------------------EQDATYLSNA
MNME_STRR6      KIEERINNLFFENAGLV---------------------------------EQDATYLSNA
MNME_STRP2      KIEERINNLFFENAGLV---------------------------------EQDATYLSNA
MNME_STRPI      KIEERINNLFFENAGLV---------------------------------EQDATYLSNA
MNME_STRPN      KIEERINNLFFENAGLV---------------------------------EQDATYLSNA
MNME_STRSY      QIEEKINQLFFENAGLV---------------------------------EQDATYLSNS
MNME_STRS2      QIEEKINQLFFENAGLV---------------------------------EQDATYLSNS
MNME_LACGA      ALENAIEKLFFSGIEN----------------------------------SQNQILVTNQ
MNME_LACJO      ALENAIEQLFFSGIEN----------------------------------SQNQILVTNQ
MNME_LACAC      ELEELINKLFFAGIEN----------------------------------SNDQVMVTNQ
MNME_LACH4      KLEELINKLFFAGIEN----------------------------------SNDQVMVTNQ
MNME_LACDB      ELEALIKKLFFKGIEN----------------------------------SNDQVLVTNQ
MNME_LACDA      ELEALIKKLFFKGIEN----------------------------------SNDQVLVTNQ
MNME_MYCGE      ELVDLLTKYINEFYKKI---------------------------------DQK-IYLIEN
MNME_MYCPN      PLVDLLTQYLHQFYSVE---------------------------------QNQ-LYLISD
MNME_MYCGA      DLIKYLEETSLAIFNDE---------------------------------NKQDSIFQEE
MNME_UREPA      SLIDEIKKLFYVQEFDN---------------------------------ANI-DVLQSQ
MNME_UREP2      SLIDEIKKLFYVQEFDN---------------------------------ANI-DVLQSQ
MNME_MYCPE      PLVNEIKTNLKQGDFNI---------------------------------ANN-LAICSD
MNME_MYCMS      QLVLRINQMYLNEEINK---------------------------------NDE-LILIGL
MNME_MYCCT      QLVLRINQMYLNEEISK---------------------------------SDE-LILIGL
MNME_MESFL      NLIMKIEQMHINEEIIN---------------------------------NDS-LILINL
MNME_MYCPU      ELEKAILFEYQNID------------------------------------LDDFRMIQNT
MNME_MYCMO      ELENKLSSYCNDVE------------------------------------WDNPNLIYSQ
MNME_MYCAP      PLKEKLVSVFKNVD------------------------------------LNNDQYVNNS
MNME_MYCS5      NLEDHLLKIYSGFD------------------------------------FNSEDIFATA
MNME_MYCHJ      NLLEKIKSIFAFLG------------------------------------KNK-EFVANS
MNME_MYCH2      NLLEKIKSIFAFLG------------------------------------KNK-EFVANS
MNME_MYCH7      NLLEKIKSIFAFLG------------------------------------KNK-EFVANS
MNME_CAMJE      -ITLLKEELQNYLNSFD----------------------------------SEGIMVSSL
MNME_CAMJJ      -ITLLKEELQNYLNSFD----------------------------------SEGIMVSSL
MNME_CAMJR      -ITLLKEELQNYLNSFD----------------------------------SEGIMVSSL
MNME_CAMJ8      -ITLLKEELQNYLNSFD----------------------------------SEGIMVSSL
MNME_CAMJD      -IALLKEELQNYLNSFD----------------------------------SEGIMVSSL
MNME_CAMC5      -ADEIVGRLRDYLDSQD----------------------------------SSEMMLSSN
MNME_CAMC1      -SSVVLKELEGYLKTQD----------------------------------TDEIMLSSN
MNME_CAMHC      -TKIITKVLNDYLNSQN----------------------------------FDGIMLSSN
MNME_CAMFF      -STPLSKELESYLNSQD----------------------------------TNDIMLSSN
MNME_SULDN      -VEELILALENIMNQAN---------------------------------TSDEMMLISQ
MNME_ARCB4      -INPLIKELELILDSNT---------------------------------FGDDITLVSK
MNME_NITSB      -ITPLTQKLQKLLDSFA---------------------------------NTEEIMLVTS
MNME_SULNB      -FVKLTRQMEALLDSIG---------------------------------EGEELMLISA
MNME_HELHP      GVQKVLECLEEVVSTHN---------------------------------GDESMILTSS
MNME_WOLSU      GVEELLSLLASWLDEQG---------------------------------GGEELMLTSE
MNME_HELPY      CLKDLSQKISAFFPKLD---------------------------------TQNKLLLTSL
MNME_HELPJ      CLKDLSQKISEFFPKLD---------------------------------TQNKLLLTSL
MNME_HELPH      CLKDLGQKISAFFPKLD---------------------------------TQNKLLLTSL
MNME_HELAH      CLKDLSQKISAFFPKLD---------------------------------TQNKLLLTSL
MNME_ECOLI      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECOLC      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SHIBS      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECODH      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SHIFL      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SHIF8      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SHIDS      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECO57      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECOUT      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECOL5      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECOK1      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECOL6      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECOSM      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECO24      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ECOHS      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SHISS      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SALCH      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SALPB      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SALTY      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SALPA      VLRNNLKQSMGFETNM------------------------------------EGGFLARR
MNME_SALTI      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_SALAR      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_CITK8      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_ENT38      DLRNHLKQSMGFETNM------------------------------------EGGFLARR
MNME_KLEP7      VLRNHLKQSMGFDTNM------------------------------------EGGFLARR
MNME_CROS8      VLRNHLKQSMGFDTSM------------------------------------EGGFLARR
MNME_YERPA      LLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_YERPN      LLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_YERPP      LLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_YERPE      LLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_YERPS      LLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_YERP3      LLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_YERPY      LLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_YERE8      LLRNHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_SERP5      LLRDHLKQSMGFTSNM------------------------------------EGGFLARR
MNME_PECAS      TLRDHLKQSMGFTSNT------------------------------------EGGFLARR
MNME_PHOLL      LLRDHLKETMGFSSNT------------------------------------EGGFLARR
MNME_SODGM      LLRTHLKQSMGFTGGT------------------------------------EGGFLARR
MNME_ACTP2      LLREHLKKSMGYQSST------------------------------------EGGFLARR
MNME_ACTPJ      LLREHLKKSMGYQSST------------------------------------EGGFLARR
MNME_HAEDU      VLREHLKTSMGYQSST------------------------------------EGGFLARR
MNME_HAEI8      LLRDHLKQAMGFQTGI------------------------------------EGGFLARR
MNME_HAEIE      LLREHLKQAMGFQTGI------------------------------------EGGFLARR
MNME_HAEIN      LLREHLKQAMGFQTGM------------------------------------EGGFLARR
MNME_HAEIG      LLREHLKQAMGFQTGM------------------------------------EGGFLARR
MNME_MANSM      LLREHLKQSMGYQTGT------------------------------------EGGFLARR
MNME_ACTSZ      LLREHLKQSMGYQTGT------------------------------------EGGFLARR
MNME_PASMU      LLREHLKQSMGYQTNM------------------------------------EGGFLARR
MNME_HAES1      LLRQHLKQSMGYQVCT------------------------------------EGGFLARR
MNME_HISS2      LLRQHLKQSMGYQVCT------------------------------------EGGFLARR
MNME_AERHH      ALREHLKACMGFQGNT------------------------------------EGGFMARR
MNME_AERS4      ALREHLKACMGFQGNT------------------------------------EGGFMARR
MNME_SHEB8      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEB9      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEB5      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEPC      ELKLHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHESW      ELKLHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHESA      ELKQHLKSLMGYKSNL------------------------------------EGGFIARR
MNME_SHESM      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHESR      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEON      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEFN      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEDO      ELKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEHH      DLKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEPA      DLKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHESH      ELQQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHEWM      SLQQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_SHELP      ELKAHLKSLMGYQSNL------------------------------------EGGFLARR
MNME_SHEAM      ALKQHLKSLMGYQSNL------------------------------------EGGFIARR
MNME_VIBCH      ALRQHLKECMGFSGNQ------------------------------------EGGFMARR
MNME_VIBC3      ALRQHLKECMGFSGNQ------------------------------------EGGFMARR
MNME_VIBCB      ALRTHLKECMGFSGNT------------------------------------EGGFMARR
MNME_VIBPA      ALRNHLKECMGFSGNT------------------------------------EGGFMARR
MNME_VIBVU      ALRNHLKECMGFSGNS------------------------------------EGGFMARR
MNME_VIBVY      ALRNHLKECMGFSGNS------------------------------------EGGFMARR
MNME_ALIF1      ALRNHLKECMGFSGNQ------------------------------------EGGFMARR
MNME_PHOPR      SLREHLKDCMGFSGTT------------------------------------EGGFMARR
MNME_PSYIN      LLKEHLKDIMGYQGHT------------------------------------TSGFMARR
MNME_PSEA6      VLAEHLKECMGFHSSN------------------------------------EGQFIARR
MNME_PSEHT      LVREHLKACIGFDGAT------------------------------------EGGFMARR
MNME_IDILO      LLREHLKHCVGYSATS------------------------------------EGSFMARR
MNME_COLP3      SLKEHLKTIMGYQGGT------------------------------------EGGFMARR
MNME_CHRSD      NLKEHLKAVMGFDATT------------------------------------EGRFSARR
MNME_MARMS      DLTEHLKAVMGFDSTT------------------------------------EGGFIARR
MNME_MARHV      VLREHLKECIGFASTT------------------------------------EGGFLARR
MNME_HAHCH      VLREHLKACVGFESHA------------------------------------EGGFMARR
MNME_PSEAE      LLREHLKACMGFEQTA------------------------------------ESGFSARR
MNME_PSEAB      LLREHLKACMGFEQTA------------------------------------ESGFSARR
MNME_PSEA7      LLREHLKACMGFEQTA------------------------------------ESGFSARR
MNME_PSEPU      LLRDHLKGCMGYEQTA------------------------------------ESGFSARR
MNME_PSEP1      LLRDHLKGCMGYEQTA------------------------------------ESGFSARR
MNME_PSEPK      LLRDHLKGCMGYEQTA------------------------------------ESGFSARR
MNME_PSEPG      LLRDHLKACMGYEQTA------------------------------------ESGFSARR
MNME_PSEPW      LLRDHLKACMGYEQTA------------------------------------ESGFSARR
MNME_PSEE4      LLRDHLKACMGYEQTA------------------------------------ESSFSARR
MNME_PSEF5      LLRDHLKACMGYEQTS------------------------------------ESSFSARR
MNME_PSEPF      LLRDHLKACMGYEQTS------------------------------------ESSFSARR
MNME_PSE14      LLREHLKACMGYEQTS------------------------------------ESSFSARR
MNME_PSEU2      LLREHLKACMGYEQTS------------------------------------ESSFSARR
MNME_PSESM      LLREHLKACMGYEQTS------------------------------------ESSFSARR
MNME_PSEMY      LLREHLKACMGYQQTA------------------------------------ESGFSARR
MNME_PSEU5      LLREHLKHCMGYEQTA------------------------------------ESSFSARR
MNME_SACD2      TLKAHLKSVMGFQSTT------------------------------------EGGFSARR
MNME_HYDCU      LLKQHLKTEMGYAQTE------------------------------------EGVFMARK
MNME_LEGPC      ELKKVIKQVVGYQPT-------------------------------------EGQFLARR
MNME_LEGPH      ELKKVIKQVVGYQPT-------------------------------------EGQFLARR
MNME_LEGPA      ELKKVIKQVVGYQPT-------------------------------------EGQFLARR
MNME_LEGPL      ELKKVIKQVVGYQPT-------------------------------------EGQFLARR
MNME_ALCBS      ALRGHLKQVAGYQGEG------------------------------------QSRFSARR
MNME_METCA      LLRQEIIRRAGYKKGT------------------------------------EGVFSARR
MNME_NITOC      LLCQRLKECAGFDRES------------------------------------EGCFSARR
MNME_ALKEH      ALRDHLKSVMGYG-EA------------------------------------GSHFSARR
MNME_COXBU      LLKNHLKNTAGFEATH------------------------------------ENNFIARR
MNME_COXBN      LLKNHLKNTAGFEATH------------------------------------ENNFIARR
MNME_COXBR      LLKNHLKNTAGFEATH------------------------------------ENNFIARR
MNME_PSYCK      DLVETLCAKVGFHPP-------------------------------------ENSLIART
MNME_PSYA2      DLVETLCAKVGFHPP-------------------------------------ENSLIART
MNME_PSYWF      QLIASLCDKVGFHPP-------------------------------------ENSLIART
MNME_ACIBY      GLVDAITAHAGFHPE-------------------------------------EDTFIART
MNME_ACIBT      GLVDAITAHAGFHPE-------------------------------------EDTFIART
MNME_ACIAD      ALIDAITAHAGFQPE-------------------------------------EDTFIART
MNME_DICNV      ILLKKIATLAGKNQHE------------------------------------ETVFIARK
MNME_BORBR      ALRQRLLQLAGWNPG------------------------------------AESPWLARE
MNME_BORPA      ALRQRLLQLAGWNPG------------------------------------AESPWLARE
MNME_BORPE      ALRQHLLQLAGWNPG------------------------------------AESPWLARE
MNME_BORPD      ELRARLLALAGWNPG------------------------------------AESPWLARE
MNME_BORA1      ELRARLLQMAGWNPG------------------------------------AESPWLARE
MNME_CUPPJ      LLRKELLRLVGWQSG------------------------------------NEGTFLARE
MNME_CUPNH      LLRRELLRLVGWQSG------------------------------------NEGNFLARE
MNME_CUPMC      LMRSELLRLIGWQSG------------------------------------NEGAFLARE
MNME_RALSO      LLRAALLEIAGWQGG------------------------------------GEGLYLARE
MNME_BURM7      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURMA      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURP6      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURP0      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURMS      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURM9      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURPS      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURP1      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURTA      LLRGELLRIAGWQAG------------------------------------AESVYLARE
MNME_BURCA      MLRAELLRIAGWQAG------------------------------------AEGVYLARE
MNME_BURCH      MLRAELLRIAGWQAG------------------------------------AEGVYLARE
MNME_BURCC      MLRAELLRIAGWQAG------------------------------------AEGVYLARE
MNME_BURL3      MLRAELLRIAGWQAG------------------------------------AEGVYLARE
MNME_BURCM      MLRAELLRIAGWQAG------------------------------------AEGVYLARE
MNME_BURA4      MLRAELLRIAGWQAG------------------------------------AEGVYLARE
MNME_BURVG      MLRAELLRIAGWQAG------------------------------------AEGVYLARE
MNME_PARXL      LLREELLRIAGWQAG------------------------------------AESVYLARE
MNME_JANMA      LLRGELLRLIGWQQT------------------------------------GESLYLARE
MNME_HERAR      LLRTELLHLVGWQQT------------------------------------GESLYLARE
MNME_ACISJ      TLRRQLLQIAGWQSA------------------------------------AEGVYIARA
MNME_ACIAC      GLRRVLLDIAGWQSA------------------------------------PEGIYTARA
MNME_VEREI      GLRRILLEVAGWQSV------------------------------------PEGICIARA
MNME_RHOFT      TLRRKLLELVGWQSK------------------------------------PEGVYMARE
MNME_POLSJ      TLRQRLLQVVGWQAA------------------------------------PEGVFMARE
MNME_POLNA      ALREQLLRVVGWQAA------------------------------------PEGVFMARE
MNME_LEPCP      ALRAALLARAGWHAA------------------------------------PEGVFIARE
MNME_METPP      TLRRRLLQLAGWQAG------------------------------------SEGVFIART
MNME_NEIMA      ALKRTLLREAGWQGE------------------------------------SEGLFLART
MNME_NEIMB      ALKRTLLREAGWQGE------------------------------------SEGLFLART
MNME_NEIM0      ALKRTLLREAGWQGE------------------------------------GEGLFLART
MNME_NEIMF      ALKRTLLREAGWQGE------------------------------------GEGLFLART
MNME_NEIG1      ALKRTLLCEAGWQGE------------------------------------SEGLFLART
MNME_CHRVO      ILKAKLLEMIGYSGA------------------------------------DEGVFLARQ
MNME_AZOSB      LLRTELLRAAGWHAH------------------------------------GEDVVLARE
MNME_AROAE      LLRSELLRVAGWHAH------------------------------------GDDVVLARE
MNME_DECAR      LLRQELLRIAGWH-Q------------------------------------AEDVFIARE
MNME_NITEU      LLRAALLKTAGWQANIA----------------------------------GEGAYMARQ
MNME_NITEC      LLRTVLLKTVGWQTNIA----------------------------------GEGAYMARQ
MNME_NITMU      SLQQGLLEMIGWQPS-T----------------------------------GEGAFMARQ
MNME_THIDA      LLRAKLLQAAGWQAA------------------------------------GEGAFMART
MNME_METFK      LLRQRLLDIAGWQPS------------------------------------GEGVFMARS
MNME_POLAQ      ALKQKILHVVGWNGA------------------------------------QEGAIVSRR
MNME_FRATF      KLKEHILNKVGYTNQN------------------------------------ESIYTARE
MNME_FRATH      KLKEHILNKVGYTNQN------------------------------------ESIYTARE
MNME_FRATO      KLKEHILNKVGYTNQN------------------------------------ESIYTARE
MNME_FRATT      KLKEHILNKVGYTNQN------------------------------------ESIYTARE
MNME_FRAT1      KLKEHILNKVGYTNQN------------------------------------ESIYTARE
MNME_FRATW      KLKEHILNKVGYTNQN------------------------------------ESIYTARE
MNME_FRATN      KLKEHILNKVGYTNQN------------------------------------ESIYTARE
MNME_FRAP2      KLKDHILAKVGYTTQN------------------------------------ESIYTARE
MNME_RUTMC      LLRKELSDIAGLEDFS------------------------------------EGVVLSRK
MNME_VESOH      LLRKELSNISGLEDLS------------------------------------EGVVLARR
MNME_XANAC      QLHIRLRALALGDGVDS----------------------------------VDGEFSART
MNME_XANC5      QLHIRLRALALGDGVDS----------------------------------VEGEFSART
MNME_XANOM      QLHIRLRELALGDGVEG----------------------------------VDGEFSART
MNME_XANOR      QLHIRLRELALGDGVES----------------------------------VDGEFSART
MNME_XANCP      HLHTRLRELALGDGIES----------------------------------VDGEFSART
MNME_XANC8      HLHTRLRELALGDGIES----------------------------------VDGEFSART
MNME_XANCB      HLHTRLRELALGDGIES----------------------------------VDGEFSART
MNME_XYLFA      TLKTRLRTLLLGETVET----------------------------------IEGEFSARL
MNME_XYLFT      TLKTRLRTLLLGETVET----------------------------------IEGEFSARL
MNME_BLOFL      LLKKHLYDSAMLQIHKNSNF--------------------------SSVEENQGNFIARK
MNME_BLOPB      LLQEYLSNNIKSKIQQDCK---------------------------SNLSENQGNFIARR
MNME_BAUCH      ILLKYLTKII------------------------------------SLPSSTEGVFLARR
MNME_WIGBR      ILIKYLKDLN------------------------------------CLLLNEEGCILART
MNME_BUCCC      YLKNKILEIT------------------------------------TLHNNVESTFLAKK
MNME_BUCAI      ILREHIIKIEKN-------------------------------------INNESVFIARR
MNME_BUCMP      KLRKHIVKIAKN-------------------------------------ENKEGVFIARR
MNME_BUCAP      ILKKHLSNRQKD-------------------------------------KSQEGLFIARR
MNME_BUCBP      ALRQHLYFSFKSS---------------------------------FEVNNSEGVVSARR
MNME_CAUVC      ALRAALASHVADALS-----------------------------------GAEFPAATRL
MNME_CAUSK      PARAALSTHVIDALS-----------------------------------GAEFPAATRI
MNME_MARMM      ALEARIEQIVRDRLS-----------------------------------VREMPALSRV
MNME_RHORT      ALEAALESRARAFFE-----------------------------------GDGTPALTRQ
MNME_MAGSA      DLVAELARVVESRFA-----------------------------------MGSAPVLTRE
MNME_PARL1      ALEAALAARVGSAYE-----------------------------------AREHPVITRA
MNME_NITWN      DLVSALTAFAEKLLG-----------------------------------SSEAGVITRL
MNME_NITHX      ELVAALTAFSDGWFG-----------------------------------SGETAVITRL
MNME_BRASO      ALLDALVGFARNFFG-----------------------------------STESGLITRE
MNME_BRASB      DLLEALVGFARDYFG-----------------------------------ATEHGLITRE
MNME_BRADU      ELVDALVKFSAEFFG-----------------------------------TSEGALVTRA
MNME_RHOP5      DLVGALGGFAAEFFG-----------------------------------AGEAGAITRQ
MNME_RHOPS      ELIAAIEDFAAQYFA-----------------------------------SGETALISRA
MNME_RHOP2      DMVEALAGFAAQYFAA----------------------------------SGEAAVISRE
MNME_RHOPA      DLLRELTRFAAQYFG-----------------------------------SAEAGLITRD
MNME_RHOPB      ELIAALGKFAAAHLG------------------------------------GESALITRA
MNME_METPB      ALLDAIQGSAASALG-----------------------------------GGDA-LVTRE
MNME_METRJ      DLLDAIQAAAEDGLG-----------------------------------TGDA-LITRA
MNME_METS4      MLLDRVAAAAGAALG-----------------------------------RGDA-VVTRE
MNME_AZOC5      TLIAEMERRLGEMGG-----------------------------------GEPA-LVTRE
MNME_BEII9      RLVEAIADFAGKLAP-----------------------------------SGHAGLITRA
MNME_RHIEC      ELRQLIGRIVAERFT-----------------------------------GLSLAIPSRQ
MNME_RHIL3      ELRRLIGDIVERRFA-----------------------------------GLSMAIPSRQ
MNME_SINMW      KLLAMLQAHLPDLAG-----------------------------------NTALSMPSRR
MNME_RHIME      DLLTALQSHLPDLAG-----------------------------------RTALAMPSRK
MNME_AGRFC      ELRRALKREIEKRVG-----------------------------------SGQTLVPARA
MNME_BRUC2      QLLDALQAFAEAKIG-----------------------------------QIEDAVPTRQ
MNME_BRUSU      QLLDALQAFAEAKIG-----------------------------------QIEDAVPTRQ
MNME_BRUA2      QLLDALQAFAEAKIG-----------------------------------QIEDAVPTRQ
MNME_BRUAB      QLLDALQAFAEAKIG-----------------------------------QIEDAVPTRQ
MNME_BRUME      QLLDALQAFAEAKIG-----------------------------------QIEDAVPTRQ
MNME_BRUO2      QLLDALQAFAEAKIG-----------------------------------QIEDAVPTRQ
MNME_BRUSI      QLLDALQAFAEAKIG-----------------------------------QIEDAVPTRQ
MNME_OCHA4      QLLTNLQNFAEEQIG-----------------------------------QIEDAVPTRQ
MNME_BARHE      HFMKELESFCLRRVS-----------------------------------EIGNLFPARK
MNME_BART1      CFIKKLESFCHRRAS-----------------------------------EVGNLVPARK
MNME_BARQU      YFIKELESFCLRRVS-----------------------------------EIGNLFPARK
MNME_BARBK      YFLKEIESFCLHRIA-----------------------------------EIGNIFPARK
MNME_CHESB      RLMELISQASAGYSN-----------------------------------FAGEILPFRE
MNME_RHILO      ALLAEIGRRAADAAG-----------------------------------DVGDVLPSRL
MNME_HYPNA      KLESWIAAFVSRRAS-----------------------------------SVEAPVITRA
MNME_GRABC      RLKTMLEAEARALTS-----------------------------------HATGAPLTRA
MNME_ACICJ      DLLAALRARVEALVE-----------------------------------RGAGPALPRP
MNME_GLUOX      ALRQILSERVAELMA-----------------------------------GSAAPPLTRA
MNME_ERYLH      ALVRDLRDAARDLLP-----------------------------------RPGDVAVNA-
MNME_NOVAD      AFRSALIAHARSALP-----------------------------------APGEAALNQ-
MNME_SPHWW      DLVALLLDRAAGLLP-----------------------------------GEGEAALSA-
MNME_SPHAL      RLHTMIVEMARTLLP-----------------------------------REGEATLRQ-
MNME_ZYMMO      RLQEKLVEIGKKILP-----------------------------------KEDEVTLNR-
MNME_RUEST      DLVSRISDTLRNRTA-------------------------------------HDGIATRA
MNME_RUEPO      QLVQRISDVLKTRSS-------------------------------------SAGIATRE
MNME_ROSDO      ELLEKIRSVFSERVS-------------------------------------AVGLATHE
MNME_RHOS4      ELVAAIGERLLGRTA-------------------------------------GAGSLTRE
MNME_RHOS1      ELVAAIGERLLGRTA-------------------------------------GAGSLTRE
MNME_RHOS5      ELVEALQDRLLARTA-------------------------------------GAGSFTRE
MNME_DINSH      RLVKAVSHRLSLRAA-------------------------------------SAGTATHV
MNME_JANSC      RLLTDIEGVLSEKMS-------------------------------------AVRSAVTD
MNME_PARDP      ELLDLVYDRLRVRAA-------------------------------------DSGLVGHK
MNME_RICAH      SILKNI-ENIAENMAG----------------------------------FTETPYITNQ
MNME_RICFE      SILKNI-ENIAENMAG----------------------------------FTETPYITNQ
MNME_RICRO      SILKNI-ENIAENMAG----------------------------------FTETPYITNQ
MNME_RICRS      SILKNI-ENIAENMAG----------------------------------FTETPYITNQ
MNME_RICCN      SILKNI-ENIAENMAG----------------------------------FTETPYITNQ
MNME_RICM5      SILKNI-ENIAENMAG----------------------------------FTETPYITNQ
MNME_RICCK      DILKNI-ENIAENMAG----------------------------------FTETPYITNQ
MNME_RICPR      NILKNI-ENIAENLAG----------------------------------VTETPYITNQ
MNME_RICTY      SILKNI-ENIAENIAG----------------------------------FTETPYITNQ
MNME_RICB8      SILKNI-EEIAENMAG----------------------------------FTETPYITNE
MNME_RICBR      SILKNI-EEIAENMAG----------------------------------FTETPYITNE
MNME_ORITB      RLMSEI-VSYAEKIAD----------------------------------PGNVPAITRE
MNME_ANAMM      SLLSALKERAIDGFPK----------------------------------SGD-VLITSQ
MNME_ANAPZ      KLLTLIQEKSRDSFPQ----------------------------------EGD-VFITSQ
MNME_EHRCJ      ILLNLIKQRVEKDFQF----------------------------------CSTHPFITSE
MNME_EHRCR      NLLNLIKQKVEKDFQF----------------------------------CNTDPFITSE
MNME_EHRRW      HLLSAIQKKVEADFKF----------------------------------CSTSPFITSE
MNME_EHRRG      HLLSAIQKKVEADFKF----------------------------------CSTSPFITSD
MNME_WOLTR      KLVSVIKEKVEEKFVY----------------------------------DRDVPVITRQ
MNME_WOLPM      KLISLIKEKAEEKFGH----------------------------------DRDTPVITRQ
MNME_NEOSM      LLLDKIFDIIS---SS----------------------------------NIEAHIITRA
MNME_PELUB      DLISKIKNKLKNKFIT----------------------------------SED-ILITRA
MNME_DEIRA      ALREAIGAALLGD--A----------------------------------TRGEAWLTTE
MNME_DEIGD      ALRDAIHTALIGD--A----------------------------------AQGEAWLTTE
MNME_THET8      RLKEAVREALLG--------------------------------------REGGEVLLTE
MNME_THET2      RLKEALREALLG--------------------------------------REGGEVLLTE
MNME_HALHL      ALRRGLAALVDRE--A----------------------------------GEDAWA-ARH
MNME_MYXXD      ALRDDMLGRLWGG--G----------------------------------TPSAVALVSE
MNME_RHOBA      SLIERLVQFAEQRDAG----------------------------------ETGSVIGTAA
MNME_AQUAE      ELSEEILKKV-GANLEES----------------------------------VNIYISVR
MNME_MAGMM      SVVAHIVARM-EQLPEHG----------------------------------EGVVIMQL
MNME_KORVE      ELREQILRMVSGESGRE-----------------------------------ESGFLTNI
MNME_SOLUE      ELRSAILDAVAPKGVLEH----------------------------------ETGFITSL
MNME_CHLTR      ELKQAL----------------------------------QKWLNTTQLGKSSKIFLVSA
MNME_CHLTB      ELKQAL----------------------------------QKWLNTTQLGKSSKIFLVSA
MNME_CHLT2      ELKQAL----------------------------------QKWLNTTQLGKSSKIFLVSA
MNME_CHLTA      ELKQAL----------------------------------QKWLNTTQLGKSSKIFLVSA
MNME_CHLMU      ELRQAL----------------------------------NKWLHTTQLGKSSKVFLVSA
MNME_CHLCV      ELKQFI----------------------------------QKWMQQQQLGKNAKVFLVSS
MNME_CHLFF      ELKQFI----------------------------------QKWIQKQQLGKNSKVFLVSA
MNME_CHLAB      ELKQFI----------------------------------QQWMQKQQLGKNGKVFLISS
MNME_CHLPN      QVKQAL----------------------------------IQWMQKQEAGKTSKVFLVSS
MNME_PARUW      ELHQTI----------------------------------DTIIWQDGPPSKEEILITNV
MNME_OPITP      DLFGAI----------------------------------GRWADQWQITVGQDVIAVNA
MNME_BDEBA      FFTRRVFFVSALDKKVRSEVLK------------------DLVKEFADLQVENTVLISNA
MNME_DESHY      QLEKEI----------------------------------KQRVYQGKAEKTKEPLLSNI
MNME_ALKMQ      EVEEALVEIVYKG---------------------------------ETRAKDS-LLVTNV
MNME_ALKOO      EIEDALAEMVYKG---------------------------------GAKAKDS-LLVTNV
MNME_CLOD6      ELQDKIESMVYKG---------------------------------SIKNNSS-LVVTNS
MNME_FINM2      DLENKIIEMFNDG---------------------------------YIEANND-NIITNI
MNME_FUSNN      NLENEIYKYIMNE---------------------------------NIEDSSQKLVITNV
MNME_CLOB1      ELKECIKNLFFSG---------------------------------EIK--SDELIVTNA
MNME_CLOBK      ELKECIKNLFFSG---------------------------------EIK--SDELIVTNA
MNME_CLOBH      ELKECIKNLFFSG---------------------------------EIK--SDELIVTNA
MNME_CLOBL      ELKECIKNLFFSG---------------------------------EIK--SDELTVTNA
MNME_CLOBM      ELKECIKNLFFSG---------------------------------EIK--SDELIVTNA
MNME_CLOK5      KIKNCIKELFFKG---------------------------------EIK--SEDLFITNT
MNME_CLOTE      DLKEYIKDLFFKG---------------------------------DIQ--TDSIIITNT
MNME_CLONN      KFKEVIKELFFSG---------------------------------KVA--SKDVMITNT
MNME_CLOAB      KLKDTIENMFATG---------------------------------NLQ--HSNTMITNT
MNME_CLOPE      DLKSKIKDLFFNG---------------------------------SID--AESVMVTNT
MNME_CLOP1      DLKSKIKDLFFNG---------------------------------SID--AESVMVTNT
MNME_CLOPS      DLKSKIKDLFFNG---------------------------------SID--AESVMVTNT
MNME_CLOB8      ILKDEVKKLFFNG---------------------------------EIS--SESLIISNA
MNME_LACP7      DLEQTITEMFFEG---------------------------------NISF-NDEIYITNM
MNME_THEP3      ELENTIYNLVFRG---------------------------------DISL-REDEIVINS
MNME_THEPX      ELENTIYNLVFRG---------------------------------DISL-REDEIVINS
MNME_CALS4      KLESEIYNLVFKG---------------------------------KVSA-TEEEIITNA
MNME_HUNT2      ELENAITELFVQG---------------------------------EVSV-NEEILLTNI
MNME_CARHZ      ILENKLYEILIPE---------------------------------QEGE-GESALISNL
MNME_DESRM      KLEETIFNMVVEG---------------------------------KITT-TDSIFVSNS
MNME_PELTS      KLEEKIVEMVMGG---------------------------------QVYP-KDELIISNT
MNME_CALS8      LVEKAIKEAILEQ---------------------------------NIEG-FDEVLITNL
MNME_SYNWW      ELEESIEKAVLSG---------------------------------QLQS-DDMEVMINL
MNME_NATTJ      KLEEHISELVFGG---------------------------------QVMQ-TEELVITKA
MNME_DESPS      ALKQAIFTVVTGS---------------------------------DTPW-DEEGCAPNL
MNME_MOOTA      ELARKVQEIVLG---------------------------------GRALAGSDEPLITNA
MNME_DESAP      ELEETIAGLVLG---------------------------------GR-VTGHHTVLISNV
MNME_ROSS1      ELGATVARLLLG---------------------------------APIAADG--RLVTNA
MNME_ROSCS      MLGATVARLLLG---------------------------------DSSPADG--RLVTNV
MNME_CHLAA      TLAKTIATTLLG---------------------------------GTLPAVGATHLVSNP
MNME_SYMTH      ALEAEVAR--VA---------------------------------GAFDASE--ELLVNA
MNME_HELMI      ELTELIRRMVYGDD-----------------------------GLGYAPDGGRLALVTQA
MNME_GEOSL      ELKESIFQTFIHG--------------------------------AAID-SREYVAVSRV
MNME_GEOMG      DLREAVFETFIHG--------------------------------RAID-SREYVALSQT
MNME_GEOUR      ALQDAIFEAFIHN--------------------------------HAVD-SREYVAVSQA
MNME_PELPD      DLKSTVRSLFVSS--------------------------------QAID-NREYVAISRV
MNME_PELCD      GLVSAIQERFVHN--------------------------------AHVAENRETVVLTQR
MNME_SYNAS      VLKEKIYDLVLE----------------------------------KAGEQDGDVLINSL
MNME_SYNFM      RLRDFLNQRFLR----------------------------------LPLEQSGSAIVPNL
MNME_DESVH      SLVTAIRAAVLAA------------------------------TGA--GEPEAGELAPNM
MNME_DESVV      SLVTAIRAAVLAA------------------------------TGA--GEPEAGELAPNM
MNME_DESAG      SLAAAVREMVLRR------------------------------SNALTADAAASDMAPNL
MNME_LAWIP      ELLVLLYNFVLSQ------------------------------HNA--QEPTFDTIVPNM
MNME_NOSS1      SLETAILEIVQT----------------------------------GKVQAADMDLAINQ
MNME_TRIV2      ALETAILEIVQT----------------------------------GKVKAADMDLAINQ
MNME_TRIEI      ELEAAILNAVNL----------------------------------DNVQPENLDFAVNQ
MNME_ACAM1      ELETAILETVQT----------------------------------QSLKAANLDWAINQ
MNME_SYNY3      ALENAIIEQVNQ----------------------------------TNLSPQNLDFAINQ
MNME_MICAN      DLEKSLINAVQN----------------------------------QELQAANLDLAINQ
MNME_SYNP2      ELETAIANLVQA----------------------------------GKVGAADLDFAINQ
MNME_SYNE7      DLEAAILAAVGT----------------------------------GDLTSANWDWALNQ
MNME_SYNP6      DLEAAILAAVGT----------------------------------GDLTSANWDWALNQ
MNME_THEEB      QLEDAILHLVQG----------------------------------QGVSAANLDFAINQ
MNME_SYNJA      ELEEALEQLVTQ----------------------------------GRPQP-NLEVSLNQ
MNME_SYNJB      ELEEALEQLVTQ----------------------------------GRPQP-NLEISLNQ
MNME_GLOVI      ALEGAILAALGQ----------------------------------EAFSVADGDFAVNE
MNME_PROM1      DLINYLLKKCG-----------------------------------SSQT-HGLDIALNE
MNME_PROMT      DLINYLLKKCG-----------------------------------SSQT-HGLDIALNE
MNME_PROMA      ELIQELLKLAG-----------------------------------ANEL-EGIEVALNQ
MNME_PROM3      ALIEAVLKTCG-----------------------------------ASEA-QGLVVALNQ
MNME_PROMM      ALIKAVLKTCG-----------------------------------ASEA-QGLVVALNQ
MNME_SYNSC      DLVQALLERCG-----------------------------------AAGT-DGMLVALNQ
MNME_SYNPX      DLVQALLERCG-----------------------------------AAGT-EGVLLALNE
MNME_SYNS9      AFVQVLLERCG-----------------------------------AGDA-AGIVLSLNT
MNME_SYNPW      ELVQAVLERCG-----------------------------------ALAD-GSLLLSLNQ
MNME_SYNS3      ALVQAVLERCG-----------------------------------ALGE-QPLLLALNQ
MNME_SYNR3      ELSSALLKLCG-----------------------------------LSGEGQGLLLALNQ
MNME_PROMS      LLIDTIIKKCG-----------------------------------LKQV-ENINIFLND
MNME_PROM0      LLIDTIIKKCG-----------------------------------LKQV-ENINIFLNE
MNME_PROM2      LLIDTIIKKCG-----------------------------------LKQV-ENINIFLNE
MNME_PROM9      LLIDTIIKKCG-----------------------------------LKQV-ENINIFLNE
MNME_PROM5      DLVDKIVKKCG-----------------------------------SKEF-ENIDIFLNE
MNME_PROMP      ELVEKIVKKCG-----------------------------------SKEF-ENIDIFLNE
MNME_CYACA      KLNNCILDLSSKE------------------------------DFDLPVHFSVNCKYLEI
MNME_CYAM1      QLKQLIWQQATQ-------------------------------------LFQLDGIYINE
MNME_BACFR      ELQQRLVA----------------------------------AAH-LPTVTQNDVIVTNI
MNME_BACFN      ELQQRLVA----------------------------------AAH-LPTVTQNDVIVTNV
MNME_BACTN      ELQKMLIN----------------------------------AAH-LPTVTQNDIIVTNV
MNME_BACV8      ILEKKLVQ----------------------------------AAA-LPEVNQNDIIITNV
MNME_PARD8      ELQQLLTE----------------------------------VSS-IPTLHQSDIIVTNV
MNME_PORGI      ELKGELTQ----------------------------------IME-TSGANEADLIVSNA
MNME_FLAJ1      ELKNELLS----------------------------------FVN-TGALRNNETIVTNT
MNME_FLAPJ      DLKNQLLS----------------------------------FVN-TGALRNNQTIVTNT
MNME_GRAFK      ELKEKLLE----------------------------------YVN-TGALRNSDTIVTNS
MNME_CYTH3      ELKQNLLE----------------------------------IIQ-YESFKQNDTLVTNM
MNME_SALRD      LLDHLTDT----------------------------------VAE-HLSRAEASPVVMNQ
MNME_CHLTE      TLKQHMGD----------------------------------LVKNLDKLHEASVLVTSL
MNME_CHLPD      ELKSRMSS----------------------------------MVEGLDKLHEASVLVTSL
MNME_CHLPM      ELKSTMAG----------------------------------MVEGLDKLHEASVLVTSL
MNME_PELLD      ELKLLMAS----------------------------------MVEGLDKLHEASVLVTSL
MNME_CHLCH      ALKQQMSN----------------------------------MVAGLDKLHEASVLITSM
MNME_BORAP      ILYDKIRT---------------------------------LISYERVEIGLDDIIISSS
MNME_BORBU      ILYDKIRA---------------------------------LISYERVEIGLDDIIISSN
MNME_BORBP      ILYDKIKT---------------------------------LISYERVEIGLDDIIISSS
MNME_TREPA      GAGEQCLAGGKNGEVRDRAPRAFVCVSAKTHAGLDALRAQTLHLLHGGQVPYEELSLGSE
MNME_TREDE      ALSEKAYS--------------------------------VLAKNTGSSGFSKTASLGSE
MNME_LEPBJ      ILLDEIQKKAATMGH------------------------------------VEDYVLLEE
MNME_LEPBL      ILLDEIQKKAATMGH------------------------------------VEDYVLLEE
MNME_LEPIN      NLLDAIKERTGKLGH------------------------------------SEDYVLLEE
MNME_LEPIC      NLLDAIKERTGKLGH------------------------------------SEDYVLLEE
MNME_LEPBA      ELLELLKSKLTSKDD------------------------------------TEDLVLLED
MNME_LEPBP      ELLELLKSKLTSKDD------------------------------------TEDLVLLED
MNME_UNCTG      DLLDEIVKIAGVSESK------------------------------------NDYLMINT
MNME_SULMW      NLLSEITFFSKKITSLKEN---------------------------------TIVITQTR
MNME_CARRP      TFIKNLKCFINKIVDNKD---------------------------------------FSK
                                                                            

MNME_THEMA      RQKQLLENVKGHLEDAIKSLKEGMP-----VDMASIDLERALNLLDEVTGRS----FRED
MNME_THESQ      RQKQLLENVKGYLEDAIKSLKEGMP-----VDMASIDLERALNLLDEVTGRS----FRED
MNME_THEP1      RQKQLLENVKGHLEDAIKSLKEGMP-----VDMASIDLERALSLLDEVTGRS----FRED
MNME_FERNB      RQLEYLKRVEYNIIKAINSLKKNMP-----LDIISIDIRNGLEQLDELMGRN----FTED
MNME_THEM4      RQVEILERVYTHLESAVNNLNMGYE-----IDLISIDLRRALEELDMLIGRK----FSDD
MNME_PSELT      RQYEYLASCRKELSDSIEAFKKKLP-----LDIVAQKVKEALGSIDKLLGTD----YTDD
MNME_PETMO      RQKITLESSKEFVLNAINSLEKGFS-----NDIIMYDVRKALEKIYELSGEN----YTEE
MNME_AYWBP      RHINQIQIALRSFQDLQQALLQSMP-----IDIYSIDLTKAYQALGQIIGEN----QENS
MNME_ONYPE      RHINQIQIALRSFQDLQQALLQSMP-----IDIYSIDLTKAYQALGQIIGDN----QENS
MNME_ACHLI      RHIQKLKEAKTSLESVINAIHHDMP-----VDIYAVDLTTAWNRLGEILGNH----QYGD
MNME_BACAN      RHIGLLTQAGKTIGDAIEAIENGVP-----IDMVQIDLTRTWEILGEITGDT----VHES
MNME_BACHK      RHIGLLTQAGKTIGDAIEAIENGVP-----IDMVQIDLTRTWEILGEITGDT----VHES
MNME_BACCZ      RHIGLLTQAGKTIGDAIEAIENGVP-----IDMVQIDLTRTWEILGEITGDT----VHES
MNME_BACAH      RHIGLLTQAGKTIGDAIEAIENGVP-----IDMVQIDLTRTWEILGEITGDT----VHES
MNME_BACC1      RHIGLLTQAGKTIGDAIEAIENGVP-----IDMVQIDLTRTWEILGEITGDT----VHES
MNME_BACCR      RHIGLLTQAGKTIGDAVEAIENGVP-----IDMVQIDLTRTWEILGEITGDT----VHES
MNME_BACMK      RHIGLLTQAGRTINDAIEAIENGVP-----IDMVQIDLTRAWEILGEITGDT----VHES
MNME_BACCN      RHIGLLTQARKTIGDAIAAIENGVP-----IDMVQIDLTRTWEILGEITGDT----VHES
MNME_BACSU      RHITILQQAKRAIEDALSGIEQDVP-----IDMVQIDLTRCWELLGEIIGDS----VHES
MNME_BACVZ      RHISILHQAKQAIDDALNGIEQDVP-----IDMVQIDLTRCWELLGEIIGDA----VHES
MNME_BACP2      RHIALLQAAKQSIEDALEGIEMDVP-----IDIVQIDLTRCWEQLGEIIGDA----VHES
MNME_BACLD      RHISLLHEAKRAITDALEGIENDVP-----IDMVQIDLTRCWEVLGEIIGDA----VHES
MNME_GEOKA      RHIALLEQAKTAIEDALAGIDAGMP-----VDLVQIDLRRAWELLGEIIGDT----VHES
MNME_GEOTN      RHIALLEQAKKAIEDALSGIDVGMP-----VDLVQIDLRRAWELLGEIVGDT----VHES
MNME_LYSSC      RHIALLHQAQATVEDAIAAAQAGVP-----VDMVQIDVTRTWELLGEIIGDT----VQES
MNME_OCEIH      RHIQLLKQAKQALEDAMEGIELGMP-----MDIVQIDVTRSWEFMGEIIGDT----ASDS
MNME_BACSK      RHIGLLNQAKAHAEEAIAASLTDVP-----VDLIQIDVTRTWELLGEIIGED----VQDS
MNME_BACHD      RHIALLEQAKRAVEDALEAIEMDVP-----IDMVQIDITRAWELLGEIIGDS----VHES
MNME_EXIS2      RHIQLIKQASQMIEDALGAAEASMP-----IDMVQIDLRRAWDTLGEINGDT----AQDS
MNME_STAAC      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAAE      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAAT      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAA3      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAA2      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAA9      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAAR      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAAW      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAAN      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAA8      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAA1      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAAM      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAAS      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRIWEILGEIIGET----ASDE
MNME_STAAB      RHISLLKQARQTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGET----ASDE
MNME_STAES      RHISLLKQARQSIQDAIDAAESGIP-----MDMVQIDLTRTWEILGEIIGES----ASDE
MNME_STAEQ      RHISLLKQARQSIQDAIDAAESGIP-----MDMVQIDLTRTWEILGEIIGES----ASDE
MNME_STAHJ      RHISLLKQARNAIQDAIDAAESGIP-----MDMVQIDLTRTWELLGEIIGES----ASDE
MNME_STAS1      RHISLLKQARNTIQDAIDAAESGVP-----MDMVQIDLTRTWEILGEIIGES----ASDE
MNME_LISMO      RHIALLHQALEALNGVTTGIQLGMP-----VDIVQIDMTRAWDLLGEITGDS----VQDE
MNME_LISMF      RHIALLHQALEALNGVTTGIQLGMP-----VDIVQIDMTRAWDLLGEITGDS----VQDE
MNME_LISIN      RHIALLHQALEALNGVTTGIQLGMP-----VDIVQIDMTRAWDLLGEITGDS----VQDE
MNME_LISW6      RHIALLHQALEALNAVTTGIQLGMP-----VDIVQIDMTRAWDLLGEITGDS----VQDE
MNME_ENTFA      RHIALLDQAALSLQEVINGIEAGMP-----VDLVQIDMTRCWDYLGEIVGDS----VQDE
MNME_LACP3      RQIGLLRQANKSLDAVIAGIHAGMP-----IDLVQIDMTAAWDKLGEITGES----APDE
MNME_LACSS      RQIGLLNQAQQSLDEVISGIAAGMP-----VDLVQIDMTNCWDKLGEITGDS----APDE
MNME_LACS1      RHIALLNQAEDSLDAVLQGLDSGMP-----VDLCQIDMTNAWDELGEITGDS----YQDE
MNME_LACPL      RHIGLLNQAKQALQDVQTGLAAGMP-----VDLVQIDMTRCWEFLGQITGDS----YEDE
MNME_LACBA      RHIGLLHQASAALDDVQNGIAAGMP-----VDLVQIDMTRAWDLLGEITGDS----YQDE
MNME_PEDPA      RHIGLLKQADTALDAVLEGIETGMP-----VDLVQIDMTRTWDLLGEITGDS----YQDE
MNME_LACLM      RHISLVEEALKALKEANNGLALGLP-----VDLIQVDVTRCWQLLGEITGEA----APDE
MNME_LACLS      RHISLVEEALKALKEANNGLALGLP-----VDLIQVDVTRCWQLLGEITGEA----APDE
MNME_LACLA      RHISIVEEALKALKEANSGLALGLP-----VDLIQVDVTRCWQLLGEITGEA----APDE
MNME_STRA1      RHISLIEKAVDSLKAVNEGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRA5      RHISLIEKAVDSLKAVNEGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRA3      RHISLIEKAVDSLKAVNEGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRAG      RHISLIEKAVDSLKAVNEGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRTD      RHISLIEKALESLEAVNQGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRT1      RHISLIEKALESLEAVNQGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRT2      RHISLIEKALESLEAVNQGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRMU      RHISLIEKALKSLQAVNDGLELGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRP8      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRPD      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRP6      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRP3      RHISLIEKTVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRPG      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRP1      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRPC      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRPM      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRPF      RHISLIEKAVQSLEAVNDGLALGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRGC      RHISLIEKALESLQAVNQGLEMGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRSV      RHISLIEKALESLQAVNQGLEMGMP-----VDLLQVDMTRTWEILGEITGDA----APDE
MNME_STRR6      RHISLIEKAVESLQAVNQGLELGMP-----VDLLQVDLTRTWEILGEITGDA----TPDE
MNME_STRP2      RHISLIEKAVESLQAVNQGLELGMP-----VDLLQVDLTRTWEILGEITGDA----TPDE
MNME_STRPI      RHISLIEKAVESLQAVNQGLELGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRPN      RHISLIEKAVESLQAVNQGLELGMP-----VDLLQVDLTRTWEILGEITGDA----APDE
MNME_STRSY      RHISLIEQAVQSLHAVNDGLKVGMP-----VDLLQVDLTRCWQILGEITGDA----APDE
MNME_STRS2      RHISLIEQAVQSLHAVNDGLKVGMP-----VDLLQVDLTRCWQILGEITGDA----APDE
MNME_LACGA      RQAGLLTKAKQSLEDVISGIDDAMP-----LDLVQIDLKNAWDTLGEITGES----APDE
MNME_LACJO      RQAGLLAKAKQSLEDVVNGIDDAMP-----LDLVQIDLKNAWDTLGEITGES----APDE
MNME_LACAC      RQTSLLHKAKSELEDVIQAVDDGIP-----VDIAQIDFTGAWDTLGEITGES----APDE
MNME_LACH4      RQTSLLTKAKKELQDVVQAVEDGIP-----IDIAQIDFTGAWDTLGEITGES----APDE
MNME_LACDB      RQAGLLAKAKQQLADVASGLEAGMP-----VDLVQIDFTGAWESLGEITGDS----APDE
MNME_LACDA      RQAGLLAKAKQQLADVASGLEAGMP-----VDLVQIDFTGAWESLGEITGDS----APDE
MNME_MYCGE      WQQILIEKIKEQLEQFLKQQKKYLF-----FDVLVTHLREAQQDILKLLGKD----VGFD
MNME_MYCPN      WQTILLQKAIAELEHFLIKQQNCLF-----FDILVVHLRAAHEYILQVLGKN----TNYD
MNME_MYCGA      WQINLLQTALYNINLILNDPN--QY-----HDLVIQHLNEANNSLLKVLSEY----EDYN
MNME_UREPA      RQIGILENVHYLINNAILNLEKGDT-----LDLIVADLEFCNLRLNELLGIS----SEYD
MNME_UREP2      RQIGILENVHYLINNAILNLEKGDT-----LDLIVADLEFCNLRLNELLGIS----SEYD
MNME_MYCPE      NELKIIKQVLLVLKKSYANSLSGFP-----LDLLVEDLKVAYEKICTIMGLS----EDLN
MNME_MYCMS      NQITLVEQIKNKLSTALSIIKSGMP-----IDIVNVDLYDAWNLLNELIGVE----YEDE
MNME_MYCCT      NQITLVEQIKNKLSTALSVIKSGMP-----IDIVNVDLYDAWNLLNELIGVE----YEDE
MNME_MESFL      QQITLVEQVKDRLEKSLNAIIGGMP-----IDIVNVDLHEAWDYLNQLIGEQ----YDEE
MNME_MYCPU      RQLALIKSSLFSIQEAIKGLEQGYT-----PDVVIVDITKAWEDLVNIVGRA----DNEK
MNME_MYCMO      NQLSMIKKSYLALSEAKEGLESGLT-----PDVVIIDITKAWESLVNIKGKA----DNEL
MNME_MYCAP      RQLALIKQAHKSLEDAIKSIKLGYD-----PDVVIIDLRQAWSHLTDITGRA----DNEL
MNME_MYCS5      RQIKLFKESLEYAYAAREEIKNQLT-----YITAIVDLNNLFDTLQLIIGNS----NRED
MNME_MYCHJ      FQISQIELGKLAILDAKTSLESGFG-----PEIAIVDLRIAWKELKTIFGRV----DDEN
MNME_MYCH2      FQISQIELGKLAILDAKTSLESGFG-----PEIAIVDLRIAWKELKTIFGRV----DDEN
MNME_MYCH7      FQISQIELGKLAILDAKTSLESGFG-----PEIAIVDLRIAWKELKTIFGRV----DDEN
MNME_CAMJE      DLINACKISSEAIFRAKGLLEE-SS-----LEFFAFELNLAINELARFTKDF----QRDE
MNME_CAMJJ      DLINACKISSEAIFRAKGLLEE-SS-----LELFAFELNLAINELARFTKDF----QRDE
MNME_CAMJR      DLINACKISSEAIFRAKGLLEE-SS-----LELFAFELNLAINELARFTKDF----QRDE
MNME_CAMJ8      DLINACKISSEAIFRAKGLLEE-SS-----LELFAFELNLAINELARFTKDF----QRDE
MNME_CAMJD      DLINACKISSEAIFRAKELLEE-SS-----LELFAFELNLAINELARFTKDF----QRDE
MNME_CAMC5      HQIKQCKDASVAIKRALNLLGD-E------LELFAYEINTAIAAISAITRSF----ERSE
MNME_CAMC1      RQILSCKEASEALKRAFLRLNE-EE-----LEIFAYELNSAIKALASITKPF----ERSE
MNME_CAMHC      RQIMAFSNAGKALKRAQNLLNE-NS-----LELFAFELNIAIKEIASIYKPF----ERDE
MNME_CAMFF      RQIEASRLASEAIKNALELLNE-SE-----LELFAYELNIALKHIGSITKPM----ENSE
MNME_SULDN      RQIGAVQNTLNYIDEAFEPLQE-QE-----LEIFSFNLNEAIKEIASITRPF----ENDE
MNME_ARCB4      RQVLAVENTLYNIGLAKEPLKS-GE-----LEFFAHFITQALEDISSITRPY----DNDE
MNME_NITSB      RQIEAVTYALENINQARTPLQM-GE-----LEIFAFHINRVIESIGSITRPM----QSSE
MNME_SULNB      RQIEAVNRAKNAIAEAKEPLMN-GE-----LEFFSYHLQEAVKAISSISKPY----DSEE
MNME_HELHP      YQLDCIKKALECIVKAHNVLDI-GQ-----LELFSYQIQDCIESICKITHPY----ENAE
MNME_WOLSU      RQLLCVKSALGELKEARDRLIE-GE-----LELFAYHIQGALKELSLITRPY----ETSE
MNME_HELPY      AQKIALENAITELQNAKNHL---ET-----LELFSYHILSAIENLNLLTRPY----ETSQ
MNME_HELPJ      AQTTALENAITELQNAKSHL---DT-----LELFSYHILSAIENLNLLTRPY----ETSQ
MNME_HELPH      AQKTALENAITELQNAKNHL---ET-----LELFSYHLLSAIENLNSLTRPY----ETSQ
MNME_HELAH      AQKNALENAITELQNAKNHL---ET-----LELFSYHILSAIENLNLLTRPY----ETSQ
MNME_ECOLI      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECOLC      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_SHIBS      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECODH      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_SHIFL      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_SHIF8      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_SHIDS      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECO57      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECOUT      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECOL5      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECOK1      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECOL6      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECOSM      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECO24      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_ECOHS      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_SHISS      RHLQALEQAAEHLQQGKAQLLGAW-----AGELLAEELRLAQQNLSEITGEF---T-SDD
MNME_SALCH      RHLQALAEAAEHLEQGKAQLLGAW-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_SALPB      RHLQALAEAAEHLEQGKAQLLGAW-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_SALTY      RHLQALAEAAEHLEQGKAQLLGAW-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_SALPA      RHLQALAEAANHLEQGKAQLLGAW-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_SALTI      RHLQALAEAANHLEQGKAQLLGAW-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_SALAR      RHLQALAEAAEHLEQGKAQLLGAW-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_CITK8      RHLQALAEAAEHLQQGKSQLLGAW-----AGELLAEELRLAQQALSEITGEF---T-SDD
MNME_ENT38      RHLQALEAAANHLDQGKAQLLGAW-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_KLEP7      RHLQALEEAANHLQQGKAQLLGAW-----AGELLAEELRLAQQALSEITGEF---T-SDD
MNME_CROS8      RHLQALEDAANHLQQGKAQLLGAW-----AGELLAEELRLAQQALSEITGEF---T-SDD
MNME_YERPA      RHLQALETAARHLIQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_YERPN      RHLQALETAARHLIQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_YERPP      RHLQALETAARHLIQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_YERPE      PHLQALETAARHLIQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_YERPS      RHLQALETAARHLVQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_YERP3      RHLQALETAARHLIQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_YERPY      RHLQALETAARHLIQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_YERE8      RHLQALETAAQHLAQGHEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_SERP5      RHLQALEQAAQHLVEGKEQLVSAY-----AGELLAEELRLAQQALSEITGEF---T-SDD
MNME_PECAS      RHLQALELAAQHLIQGKEQLVSAY-----AGELLAEELRLAQQSLSEITGEF---T-SDD
MNME_PHOLL      RHLQALNTAAEHLQQGHEQLVVAR-----SGELLAEELRLAQQALSEITGEF---T-SDD
MNME_SODGM      RHLDALETAATHLQQGKEQLVSAC-----YGELLAEELRLAQQSLSEITGEF---S-SDD
MNME_ACTP2      RHLQALETAAEHLERGHIQLTQFF-----AGELLAEELRMVQNALSEITGQF---T-SDD
MNME_ACTPJ      RHLQALETAAEHLERGHIQLTQFF-----AGELLAEELRMVQNALSEITGQF---T-SDD
MNME_HAEDU      RHLQALETAAKHLTQGHIQLTQFF-----AGELLAEELRLVQNTLSEITGQF---T-SDD
MNME_HAEI8      RHLDALEKAAEHLQIGLVQLTEFH-----AGELLAEELRLVQSYLSEITGQF---T-SDD
MNME_HAEIE      RHLDALEKAAEHLQIGLVQLTEFH-----AGELLAEELRLVQSYLSEITGQF---T-SDD
MNME_HAEIN      RHLDALDKAAEHLQIGLVQLTEFH-----AGELLAEELRLVQSYLSEITGQF---T-SDD
MNME_HAEIG      RHLDALDKAAEHLQIGLVQLTEFH-----AGELLAEELRLVQSYLSEITGQF---T-SDD
MNME_MANSM      RHLEALEHAAEHLQIGRVQLTQFH-----AGELLAEELRIVQDYLGEITGKF---T-SDD
MNME_ACTSZ      RHLDALEKAAYHLRQGHIQLTEFR-----AGELLAEELRMVQSHLSEITGQF---T-SDD
MNME_PASMU      RHLEALEQAATHLQQGHVQLTQFY-----AGELLAEELRRVQNHLSEITGQF---T-SDD
MNME_HAES1      RHLEALEQADIHLQAGLIQLTEFY-----AGELVAEELRIAQHHLSEITGQF---T-SDD
MNME_HISS2      RHLEALEQADIHLQAGLIQLTEFY-----AGELVAEELRIVQHHLSEITGQF---T-SDD
MNME_AERHH      RHLDALERAAERLLVAKEQLEVFV-----AGELVAEELRLAQESLSEITGEF---S-SDD
MNME_AERS4      RHLDALERAAERLLVAKDQLEIYV-----AGELVAEELRLAQESLSEITGEF---S-SDD
MNME_SHEB8      RHLEALELAAGHLQLGKEQLEVYL-----AGELLAEELRMCQLALSEITGRF---T-SDD
MNME_SHEB9      RHLEALELAAGHLQLGKEQLEVYL-----AGELLAEELRMCQLALSEITGRF---T-SDD
MNME_SHEB5      RHLEALELAAGHLQLGKEQLEVYL-----AGELLAEELRMCQLALSEITGRF---T-SDD
MNME_SHEPC      RHLEALDVAASHLQLGKEQLEVYL-----AGELLAEELRMAQLALSEITGRF---T-SDD
MNME_SHESW      RHLEALDVAASHLQLGKEQLEVYL-----AGELLAEELRMAQIALSEITGRF---T-SDD
MNME_SHESA      RHLEALDVAASHLQLGKEQLEIYL-----AGELLAEELRMAQLALSEITGRF---T-SDD
MNME_SHESM      RHLEALDVAASHLQLGKEQLEIYL-----AGELLAEELRMAQLALSEITGRF---T-SDD
MNME_SHESR      RHLEALDIAASHLQLGKEQLEIYL-----AGELLAEELRMAQLALSEITGRF---T-SDD
MNME_SHEON      RHLEALEIAASHLQLGKEQLEVYL-----AGELLAEELRMAQLALSEITGRF---T-SDD
MNME_SHEFN      RHLEALELAANHLQLGKEQLEVYL-----AGELLAEELRMTQMALSEITGKF---T-SDD
MNME_SHEDO      RHLEALELAASHLQLGKEQLEVYL-----AGELLAEELRMAQMALSEITGKF---T-SDD
MNME_SHEHH      RHLEALDLASSHLLLGKEQLEVYQ-----AGELLAEELRMCQMALSEITGKF---T-SDD
MNME_SHEPA      RHLEALDLASSHLMLGKEQLEVYQ-----AGELLAEELRMCQMALSEITGKF---T-SDD
MNME_SHESH      RHLEALELATSHLMIGKEQLEVYQ-----AGELLAEELRMTQMALSEITGKF---T-SDD
MNME_SHEWM      RHLEALDLASSHLMIGKEQLEVYL-----AGELLAEELRMTQMALSEITGKF---T-SDD
MNME_SHELP      RHLEALELASSHLALGQEQLEVYQ-----AGELLAEELRMCQLALSEITGKF---T-SDD
MNME_SHEAM      RHLEALEQASEHLQLGKVQLEVYL-----AGELLAEELRMAQQALSEITGEF---T-SDD
MNME_VIBCH      RHLDALERAAEHLAIGQQQLEGYM-----AGEILAEELRIAQQHLNEITGEF---S-SDD
MNME_VIBC3      RHLDALERAAEHLAIGQQQLEGYM-----AGEILAEELRIAQQHLNEITGEF---S-SDD
MNME_VIBCB      RHLDALERAAQHLQIGQEQLEGYM-----AGEILAEELRITQQHLNEITGEF---S-SDD
MNME_VIBPA      RHLDALERAAQHLQIGQEQLEGYM-----AGEILAEELRITQQHLNEITGEF---S-SDD
MNME_VIBVU      RHLDALQRAAEHLLIGQEQLEGYM-----AGEILAEELRIAQQHLNEITGEF---S-SDD
MNME_VIBVY      RHLDALQRAAEHLLIGQEQLEGYM-----AGEILAEELRIAQQHLNEITGEF---S-SDD
MNME_ALIF1      RHLEALEKAAQHLDIGQQQLEGYM-----AGEILAEELRIAQQHLSEITGEF---T-SDD
MNME_PHOPR      RHLEALEQAAQHLEIGKEQLEGFM-----AGEILAEELRLAQQHLSEITGEF---T-SDD
MNME_PSYIN      RHLEAIDNAQRHLLEGKVQLEEYK-----AGELLAEELRLTQQYLSEITGAF---S-SDD
MNME_PSEA6      RHIDAIERAEEHLLLGKQQLEDNL-----AGELLAEELRLAQAYLSEITGEF---S-SDD
MNME_PSEHT      RHLDALEHAAYHLDTGKAQLEMHI-----AGEILAEELRLTQQYLNEITGEF---T-SDD
MNME_IDILO      RHLEALAKAKVHLLQGLEQLEANM-----AGEILAEELRLTQQHLNEITGEF---T-SDD
MNME_COLP3      RHLVALENTHQHLLTGLDQLESYV-----AGEILAEELRICQQELDQITGEF---T-SDD
MNME_CHRSD      RHLDALDRAGDALDNGIAQLRGHG-----AGELLAEDLRDAQQALSEITGEF---T-ADD
MNME_MARMS      RHIEALNKANRFLDAGNEQLHGYG-----AGELLAEDLKEAQQALSEITGAF---T-SDD
MNME_MARHV      RHLDALERARDSLLQGQTQLEGYG-----AGELLAEDLRAAQDALGEITGHL---T-PDE
MNME_HAHCH      RHLEALTVAEKHIQLAKQQLLSAN-----AGELVAEDLRVAQNALSEITGAF---T-SDD
MNME_PSEAE      RHLEALRLAGQALEHGHSQLIHNG-----AGELLAEDLRQAQQHLGEITGAF---T-PDD
MNME_PSEAB      RHLEALRQAGQALEHGHSQLIHNG-----AGELLAEDLRQAQQHLGEITGAF---T-PDD
MNME_PSEA7      RHLEALRLAGNALEHGHAQLIHNG-----AGELLAEDLRQAQQHLGEITGAF---T-PDD
MNME_PSEPU      RHLDALRQASEHLEHGRAQLTLAG-----AGELLAEDLRQAQHALGEITGAF---S-SDD
MNME_PSEP1      RHLDALRQASEHLEHGRAQLTLAG-----AGELLAEDLRQAQHALGEITGAF---S-SDD
MNME_PSEPK      RHLDALRQASEHLEHGRAQLTLAG-----AGELLAEDLRQAQHALGEITGAF---S-SDD
MNME_PSEPG      RHLDALRQASEHLEHGRAQLTLAG-----AGELLAEDLRQAQHALGEITGAF---S-SDD
MNME_PSEPW      RHLDALRQACAHLEHGRAQLTLAG-----AGELLAEDLRQAQHALGEITGAF---S-SDD
MNME_PSEE4      RHLEALRQASAHLEHGRAQLTLAG-----AGELLAEDLRQAQQALGEITGAF---S-SDD
MNME_PSEF5      RHLEALHYASAALEHGRAQLTLAG-----AGELLAEDLRQAQQSLGEITGAF---S-SDD
MNME_PSEPF      RHLEALRHASDALEHGRAQLTLAG-----AGELLAEDLRQAQQSLGEITGAF---S-SDD
MNME_PSE14      RHLEALRHASDSLEHGRAQLTLAG-----AGELLAEDLRQAQQALGEITGAF---S-SDD
MNME_PSEU2      RHLEALRHASDSLEHGRAQLTLAG-----AGELLAEDLRQAQQALGEITGAF---S-SDD
MNME_PSESM      RHLEALRHASDSLEHGRAQLTLAG-----AGELLAEDLRQAQQALGEITGAF---S-SDD
MNME_PSEMY      RHLEALHQAEQYLEHGRNQLTLMG-----AGELLAEDLRMAQQALGEITGAF---S-SDD
MNME_PSEU5      RHLDALRLADEHLRHGHDQLTLAG-----AGELLAEDLRLAQQALGEITGAF---S-SDD
MNME_SACD2      RHIHAIEQAQNYLLTGREQLQLHT-----AGELLAEDLRAAQNHLSEITGAF---T-PDD
MNME_HYDCU      RHLEALETALHFVETGQQQLEHFA-----AGELLAEDLRQAQQALSEITGQF---T-SDD
MNME_LEGPC      RHLQALDEAKALLLTGQSQLTNHK-----AGELLAEDLRLAHQTLCEITGEF---T-SDD
MNME_LEGPH      RHLQALDEAKALLLTGQSQLTNHK-----AGELLAEDLRLAHQTLCEITGEF---T-SDD
MNME_LEGPA      RHLQALDEAKALLLTGQSQLTNHK-----AGELLAEDLRLAHQTLCEITGEF---T-SDD
MNME_LEGPL      RHLQALDEAKALLLTGQSQLTNHK-----AGELLAEDLRLAHQTLCEITGEF---T-SDD
MNME_ALCBS      RHITALEKALMALESGEQQLHGQA-----AGELLAEDLRAAQKALEEITGVF---T-ADD
MNME_METCA      RHLDAIRRARAAVANARLYLHTK------TAELLAEELRAAQKALGEITGEF---T-NED
MNME_NITOC      RHLEALQRAGAAVVVARKILGDKG-----AEEILAEELRQAQNALAEITGEY---R-SDD
MNME_ALKEH      RHLDALARAADHLALARRALVEEM-----AGEIAAEELRLVQHNLGEITGEF---T-SED
MNME_COXBU      RHCDAIARASAFLKNANNHLLNQK-----AGELVAEDLKLAQNALSEITGEF---T-SDD
MNME_COXBN      RHCDAIARASAFLKNANNHLLNQK-----AGELVAEDLKLAQNALSEITGEF---T-SDD
MNME_COXBR      RHCDAIARASAFLKNANNHLLNQK-----AGELVAEDLKLAQNALSEITGEF---T-SDD
MNME_PSYCK      RHLDALRRTAEYLAEAHEQLTVFK-----AGELVAESLRQAQHSLGEITGEF---S-ADD
MNME_PSYA2      RHLDALRRTAEYLAEAHEQLTVFK-----AGELVAESLRQAQHSLGEITGEF---S-ADD
MNME_PSYWF      RHLDALRRTQQHVDEAHQQLVIYQ-----AGELVAESLRQGQYSLGEITGEF---S-ADD
MNME_ACIBY      RHLDAMKRTQLYLAEAREQLVIFN-----AGELVAESLRLAQNALGEITGDF---S-ADD
MNME_ACIBT      RHLDAMKRTQLYLAEAREQLVVFN-----AGELVAESLRLAQNALGEITGDF---S-ADD
MNME_ACIAD      RHLDAMKRTQLHLHEAREQLVVFH-----AGELVAESLRLAQNALSEITGEF---S-ADD
MNME_DICNV      RHIHALESVEAHLQRALQQLEQFF-----VAELVAEELRLAHLALGTITGTV---S-SDD
MNME_BORBR      RHLHALQQAAQHLEIATEHAREDDR----VLDLFAEELRLAHEALTGITGKF---T-SDD
MNME_BORPA      RHLHALQQAAQHLEIATEHAREDDR----VLDLFAEELRLAHEALTGITGKF---T-SDD
MNME_BORPE      RHLHALQQAAQHLEIATEHAREDDR----VLDLFAEELRLAHEALTGITGKF---T-SDD
MNME_BORPD      RHVHALQRAAEHLEAATEHAAQDDR----VLDLFAEELRLAHDSLSSITGKF---T-SDD
MNME_BORA1      RHLHALQAARDHLDIAAEHASHDDR----VLDLFAEELRLSHESLSSITGKF---T-SDD
MNME_CUPPJ      RHLTALRQAQSHLDVAAEQSERQAQ----ALDLFAEELRLAQEHLNSITGEF---T-SDD
MNME_CUPNH      RHLTALRNAQSHLDIAAEQAEHQAQ----ALDLFAEELRLAQDCLNSITGEF---T-SDD
MNME_CUPMC      RHLIALRNAESHLELAEASASQHAQ----ALDLFAEELRLAQDHLNSITGEF---T-SDD
MNME_RALSO      RHLSALRSAREHLTIAADHADQRAQ----SLDLFAEELRLAQEALNSITGAF---S-SDD
MNME_BURM7      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURMA      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURP6      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURP0      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURMS      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURM9      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURPS      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURP1      RHLIALRAAQAHLARAAEHAEQNAQ----ALDLFAEELRLAQERLNSITGEF---T-SDD
MNME_BURTA      RHLIALRAAQAHVARAAEHADQNAQ----ALDLFAEELRLAQEQLNSITGEF---S-SDD
MNME_BURCA      RHLIALRAAQEHLAQAANHAEQRAQ----SLDLFAEELRLAQEQLNAITGEF---T-SDD
MNME_BURCH      RHLIALRAAQEHLAQAANHAEQRAQ----SLDLFAEELRLAQEQLNAITGEF---T-SDD
MNME_BURCC      RHLIALRAAQEHLAQAADHAEQRAQ----SLDLFAEELRLAQEQLNAITGEF---T-SDD
MNME_BURL3      RHLIALRAAQEHLAQAADHAEQRAQ----SLDLFAEELRLAQEQLNAITGEF---T-SDD
MNME_BURCM      RHLIALRAAQEHLAQAADHAEQRAQ----SLDLFAEELRLAQEQLNAITGEF---T-SDD
MNME_BURA4      RHLIALRAAQEHLAQAADHAEQRAQ----SLDLFAEELRLAQEQLNAITGEF---T-SDD
MNME_BURVG      RHLIALRAAQEHLAQAADHAEQRAQ----SLDLFAEELRLAQEQLNAITGEF---T-SDD
MNME_PARXL      RHLIALRAAEEHLATAAAHADQNSQ----ALDLFAEELRLAQDQLNSITGEF---S-SDD
MNME_JANMA      RHLVALKSAHDHLEMAAQHAAHDSEATDPALDLFAEELRLAQERLSSITGEF---T-SDD
MNME_HERAR      RHLVALKSAHSHLEMAAQHAAHDNEATDPALDLFAEELRLAQERLSSITGEF---T-SDD
MNME_ACISJ      RHIEALRAVDAHLMEAAAQLESDGP----ALDLLAEELRLAQNALNTITGEF---T-SDD
MNME_ACIAC      RHLEALRAVDMHLMEAAAQLQCDGP----ALDLLAEELRLAQQALNAITGEF---T-SDD
MNME_VEREI      RHVQALQMAAAHLEQAADQLQARGA----ALELLAEELRLAQNALDSITGAF---T-SDD
MNME_RHOFT      RHVQALHRTAAHLMTAGFHLEAKAQ----ALDLLAEELRLAQNALGEITGDF---S-SDD
MNME_POLSJ      RHVRALHHVQDQLATAGRQLQAARP----ALDLLAEDLRQAQRQLSEITGEF---T-PDD
MNME_POLNA      RHVSALRSVQIQLLTAQNQLQAAVP----ALDLLAEDLRQAQLHLSSITGAF---N-ADD
MNME_LEPCP      RHVRALRAAATHVTAAQGWAEQSDS----ALDLLAEELRSAHDALAEITGSY---S-SDD
MNME_METPP      RHLQALQATAEHLVRARQLADRADA----ALDLLAEELRLAHDALGAITGRY---T-PDE
MNME_NEIMA      RHVNALKAAQEELSLAAL---CGNHQ----IELFAEHLRLAQVACGEITGEF---T-ADD
MNME_NEIMB      RHVNALKAAQEELSLAAL---CGNHQ----IELFAEHLRLAQVACGEITGEF---T-ADD
MNME_NEIM0      RHVNALKAAQEELSLAAL---CGNHQ----IELFAEHLRLAQVACGEITGEF---T-ADD
MNME_NEIMF      RHVNALKAAQEELSLAAL---CGNHQ----IELFAEHLRLAQVACGEITGEF---T-ADD
MNME_NEIG1      RHVNALKAAQEELSLAAL---CGNHQ----IELFAEHLRLAQVACGEITGEF---T-ADD
MNME_CHRVO      RHLDAIARAADHLELAE----ADWEQ----VEIFAEELRMAQNALSEITGEF---S-ADD
MNME_AZOSB      RHLLALREALDHLAAAE----AAASA----LELFAEELRLAQEALAGITGEF---S-ADD
MNME_AROAE      RHLVALRDALTHVVAAR----SQCGA----LELFAEELRLAQIRIGEITGEF---S-SDD
MNME_DECAR      RHLRALSAAQEHVAAARNVVEGALPA----LELFAEELRLAQQSLGEITGEF---T-ADD
MNME_NITEU      RHLQALIQAKELLERAAAWLHRAD-----QLEILAEELRLAQQALSSITGEF---T-SDD
MNME_NITEC      RHLQALLHAKELLKRAETWLHTAD-----QLEILAEELRLAQQALSSITGEF---T-SDD
MNME_NITMU      RHLSALTAARTHLEAACALANSLD-----QVELFAEELRLAQLALSSITGEF---S-ADD
MNME_THIDA      RHLDALDRAARHIEQAGAVAR--------QLELFAEELRLAQAALAEITGEF---S-ADA
MNME_METFK      RHLLALNKVRDHLEVAAGRLM--------QAELFAEELRLAQDALSTITGEF---T-SDD
MNME_POLAQ      RHLDCLERAAEHIAKSEQFAANGNN----SLELFAEELFLAQNHLGQITGKL---L-PDD
MNME_FRATF      RHVTAINNAFEHIKLAKEQLELGN------GELLAEELLIVQEYLNSITGEF---S-SDD
MNME_FRATH      RHVTAINNAFEHIKLAKEQLELGN------GELLAEELLIVQEYLNSITGEF---S-SDD
MNME_FRATO      RHVTAINNAFEHIKLAKEQLELGN------GELLAEELLIVQEYLNSITGEF---S-SDD
MNME_FRATT      RHVTAINNAFEHIKLAKEQLELGN------GELLAEELLIVQEYLNSITGEF---S-SDD
MNME_FRAT1      RHVTAINNAFEHIKLAKEQLELGN------GELLAEELLIVQEYLNSITGEF---S-SDD
MNME_FRATW      RHVTAINNAFEHIKLAREQLELGN------GELLAEELLIVQEYLNSITGEF---S-SDD
MNME_FRATN      RHVTAINNAFEHIKLAKEQLELGN------GELLAEELLIVQEYLNSITGEF---S-SDD
MNME_FRAP2      RHVTAIDNAFDHIKLAKEQLELGN------GELLAEELLIVQEHLNSITGEF---S-SDD
MNME_RUTMC      RHIIALEESLASIDNAIMQLENGV------VELMAEDLRFAGQFMGSITGEF---S-SDD
MNME_VESOH      RHIIALEASLVSIGNAIMQLEIGA------IELMAEDLRFAGQFMGSITGEF---S-SDD
MNME_XANAC      RHVQALRRAEQHADAADLELGFEQ------LELAAEELRLAHEALGEITGKL---S-ADD
MNME_XANC5      RHVQALRRAEQHVDAADLELGFEQ------LELAAEELRLAHEALGEITGKL---S-ADD
MNME_XANOM      RHVEALRRAERHVDAADLELGFEQ------LELAAEELRLAHEALGEITGKI---S-ADD
MNME_XANOR      RHVEALRRAERHVDAADLELGFEQ------LELAAEELRLAHEALGEITGKI---S-ADD
MNME_XANCP      RHVDALHRAEQHADAADLELRYEQ------LELAAEELRLAHEALGEITGKL---S-ADD
MNME_XANC8      RHVDALHRAEQHADAADLELRYEQ------LELAAEELRLAHEALGEITGKL---S-ADD
MNME_XANCB      RHVDALHRAEQHADAADLELRYEQ------LELAAEELRLAHEALGEITGKL---S-ADD
MNME_XYLFA      RHVQALQRTAAHVTDANAQFAYEH------LELTAEELRLAYKALGEINGSM---S-PDE
MNME_XYLFT      RHVQALQRTAAHVTDANAQFSYEH------LELTAEELRLAYKALGEINGSM---S-PDE
MNME_BLOFL      RHLKILQKVFQYLLSAKTQLQYNM----TVNDCFAEDLKKAHEELAQIFGKL---T-PDD
MNME_BLOPB      RHLNALEKSSKYLFSAQTQLLSTM----SINELFAEDLGLAHKELSKIFGKF---T-PDD
MNME_BAUCH      RHLEALEITANYLLQCKEKISFP-----TMLELIAEDLQLAHNALSQITGKF---S-SHE
MNME_WIGBR      RHILEIKKAKNNILNAK-KLLNKY----NLSDFVSEELRIAQSCLEKILGIN---NNSND
MNME_BUCCC      RHISALKKSLMYLINGK-RNWMKN----LYLELLSDDIRLSIKYLLKITGKF---N-SED
MNME_BUCAI      RHIKQLDLAYDEFLTAE-NTWRES----ENIELLAESLSIISKFLGEIIGQC---T-SED
MNME_BUCMP      RHINQINLAYNEFLMAK-KKWIIS----KNIELLAESLRLINRFLGEITGRF---T-SND
MNME_BUCAP      RHIHQIDLSYCELLKAQ-KNWLKY----KNIELLAESLNIINKLLGEITGEF---T-SSD
MNME_BUCBP      RHINILSMVLEKFLSSK-KDWKKI----NNIELLADDLRTCQDLLGGITGKI---T-SDE
MNME_CAUVC      RHAERLSEARSYLERAL---SDVGL----EVELAAEDVRLAARALERISGRI---D-PED
MNME_CAUSK      RHAESLTEARTYLQRAL---SDVGL----EVELVAEDVRLAARALSRITGRI---D-PED
MNME_MARMM      RHRRAVETALEALSRCR---DQLAD----APELAGEDARLAVRALESLTGRV---D-VED
MNME_RHORT      RHRSALMEARAALRRAA---EAPLA------ELVAEDLRLALRAIGRITGRV---T-VDD
MNME_MAGSA      RHRVAVAEAVAALSRFD---PGLGI------EMAAEDLRLAARSLGRITGRV---D-VEE
MNME_PARL1      RHREGLADCAASLARAE---AALKAG--RDAELVAEDLRLAARALGRITGRV---D-VED
MNME_NITWN      RHRNILRDAVASLAKAE---TLAG----RGDELVAEELRIAIHLMGRLLGRV---D-IDD
MNME_NITHX      RHRNILQDAAASLAKAE---ALIG----QGDELVAEEIRIAVRLIGRLLGRV---D-IDD
MNME_BRASO      RQRQSLRQTADALQRSL---DTVD----LGEELVAEELRIAALALGRLLGRV---D-VED
MNME_BRASB      RQRTWLSETAAALRRSI---AAVD----LGEELAAEELRIAALALGRLLGRV---D-VED
MNME_BRADU      RQRDLLRQASDSLRRSL---ELVG----EGEELAAEELRSAAYALGRLLGRV---D-VED
MNME_RHOP5      RHRDLLRDALVMLQCSK---RGR------AEELVAEDLRSASRSLGRLLGQV---D-VED
MNME_RHOPS      RHRTLLQDAAAMLQRS----LQHD----LPAELVAEELRLAGVALGRLLGRV---D-VED
MNME_RHOP2      RHRLLLQQAEVMLRCS----MTVG----LAPELVAEELRLAAGALGRLLGRV---D-VED
MNME_RHOPA      RHRRLLADAAASLTRS----LVPG----LAEEIVAEELRASAHSLGRLLGRV---D-VED
MNME_RHOPB      RHRDLLRQTADALGRAI---DLPE-----QVELIAEELRIAAHRLGQLLGRV---D-VED
MNME_METPB      RHREALSRAAGHLDRVA---TAPAG---FPPELVAEDLRLAVRALGEVGGHV---G-VEE
MNME_METRJ      RHRAALEACVAHLDRVS---GSAGG---LP-ELAAEDLRLAVRALGEVAGHV---G-VED
MNME_METS4      RQRRALEECAAHLGRAI---AGAET---MPAELVAEDLRLAVRALGAVAGRV---G-VEE
MNME_AZOC5      RQRHALSDALYELD-AA---LAIQT---HDEDLMAEHLRLAARALDQVVGRV---D-VED
MNME_BEII9      RHRQAFERAAAALDRCI---REA-----SPVELLAEDLRLAAQALLSLTGRI---E-TEE
MNME_RHIEC      RHKDSLTKCLAALDAAI---SEIDA----DLELRTEQLRLAAEYLGRITGRV---D-VEQ
MNME_RHIL3      RHKDSLAKCLAALDVAL---SQTDV----NLELRTEQLRIAAEYLGRITGRV---D-VEQ
MNME_SINMW      RHVDCLRQAGAALVRSM---EARE------LELQAEQLRQAGDALGRITGRV---D-VEK
MNME_RHIME      RHVDCLRQASAALERSL---ISSD------LELRAEQLRQAGDALGRITGRV---D-VEN
MNME_AGRFC      RHKKRLEETLNYVSDAL---DSETL----DLAIRSEYLRLAATSLGRITGRV---D-VED
MNME_BRUC2      RHINLLRATIEEIEKAI---EGDDL----PLELRAENMRLASQFLGRITGDV---D-VEE
MNME_BRUSU      RHINLLRATIEEIEKAI---EGDDL----PLELRAENMRLASQFLGRITGDV---D-VEE
MNME_BRUA2      RHINLLRATIEEIEKAI---EGDDL----PLELRAENMRLASQFLGRITGDV---D-VEE
MNME_BRUAB      RHINLLRATIEEIEKAI---EGDDL----PLELRAENMRLASQFLGRITGDV---D-VEE
MNME_BRUME      RHINLLRATIEEIEKAI---EGDDL----PLELRAENMRLASQFLGRITGDV---D-VEE
MNME_BRUO2      RHINLLRATIEEIEKAI---EGDDL----PLELRAENMRLASQFLGRITGDV---D-VEE
MNME_BRUSI      RHINLLRATIEEIEKAI---EGDDL----PLELRAENMRLASQFLGRITGDV---D-VEE
MNME_OCHA4      RHINLLRSTVTEIDRAI---NGTNL----PLELRAENMRLASQYLGRITGDV---D-VEE
MNME_BARHE      RQLQLLKEAVKEIENSV---NYDSL----DLSLRAEHLRRASDFLGKITGDI---D-VED
MNME_BART1      RQLQLLKEAVKEIENSL---NYHSL----DLSLRAEHLRRASDFLGKITGDI---D-VED
MNME_BARQU      RQLQLLKEAIREIEASI---NYRSL----DLSLHAEHLRCASVFLGKITGDI---D-VED
MNME_BARBK      RQIQLLKEAVKEIDSSI---NYTFL----DLSLRAEHLRRASDALGRITGDI---D-VED
MNME_CHESB      RHVALLGQAADALEAGI---DGENI----GLELRAECLRLSSLALGRISGEI---D-VED
MNME_RHILO      RHVELLGEANRHLLRAA---AEDAA----GQELRAEELRLAADSLGRIVGAI---D-VED
MNME_HYPNA      RHREKLVAGLASLTAAR---DALVSD--MGAELAGEDVRMALRQLSSVIGRV---D-VED
MNME_GRABC      RHRAALQDAIQHLEDAE---SARLE------ELRAEEIRLARQAVGRVTGQI---G-VEQ
MNME_ACICJ      RQIACLRDVAAALDRAL---AIDVP------ELRAEEMQAAAVALARLTGTI---G-VED
MNME_GLUOX      RHRAGIQEAVTHLDHAR---TATWP------ELRGEELRLSMLALGRLTGRV---D-VES
MNME_ERYLH      RQHALLSEAAGELAEIT---RGQDL------LITAEHLRTARSAFDRFTGRA---T-TED
MNME_NOVAD      RQHTHLSEVARALEDAA---AEQDP------LLAAENLRLGRRGLDALVGRT---G-TED
MNME_SPHWW      RQRAALDRLGEALALAR---EEGDP------ILVAEGLRLARAAIDALTGRA---G-TED
MNME_SPHAL      RQRDALAEAKGWLEVETGSREAGDL------ILLAERLRLAGATLDRITGRG---G-VED
MNME_ZYMMO      RQRQLVKEAADSLALAL---DAEDM------LIIAEAIRQACRCYDRLTGKA---G-VEN
MNME_RUEST      RHRETMNRAVLSLRQAIEVVEQGPE----FYDLAAEDMRSAIRALELLVGRI---N-VEN
MNME_RUEPO      RHRVAMKTALDALDRTGTVLESGPD----LYDIAAEELRTAIRALESLVGRI---G-VET
MNME_ROSDO      RHRLAMQRALEDLDNSFEALLRGPE----FYDITAQELRSAIRALETLVGRI---D-AEN
MNME_RHOS4      RHRLAIERAIGAMESVRAELLRGQQ----HTELAADDLRRAIRSLDSLVGRV---D-VES
MNME_RHOS1      RHRLAIERAIGAMESVRAELLRGQQ----HTELAADDLRRAIRSLDSLVGRV---D-VES
MNME_RHOS5      RHRLAMERAIRAMESAHVQLMQGVP----HPELAAEDLRLALRALDSLVGRV---D-VEA
MNME_DINSH      RHRLAISSAVESLDLAKTKISEGF-----PVELVIEDLRQALVDLESLIGRV---G-VEQ
MNME_JANSC      RQRGGIEAARVSLDAGVTVL-SGTA----ELELAAEHIRHAQRSLDSVIGRV---D-VEN
MNME_PARDP      RQAEALQRAVAALAIDDSLA----------PEFLAEALRQAAQALAMMVGRV---G-AED
MNME_RICAH      RHRHYLKQALSHLTDFS----LDN-----DLVLATEDIRITARCIGAITGVI---N-VEE
MNME_RICFE      RHRHYLKQALSHLTAFS----LDN-----DLVLATEDIRMTARCIGAITGVI---N-IEE
MNME_RICRO      RHRNYLQQALSHLTAFS----LDN-----DLVLATEDIRMTARCIGAITGVI---N-VEE
MNME_RICRS      RHRNYLQQALSHLTAFS----LDN-----DLVLATEDIRMTARCIGAITGVI---N-VEE
MNME_RICCN      RHRNYLQQALSHLTAFS----LDN-----DLVLATEDIRMTARCIGAITGVI---N-VEE
MNME_RICM5      RHRNYLQQALSHLTAFS----LDN-----DLVLATEDIRMTARCIGAIMGVI---N-VEE
MNME_RICCK      RHRHYLKQGLTYLKNFT----LDN-----DLVLATEDIRMTVRCIGTITGVI---N-VNE
MNME_RICPR      RHRHYLKQALSHLIDFN----LDN-----DLVLATEDIRMTVRCIGLITGVI---N-VEE
MNME_RICTY      RHRHYLKQALSHLMAFN----LDN-----DLVLATEDMRMTARCIGLITGVI---N-VEE
MNME_RICB8      RHRHHLKQALVYLKDFN----LDN-----DLVLATEDIRMTMHRIGAITGII---D-VEE
MNME_RICBR      RHRHHLKQALVYLKDFN----LDN-----DLVLATEDIRMTMRRIGAITGII---D-VEE
MNME_ORITB      RYRNSLNKALELLQLVN----LEN-----DLVLAAEDLRMAIRYLEHITGKI---K-IDD
MNME_ANAMM      RHRGHLQSAAKVISDIT----DEM-----PAEIVAEYLRLATKEIGKVTGAV---Y-GDD
MNME_ANAPZ      RHRSHLQKALQVVDAVS----KVM-----PIEIVAEHLRIAAYELGRVTGAV---S-GDD
MNME_EHRCJ      RQRLHIQNTLNIVKNMD----LEL-----PMEIVAEDLRLSVRELGKVVGVI---S-DED
MNME_EHRCR      RQRKHIQNTLNIIKSVD----LSL-----PMEIVSEDLRLSVRELGKVVGVI---S-DDD
MNME_EHRRW      RQRVHIQNAVNILKNIS----FEL-----PMELISEDLRLSVRELEKVVGVI---S-NEE
MNME_EHRRG      RQRVHIQNAVNILKNIS----FEL-----PMELISEDLRLSVRELEKVVGVI---S-NEE
MNME_WOLTR      RHRNCMQKAIEHLRRFN----MNN-----PIELVSEDLRLAASELGVVTGII---N-VEE
MNME_WOLPM      RHRNHMKKALEHLQRFN----IDN-----PIELISEDLRLAAFELGAVIGII---D-VEE
MNME_NEOSM      RHRLALENALEHLRRFN----TDL-----PIELAAEEIKLAANHIASVTGEI---K-LDD
MNME_PELUB      RHRQHLEQSLNCLKNFE----EKNEA--EDFDKAAEDLRLATRHLGMIVGKV---D-VEE
MNME_DEIRA      RQTDTVRRALTHVQAARTLP----------DDLAGYELEEALHALAELTGQD---V-QED
MNME_DEIGD      RQADAARRALTHIQAARSLP----------DDLAGYELEEALRALADLTGRD---V-QDD
MNME_THET8      RQVEALLRARERLEEALSLP----------EDLMGLALEEAARALALLTGKE---V-AEE
MNME_THET2      RQVEALLRARERLEEALALP----------EDLMGLALEEAARALALLTGKE---V-AEE
MNME_HALHL      RHIEALDRAGEELEEALVVARRGGQ-----EELVAEALRRAQTALGEITGRV---S-HEA
MNME_MYXXD      RHADALRRASEALGRAESASRVSTL-----E-VVSGEVGLALEALGEVSGTV---V-SEA
MNME_RHOBA      RCQDSLAAAIEHLAQAIQWTEQAAG-----HELVAAEMRLAVEAIGEVTGQV---Y-TDD
MNME_AQUAE      HETLLKKAKEVLERFKEEFREKDISP-----EIAMLDLREASDYLGEILGEI---T-TED
MNME_MAGMM      RQQQTLQQAIVLIEEAQEMLANGQWL-----ELVAEPLTRSIDQLTQLMGNT---D-YED
MNME_KORVE      RQHQLVTDSLAALEAATNALEVRVPH-----EMVLMDLYNALRPLDDITGAT---T-ADD
MNME_SOLUE      RHEQLLREAVEYLQKAREAV-ASIPH-----EMLLLDLYAALRPIDAITGAT---T-ADD
MNME_CHLTR      RHHSLLHSVYTCLTAALNGFTEHL-----PNECIALDLRQALHSIGNLSGSE---V-TEN
MNME_CHLTB      RHHSLLHSVYTCLTAALNGFTEHL-----PNECIALDLRQALHSIGNLSGSE---V-TEN
MNME_CHLT2      RHHSLLHSVYTCLTAALNGFTEHL-----PNECIALDLRQALHSIGNLSGSE---V-TEN
MNME_CHLTA      RHHSLLHSVYTCLTAALNGFTEHL-----PNECIALDLRQALHSIGNLSGSE---V-TEN
MNME_CHLMU      RHHSLLHAVHTCLTDALTGFQEHL-----PNECLALDLRQALHSIGNLSGSE---V-TEN
MNME_CHLCV      RHHTILQQMRSYLLSAKEGLLAQL-----PPELIALELRQALQATGNLSGSE---V-NET
MNME_CHLFF      RHHTILQQIRTYLLSAKEGLLSQL-----PPELVALELRQALQTTGNLSGSE---I-NET
MNME_CHLAB      RHHTILQHMRTYLLSAQEGLQSQS-----PPEFIALELRQALQTTGNLSGSE---I-NET
MNME_CHLPN      RHHMILQEVARCLKEAQQNLYLQ------PPEIIALELREALHSIGMLSGKE---V-TES
MNME_PARUW      RHKEALIESIESLRRVKIGLRHQV-----SPEFLTLDMRQSLLELGKIIGTN---I-SED
MNME_OPITP      RHSHALALALEALDAALDKLRSGD-----AAELLASDLRSALLALGDIAGRV---D-NER
MNME_BDEBA      RHFENLTRALENTQRSQSVVAQGL-----GAEFLALEFKEALIAIHETLGKR---F-DDQ
MNME_DESHY      RQITALERAVSALANGWDSVKNGL-----PWDMVSIDIRQALQEISQMTGDS---V-QES
MNME_ALKMQ      RHKNALERALESLTDGVQAIKQKM-----PLDFVEVDVKNAWDALGEITGDT---V-GED
MNME_ALKOO      RHKNALERALDSIIDGTKAIEQKL-----PLDFVEVDIKNSWKALGEITGDT---V-EED
MNME_CLOD6      RHKDALSKAYKSATDALIALEQSM-----PFDFVEVDLKNIWDYLGYINGDT---V-TED
MNME_FINM2      RHRDIINKAIKSLESSLHDMEAGV-----PIDCFEVDLRNAWEILGEITGET---V-DDD
MNME_FUSNN      RHKSALEKTNEALLNIIETIDMGL-----PMDLMAVDIKDALDSLSEVTGEI---S-SED
MNME_CLOB1      RHQEALIRSRESCIQAIETLSDEI-----SIDLASIDIRNAWKYLGEITGDT---L-DEN
MNME_CLOBK      RHQEALIRSRESCIQAIETLSDEI-----SIDLASIDIRNAWKYLGEITGDT---L-DEN
MNME_CLOBH      RHQEALIRSRESCIQAIETLSDEI-----SIDLASIDIRNAWKYLGEITGDT---L-DEN
MNME_CLOBL      RHQEALIRSRESCIQAIETLSDEI-----SIDLASIDIRNAWKYLGEITGDT---L-DEN
MNME_CLOBM      RHQEALIRSRESCIQAIETLSDEI-----SIDLASIDIRNAWKYLGEITGDT---L-DEN
MNME_CLOK5      RHKEGLIRAKESCIEALQTLKSTL-----SIDLVSIDIKNAWINLGKITGDT---L-EED
MNME_CLOTE      RHKEALIRAKESCNTALKALENTL-----AIDLASIDIKNAWLSLGEITGDT---L-EED
MNME_CLONN      RHKEALIRAKESLEASKNALDNTF-----AIDLASIDLRNAWKSLGEINGDT---V-EED
MNME_CLOAB      RHKEALLRAREHCTTSLKALQDTL-----AIDLASIDIRNAWTALGEITGET---L-QED
MNME_CLOPE      RHKEALYRASENLDGALNGLNNNE-----FLDLVSIYVTSALRALGEITGAE---L-EED
MNME_CLOP1      RHKEALYRASENLDGALNGLNNNE-----FLDLVSIYVTSALRALGEITGAE---L-EED
MNME_CLOPS      RHKEALYRASENLDGALNGLNNNE-----FLDLVSIYVTSALRALGEITGAE---L-EED
MNME_CLOB8      RHKQALYKSLENCKMALDKINANE-----YLDLISIYITAAMKALGEITGDE---L-EED
MNME_LACP7      RHKNALVEAKVSLEQVIVSIENEM-----PEDFFSIDLMNAYEILGTIIGES---V-DED
MNME_THEP3      RHKEALINAKKYMESCVEAIEGGY-----SEDLITIDLNAALDQLGKITGET---A-TED
MNME_THEPX      RHKEALINAKKYMESCVEAIEGGY-----SEDLITIDLNAALDQLGKITGET---A-TED
MNME_CALS4      RHREVLINAKKHMESVIEAIEKGY-----SEDLITIDVNGALNEIGKITGET---A-TED
MNME_HUNT2      RHKNLIDMAISSIEKAMESIDGSM-----PLDLVSIDITDAADYLGQITGES---V-SED
MNME_CARHZ      RHKNYLEKALNSLLSAKESIASGE-----PVDLVAIDLNEALRELGAITGDA---L-GDE
MNME_DESRM      RHKHALERAMQHLLEASKGLQEYV-----PADLVSIDLKSSWEILGEITGNS---V-TED
MNME_PELTS      RHRMAMERAADHLAEAVSGIRQNV-----PVDVVAIDLRAAWESLGEITGTT---V-TED
MNME_CALS8      RHKELLLKAKGFLTSAKQNL-YSF-----PLDILSIDLKNALDSIYQITGKN---V-TED
MNME_SYNWW      RQKNALLTAKRHIEESLAAM-GKV-----SLDCLGVDIWGALEALGEISGKN---L-KEE
MNME_NATTJ      RHFHSLDKVKEALSSAEENIKAEM-----SEDLIAIDIKEAYDYLGEITGET---A-SEE
MNME_DESPS      RHKKSLEATLIAAERMVDDLAQGMG----SSDLLSIDMQECLDQLGDIIGIT---T-TDD
MNME_MOOTA      RHRAALENCREHLASAIKAWEEGL-----PEDLIAIDLWSAADYLGEIIGTT---A-RED
MNME_DESAP      RHQHALEQAGRYLEEARSALVSGM-----PLEMAVIDIRNALDSLGDITGET---A-GED
MNME_ROSS1      RHRDALARAADHARDALTGFQQGV-----SPDLLAVDLTAAINAIGEVTGES---V-GED
MNME_ROSCS      RHRDALARAATHARDALDSFRRGV-----SPDLLAVDLTAAINAIGEVTGEA---V-GDD
MNME_CHLAA      RHRAALRRAAEFLRAAQETLAAGA-----ATDLLAADLTGAANALGEITGET---V-GED
MNME_SYMTH      RQAEAIRRARNHLRDAQATLESGL-----GDELVAIDLRAAWMALGEVTGET---A-GEE
MNME_HELMI      RHREALERSYAHLRQALDAVAHGA-----SPDFLTIDLKAAWEALGEITGDT---V-GED
MNME_GEOSL      RHRDLLSRSTMHLTAFEQGLASGF-----TLELLAVELRDALAAVGEVTGET---T-PDD
MNME_GEOMG      RHRDALVKARGRIAVFFANLAAGN-----DLEILAVDLRDALDAVGEVTGET---T-PDD
MNME_GEOUR      RHRDALQKSRDALLRFRGNLVAGM-----ELDLLAIDLRDALSAIGEVTGET---T-ADD
MNME_PELPD      RHRDALSSADGSLSRFRQGLDSGA-----SLDLLALDLREALASVGEVTGQV---T-NED
MNME_PELCD      RHRQALVKARQSLGRFRETLVQGM-----SPEFGAVELRDALDAVGEITGET---T-PDD
MNME_SYNAS      RHKMALEKTRQQVSQALASLQEGL-----SQEFAALDIREALEALGEIAGET---V-TED
MNME_SYNFM      RQRGCIEKALQAMIRARDLISGGG-----FWELASTELRTARNELDSVLGWN---G-DDA
MNME_DESVH      RQAAALDKAATILDELAGDIRAHV-----PYDLCGVRLDGACAALMDVTGQS---T-PEA
MNME_DESVV      RQAAALDKAATILDELAGDIRAHV-----PYDLCGVRLDGACAALMDVTGQS---T-PEA
MNME_DESAG      RQTEALRRALEELEALAADIVSGV-----PYDLAGVRLESACSVLSEITGET---T-PDD
MNME_LAWIP      RQVEVFSLVLEEIRSLYEDIRSGI-----PYDLCAVMLENISSMLNSIIGFD---T-PEE
MNME_NOSS1      RQAAALTQAKMSLEQVQATITQQL-----PLDFWTIDLRGAIQALGEITGEE---V-TES
MNME_TRIV2      RQAAALTQAKISLEQVQATITQQL-----PLDFWTIDLRGAIQALGEITGEE---V-TES
MNME_TRIEI      RQAAALTRAKIALEQCLNTIKNNL-----PLDFWTIDLRGSIYALGEVTGED---V-TES
MNME_ACAM1      RQAAALQKAQAALEHVQGAIADQL-----PLDFWTIDLRGAIQALGEITGED---I-TES
MNME_SYNY3      RQEAVLTEAQLALKQLQQTMAEQL-----PLDFWTIDLRLAINALGQVTGET---V-TES
MNME_MICAN      RQAAALTRAKIALQQVKKTIDQNL-----PFDFWSIDLRTAIQSLGEITGEE---V-TES
MNME_SYNP2      RQAAALAQAQQALIQVRETIAQGL-----PLDFWTIDLRSAIQALGEITGEG---V-TES
MNME_SYNE7      RQVAALTTAQTALRRVEETLQAQL-----PLDFWTIDLREAIAALGSITGEE---I-AES
MNME_SYNP6      RQVAALTTAQTALRRVEETLQAQL-----PLDFWTIDLREAIAALGSITGEG---I-AES
MNME_THEEB      RQAGLLEQVHQSLNHVLAAIDAQL-----PLDFWTIDLHAAARALGTLTGEE---V-TES
MNME_SYNJA      RQAAALRQAQASLEQVVQAMQAQL-----PLDFWTIDLRGALHALGQITGEE---I-SEA
MNME_SYNJB      RQAAALQQAQASLEQVGQAIQAQL-----PLDFWSIDLRGALHALGQITGEE---I-SES
MNME_GLOVI      RQYEALVRAEVALVRVVETVEAAL-----PIDFWTIDLRAAAHALGEVTGES---V-TEA
MNME_PROM1      RQLDLAKSTTESLENINKVFDEKL-----PWDFWTIDLRQAINYLGELTGED---L-TEN
MNME_PROMT      RQLDLAKSTMKSLENINKVFDEKL-----PWDFWTIDLRQAINYLGELTGED---L-TES
MNME_PROMA      RQLDLVKVAVNALDQIEKVAAESL-----AWDFWTIDLREAIYKLGELTGEE---V-TEA
MNME_PROM3      RQQDLAATAAIALARTQEAAAQKL-----PWDFWTIDLRQAISSLGEITGEE---I-TEA
MNME_PROMM      RQQDLAAAAAIALARTQEAAEHQL-----PWDFWTIDLRQAISSLGEITGEE---I-TEA
MNME_SYNSC      RQRDLAARAAEALARSQEVAAQQL-----PWDFWTIDLREAIRALGEITGEE---L-TEA
MNME_SYNPX      RQRDLAATAAAALGRSQEVAAQQL-----PWDFWTIDLREAIRALGEITGEE---L-TEA
MNME_SYNS9      RQRDLASVAAAALERSHEVAQQQL-----PWDFWTIDLREAIRGLGEITGEE---L-TEA
MNME_SYNPW      RQGDLAQQAADALARSAQVAADGL-----PWDFWTIDLRQAIHSLGEITGEE---L-TES
MNME_SYNS3      RQSDLAVTAAEALARSEQVAADGL-----PWDFWTIDLRQAIRSLGEITGEQ---L-TES
MNME_SYNR3      RQCDLAAAASAALGRSQQAARDGL-----PWDFWTIDLREAIRALGEITGAE---I-TEA
MNME_PROMS      RHLTNLSACLSNLNDTDEIIENKL-----PFDLLSIELRDGIQNLSKITGQE---L-TEE
MNME_PROM0      RHQTNLSACLSNLNDTDEIIENKL-----PFDLLSIELRDGIQNLSKITGQE---L-TEE
MNME_PROM2      RHLANLSACLSNLNDTDEIIKNKL-----PFDLLSIELRDGIQNLSKITGQE---L-TEE
MNME_PROM9      RHLTNLSSCLSNLNDTDVIIKNKL-----PFDLLSIELRDGIQNLSKITGQE---L-TEE
MNME_PROM5      RQISNLRDCLKNLNDTDPIIANQL-----PFDLLSIEVRDGIKNLSRITGQE---L-TED
MNME_PROMP      RQISNLTDCLKNLNDTDPIIANKL-----PFDLLSIEVRDGIKNLSRITGQE---L-TED
MNME_CYACA      LNNIYLILDELYTGSLNKSVTSYD-----FIAVELRRVLQGLNQIT--GDEV---V-ENN
MNME_CYAM1      RQSQLLQQAKQHLCNLQSALDEGY-----PLEIISWHLKNAIQCLD--END----V-NAS
MNME_BACFR      RHYEALTRALDAIHRVQEGLDANI-----SGDFLSQDIRECIFHLSDIAGE----VTNDM
MNME_BACFN      RHYEALTRALDAIHRVQEGLDANI-----SGDFLSQDIRECIFHLSDIAGE----VTNDM
MNME_BACTN      RHYEALSKALDAIHRVQDGLDSHI-----SGDFLSQDIRECIFFISDIAGE----VTNDM
MNME_BACV8      RHYEALTRALDSIHRVQEGLQLEL-----SGDLVSEDLRQCIHELSEIVAEG--GITSEE
MNME_PARD8      RHFEALTHALEAIHRVQEGLNSSL-----SGDFISQDLRECIFHLSDIVGE----VTTDQ
MNME_PORGI      RHHQLLREAFDALRRMRLGFDMGL-----STDLLTLDLRHAITSIGEITGRE---ITSDD
MNME_FLAJ1      RHYDSLLKALDEIQKVKFGLETNL-----SSDLIALDIKEALYQFGLITGQ----VSNDE
MNME_FLAPJ      RHYDSLLKALDEIQKVKFGLQTNL-----PSDLMAIDIKQALYYFGEITGQ----VTNDE
MNME_GRAFK      RHYAALLKALEEINKVEEGLNADL-----SGDLLAIDIRQALHHFGEITGE----ITNDD
MNME_CYTH3      RHYESLRETRKALDEVLTGMDSQV-----PGDLLAQDIRQSLFHLGEITGD----ISTDD
MNME_SALRD      RHRQHLRDALDAVQQAREALDAGV-----SGDMLTLDLRAALQELGAITGE----ITNED
MNME_CHLTE      RHYEALRNASDALQNALELIAHES-----ETELIAFELRAALDYVGQITGK----VVNEE
MNME_CHLPD      RHYEALRNAGDALRNAQNLLDEQA-----DTELIAFELRAALDYVGEITGK----VVNEE
MNME_CHLPM      RHYEALRNAADSLDNALQLITARE-----PAELIAFELRSALDYVGEITGK----VVSQE
MNME_PELLD      RHYEALRNASDALHNALGLIEGGE-----ATELIAFELRSALDYVGEITGK----VVSEE
MNME_CHLCH      RHYEALRRASDALENGACLVAEHA-----ETELVAFELRSALEAVGEITGK----VVNDE
MNME_BORAP      RQIQLLEKAYALILDLLSKIDRQV-----SYDMLAFDAYEIINCLGEITGE----VSSED
MNME_BORBU      RQMQLLEKAYALILDLLSKIDRQV-----SYDMLAFDAYEIINCLGEITGE----VSSED
MNME_BORBP      RQMQLLEKAYALVLDLLNKIDRQV-----SYDMLAFDAYEIINCLGEITGE----VSSED
MNME_TREPA      RQYVLVDAAVQALEHAQEAYARGF-----GLDAVVHDLEEALYHCGALTGE----VHSED
MNME_TREDE      RQRDAVQKALDVLQTAYQNSLEGF-----PLDLIVEDLEEALSFLGEITGE----VRSDD
MNME_LEPBJ      RQRYHFETIVRCLDKTLRLIEEGA-----PAEIYIQEMNYALSEIGEVNGRVDT----EE
MNME_LEPBL      RQRYHFETIVRCLDKTLRLIEEGA-----PAEIYIQEMNYALSEIGEVNGRVDT----EE
MNME_LEPIN      RQRYHFETIVRCLDKTLHLLKEGA-----PAEIYIQEINYALAEIGEVNGKVDT----EE
MNME_LEPIC      RQRYHFETIVRCLDKTLHLLKEGA-----PAEIYIQEINYALAEIGEVNGKVDT----EE
MNME_LEPBA      RQRYHIQKIESCLSEAIQLMENNA-----PAEIYIQEINVALHEIGQVNGVVEN----EE
MNME_LEPBP      RQRYHIQKIESCLSEAIQLMENNA-----PAEIYIQEINVALHEIGQVNGVVEN----EE
MNME_UNCTG      RHFILLQNTLESLIRTKQSLSAKDA-----DEIACFEALSAQISLNEILGIN----VKQD
MNME_SULMW      HYESFKKAIFYLYKVKKNLYSISP-------EFLSIDIRTALDYLGKVTGEV----TNED
MNME_CARRP      NNYSDVKILFNKFSFFYKEFSCNY-------DLVLSKLIDFQKNIFKLTGNF----TNKK
                                                                            

MNME_THEMA      LLDTIFSNFCVGK-
MNME_THESQ      LLDTIFSNFCVGK-
MNME_THEP1      LLDTIFSNFCVGK-
MNME_FERNB      LLDNIFSNFCVGK-
MNME_THEM4      LLDNIFSNFCVGK-
MNME_PSELT      LLDRIFKDFCVGK-
MNME_PETMO      LLDKIFSTFCVGK-
MNME_AYWBP      LIKELFSKFCLGK-
MNME_ONYPE      LIKELFSKFCLGK-
MNME_ACHLI      LLTELFSKFCLGK-
MNME_BACAN      LIDQLFSQFCLGK-
MNME_BACHK      LIDQLFSQFCLGK-
MNME_BACCZ      LIDQLFSQFCLGK-
MNME_BACAH      LIDQLFSQFCLGK-
MNME_BACC1      LIDQLFSQFCLGK-
MNME_BACCR      LIDQLFSQFCLGK-
MNME_BACMK      LIDQLFSQFCLGK-
MNME_BACCN      LIDQLFSQFCLGK-
MNME_BACSU      LIDQLFSQFCLGK-
MNME_BACVZ      LIDQLFSQFCLGK-
MNME_BACP2      LIDQLFSQFCLGK-
MNME_BACLD      LIDQLFSQFCLGK-
MNME_GEOKA      LIDQLFAQFCLGK-
MNME_GEOTN      LIDQLFAQFCLGK-
MNME_LYSSC      LINQLFSQFCLGK-
MNME_OCEIH      LIDQLFSQFCLGK-
MNME_BACSK      LIDQLFSQFCLGK-
MNME_BACHD      LIDQLFSQFCLGK-
MNME_EXIS2      LLDKLFSQFCLGK-
MNME_STAAC      LIDQLFSQFCLGK-
MNME_STAAE      LIDQLFSQFCLGK-
MNME_STAAT      LIDQLFSQFCLGK-
MNME_STAA3      LIDQLFSQFCLGK-
MNME_STAA2      LIDQLFSQFCLGK-
MNME_STAA9      LIDQLFSQFCLGK-
MNME_STAAR      LIDQLFSQFCLGK-
MNME_STAAW      LIDQLFSQFCLGK-
MNME_STAAN      LIDQLFSQFCLGK-
MNME_STAA8      LIDQLFSQFCLGK-
MNME_STAA1      LIDQLFSQFCLGK-
MNME_STAAM      LIDQLFSQFCLGK-
MNME_STAAS      LIDQLFSQFCLGK-
MNME_STAAB      LIDQLFSQFCLGK-
MNME_STAES      LIDQLFSQFCLGK-
MNME_STAEQ      LIDQLFSQFCLGK-
MNME_STAHJ      LIDQLFSQFCLGK-
MNME_STAS1      LIDQLFSQFCLGK-
MNME_LISMO      LLDQLFNQFCLGK-
MNME_LISMF      LLDQLFNQFCLGK-
MNME_LISIN      LLDQLFNQFCLGK-
MNME_LISW6      LLDQLFNQFCLGK-
MNME_ENTFA      LITQLFSQFCLGK-
MNME_LACP3      LITQLFSQFCLGK-
MNME_LACSS      LITELFSQFCLGK-
MNME_LACS1      LLTQLFSQFCLGK-
MNME_LACPL      LLDQLFSQFCLGK-
MNME_LACBA      LLDQLFSQFCLGK-
MNME_PEDPA      LLDQLFSQFCLGK-
MNME_LACLM      LITQLFSQFCLGK-
MNME_LACLS      LITQLFSQFCLGK-
MNME_LACLA      LITQLFSQFCLGK-
MNME_STRA1      LITQLFSQFCLGK-
MNME_STRA5      LITQLFSQFCLGK-
MNME_STRA3      LITQLFSQFCLGK-
MNME_STRAG      LITQLFSQFCLGK-
MNME_STRTD      LITQLFSQFCLGK-
MNME_STRT1      LITQLFSQFCLGK-
MNME_STRT2      LITQLFSQFCLGK-
MNME_STRMU      LITQLFSQFCLGK-
MNME_STRP8      LITQLFSQFCLGK-
MNME_STRPD      LITQLFSQFCLGK-
MNME_STRP6      LITQLFSQFCLGK-
MNME_STRP3      LITQLFSQFCLGK-
MNME_STRPG      LITQLFSQFCLGK-
MNME_STRP1      LITQLFSQFCLGK-
MNME_STRPC      LITQLFSQFCLGK-
MNME_STRPM      LITQLFSQFCLGK-
MNME_STRPF      LITQLFSQFCLGK-
MNME_STRGC      LITQLFSQFCLGK-
MNME_STRSV      LITQLFSQFCLGK-
MNME_STRR6      LITQLFSQFCLGK-
MNME_STRP2      LITQLFSQFCLGK-
MNME_STRPI      LITQLFSQFCLGK-
MNME_STRPN      LITQLFSQFCLGK-
MNME_STRSY      LITQLFSQFCLGK-
MNME_STRS2      LITQLFSQFCLGK-
MNME_LACGA      LITQLFSQFCLGK-
MNME_LACJO      LITQLFSQFCLGK-
MNME_LACAC      LITQLFSQFCLGK-
MNME_LACH4      LVTQLFSQFCLGK-
MNME_LACDB      LINDLFSQFCLGK-
MNME_LACDA      LINDLFSQFCLGK-
MNME_MYCGE      LVNEIFNNFCLGK-
MNME_MYCPN      LINEIFKHFCLGK-
MNME_MYCGA      LIDEIFKNFCLGK-
MNME_UREPA      FLDDLFKNFCIGK-
MNME_UREP2      FLDDLFKNFCIGK-
MNME_MYCPE      IIDKMFKNFCLGK-
MNME_MYCMS      IIDNIFRKYCLGK-
MNME_MYCCT      IIDNIFRKYCLGK-
MNME_MESFL      IIDNIFKKYCLGK-
MNME_MYCPU      LLDSMFSNFCLGK-
MNME_MYCMO      LLDKMFSNFCLGK-
MNME_MYCAP      LLDEMFKNFCLGK-
MNME_MYCS5      LLDEMFKNFCLGK-
MNME_MYCHJ      LLDSIFSKFCLGK-
MNME_MYCH2      LLDSIFSKFCLGK-
MNME_MYCH7      LLDSIFSKFCLGK-
MNME_CAMJE      ILDEMFGNFCLGK-
MNME_CAMJJ      ILDEMFGNFCLGK-
MNME_CAMJR      ILDEMFGNFCLGK-
MNME_CAMJ8      ILDEMFGNFCLGK-
MNME_CAMJD      ILDEMFGNFCLGK-
MNME_CAMC5      ILDEMFSHFCLGK-
MNME_CAMC1      ILDEMFSHFCLGK-
MNME_CAMHC      ILESMFSNFCLGK-
MNME_CAMFF      LLDKMFSSFCLGK-
MNME_SULDN      MLDKMFGSFCLGK-
MNME_ARCB4      MLDVMFGEFCLGK-
MNME_NITSB      LLDKMFGEFCLGK-
MNME_SULNB      ILDKMFGEFCLGK-
MNME_HELHP      LLDRLFATFCLGK-
MNME_WOLSU      LLDVMFGQFCLGK-
MNME_HELPY      MLDSMFSEFCLGK-
MNME_HELPJ      MLDSMFSEFCLGK-
MNME_HELPH      MLDSMFSEFCLGK-
MNME_HELAH      MLDSMFSEFCLGK-
MNME_ECOLI      LLGRIFSSFCIGK-
MNME_ECOLC      LLGRIFSSFCIGK-
MNME_SHIBS      LLGRIFSSFCIGK-
MNME_ECODH      LLGRIFSSFCIGK-
MNME_SHIFL      LLGRIFSSFCIGK-
MNME_SHIF8      LLGRIFSSFCIGK-
MNME_SHIDS      LLGRIFSSFCIGK-
MNME_ECO57      LLGRIFSSFCIGK-
MNME_ECOUT      LLGRIFSSFCIGK-
MNME_ECOL5      LLGRIFSSFCIGK-
MNME_ECOK1      LLGRIFSSFCIGK-
MNME_ECOL6      LLGRIFSSFCIGK-
MNME_ECOSM      LLGRIFSSFCIGK-
MNME_ECO24      LLGRIFSSFCIGK-
MNME_ECOHS      LLGRIFSSFCIGK-
MNME_SHISS      LLGRIFSSFCIGK-
MNME_SALCH      LLGRIFSSFCIGK-
MNME_SALPB      LLGRIFSSFCIGK-
MNME_SALTY      LLGRIFSSFCIGK-
MNME_SALPA      LLGRIFSSFCIGK-
MNME_SALTI      LLGRIFSSFCIGK-
MNME_SALAR      LLGRIFSSFCIGK-
MNME_CITK8      LLGRIFSSFCIGK-
MNME_ENT38      LLGRIFSSFCIGK-
MNME_KLEP7      LLGRIFSSFCIGK-
MNME_CROS8      LLGRIFSSFCIGK-
MNME_YERPA      LLGRIFSSFCIGK-
MNME_YERPN      LLGRIFSSFCIGK-
MNME_YERPP      LLGRIFSSFCIGK-
MNME_YERPE      LLGRIFSSFCIGK-
MNME_YERPS      LLGRIFSSFCIGK-
MNME_YERP3      LLGRIFSSFCIGK-
MNME_YERPY      LLGRIFSSFCIGK-
MNME_YERE8      LLGRIFSSFCIGK-
MNME_SERP5      LLGRIFSSFCIGK-
MNME_PECAS      LLGRIFSSFCIGK-
MNME_PHOLL      LLGRIFSSFCIGK-
MNME_SODGM      LLGRIFSSFCIGK-
MNME_ACTP2      LLGNIFSSFCIGK-
MNME_ACTPJ      LLGNIFSSFCIGK-
MNME_HAEDU      LLGNIFSSFCIGK-
MNME_HAEI8      LLGNIFSSFCIGK-
MNME_HAEIE      LLGNIFSSFCIGK-
MNME_HAEIN      LLGNIFSSFCIGK-
MNME_HAEIG      LLGNIFSSFCIGK-
MNME_MANSM      LLGNIFSSFCIGK-
MNME_ACTSZ      LLSNIFSSFCIGK-
MNME_PASMU      LLGNIFSSFCIGK-
MNME_HAES1      LLGNIFSSFCIGK-
MNME_HISS2      LLGNIFSSFCIGK-
MNME_AERHH      LLGRIFSSFCIGK-
MNME_AERS4      LLGRIFSSFCIGK-
MNME_SHEB8      LLGKIFSSFCIGK-
MNME_SHEB9      LLGKIFSSFCIGK-
MNME_SHEB5      LLGKIFSSFCIGK-
MNME_SHEPC      LLGKIFSSFCIGK-
MNME_SHESW      LLGKIFSSFCIGK-
MNME_SHESA      LLGKIFSSFCIGK-
MNME_SHESM      LLGKIFSSFCIGK-
MNME_SHESR      LLGKIFSSFCIGK-
MNME_SHEON      LLGKIFSSFCIGK-
MNME_SHEFN      LLGKIFGSFCIGK-
MNME_SHEDO      LLGKIFSSFCIGK-
MNME_SHEHH      LLGKIFSSFCIGK-
MNME_SHEPA      LLGKIFSSFCIGK-
MNME_SHESH      LLGKIFSSFCIGK-
MNME_SHEWM      LLGKIFSSFCIGK-
MNME_SHELP      LLGKIFSSFCIGK-
MNME_SHEAM      LLGKIFSSFCIGK-
MNME_VIBCH      LLGRIFSSFCIGK-
MNME_VIBC3      LLGRIFSSFCIGK-
MNME_VIBCB      LLGRIFSSFCIGK-
MNME_VIBPA      LLGRIFSSFCIGK-
MNME_VIBVU      LLGRIFSSFCIGK-
MNME_VIBVY      LLGRIFSSFCIGK-
MNME_ALIF1      LLGRIFTSFCIGK-
MNME_PHOPR      LLGRIFTSFCIGK-
MNME_PSYIN      LLGKIFSSFCIGK-
MNME_PSEA6      LLGKIFSSFCIGK-
MNME_PSEHT      LLGKIFSSFCIGK-
MNME_IDILO      LLGQIFGSFCIGK-
MNME_COLP3      LLGKIFSSFCIGK-
MNME_CHRSD      LLGEIFGSFCIGK-
MNME_MARMS      LLGRIFGSFCIGK-
MNME_MARHV      LLGKIFSSFCIGK-
MNME_HAHCH      LLGRIFSSFCIGK-
MNME_PSEAE      LLGRIFSSFCIGK-
MNME_PSEAB      LLGRIFSSFCIGK-
MNME_PSEA7      LLGRIFSSFCIGK-
MNME_PSEPU      LLGRIFSSFCIGK-
MNME_PSEP1      LLGRIFSSFCIGK-
MNME_PSEPK      LLGRIFSSFCIGK-
MNME_PSEPG      LLGRIFSSFCIGK-
MNME_PSEPW      LLGRIFSSFCIGK-
MNME_PSEE4      LLGRIFSSFCIGK-
MNME_PSEF5      LLGRIFSSFCIGK-
MNME_PSEPF      LLGRIFSSFCIGK-
MNME_PSE14      LLGRIFSSFCIGK-
MNME_PSEU2      LLGRIFSSFCIGK-
MNME_PSESM      LLGRIFSSFCIGK-
MNME_PSEMY      LLGRIFSSFCIGK-
MNME_PSEU5      LLGRIFSSFCIGK-
MNME_SACD2      LLGKIFSSFCIGK-
MNME_HYDCU      LLGRIFTSFCIGK-
MNME_LEGPC      LLGKIFSSFCIGK-
MNME_LEGPH      LLGKIFSSFCIGK-
MNME_LEGPA      LLGKIFSSFCIGK-
MNME_LEGPL      LLGKIFSSFCIGK-
MNME_ALCBS      LLGRIFSSFCIGK-
MNME_METCA      LLNRIFSSFCLGK-
MNME_NITOC      LLGEIFSTFCIGK-
MNME_ALKEH      LLGEIFSSFCIGK-
MNME_COXBU      LLGKIFSEFCIGK-
MNME_COXBN      LLGKIFSEFCIGK-
MNME_COXBR      LLGKIFSEFCIGK-
MNME_PSYCK      LLGKIFGSFCIGK-
MNME_PSYA2      LLGKIFGSFCIGK-
MNME_PSYWF      LLGRIFGSFCIGK-
MNME_ACIBY      LLGKIFGSFCIGK-
MNME_ACIBT      LLGKIFGSFCIGK-
MNME_ACIAD      LLGKIFGSFCIGK-
MNME_DICNV      LLDEIFSGFCIGK-
MNME_BORBR      LLGEIFSSFCIGK-
MNME_BORPA      LLGEIFSSFCIGK-
MNME_BORPE      LLGEIFSSFCIGK-
MNME_BORPD      LLGEIFSSFCIGK-
MNME_BORA1      LLGEIFSSFCIGK-
MNME_CUPPJ      LLGTIFTRFCIGK-
MNME_CUPNH      LLGTIFTRFCIGK-
MNME_CUPMC      LLGTIFTRFCIGK-
MNME_RALSO      LLGVIFSRFCIGK-
MNME_BURM7      LLGVIFSRFCIGK-
MNME_BURMA      LLGVIFSRFCIGK-
MNME_BURP6      LLGVIFSRFCIGK-
MNME_BURP0      LLGVIFSRFCIGK-
MNME_BURMS      LLGVIFSRFCIGK-
MNME_BURM9      LLGVIFSRFCIGK-
MNME_BURPS      LLGVIFSRFCIGK-
MNME_BURP1      LLGVIFSRFCIGK-
MNME_BURTA      LLGVIFSRFCIGK-
MNME_BURCA      LLGVIFSRFCIGK-
MNME_BURCH      LLGVIFSRFCIGK-
MNME_BURCC      LLGVIFSRFCIGK-
MNME_BURL3      LLGVIFSRFCIGK-
MNME_BURCM      LLGVIFSRFCIGK-
MNME_BURA4      LLGVIFSRFCIGK-
MNME_BURVG      LLGVIFSRFCIGK-
MNME_PARXL      LLGVIFSRFCIGK-
MNME_JANMA      LLGVIFSRFCIGK-
MNME_HERAR      LLGVIFSRFCIGK-
MNME_ACISJ      LLGVIFSSFCIGK-
MNME_ACIAC      LLGVIFSSFCIGK-
MNME_VEREI      LLGAIFARFCIGK-
MNME_RHOFT      LLGVIFSRFCIGK-
MNME_POLSJ      LLGEIFSRFCIGK-
MNME_POLNA      LLGEIFSKFCIGK-
MNME_LEPCP      LLGDIFGRFCIGK-
MNME_METPP      LLGDIFSRFCIGK-
MNME_NEIMA      LLGVIFSRFCIGK-
MNME_NEIMB      LLGVIFSRFCIGK-
MNME_NEIM0      LLGVIFSRFCIGK-
MNME_NEIMF      LLGVIFSRFCIGK-
MNME_NEIG1      LLGVIFSRFCIGK-
MNME_CHRVO      LLGVIFSRFCIGK-
MNME_AZOSB      LLGEIFSRFCIGK-
MNME_AROAE      LLGVIFSRFCIGK-
MNME_DECAR      LLGVIFSRFCIGK-
MNME_NITEU      LLGEIFSSFCIGK-
MNME_NITEC      LLGEIFSNFCIGK-
MNME_NITMU      LLGEIFSRFCIGK-
MNME_THIDA      LLGEIFGSFCIGK-
MNME_METFK      LLGEIFSRFCIGK-
MNME_POLAQ      LLGKIFSQFCIGK-
MNME_FRATF      LLGEIFSSFCIGK-
MNME_FRATH      LLGEIFSSFCIGK-
MNME_FRATO      LLGEIFSSFCIGK-
MNME_FRATT      LLGEIFSSFCIGK-
MNME_FRAT1      LLGEIFSSFCIGK-
MNME_FRATW      LLGEIFSSFCIGK-
MNME_FRATN      LLGEIFSSFCIGK-
MNME_FRAP2      LLGEIFSSFCIGK-
MNME_RUTMC      LLGEIFSSFCIGK-
MNME_VESOH      LLDEIFSSFCIGK-
MNME_XANAC      LLGKIFSSFCIGK-
MNME_XANC5      LLGKIFSSFCIGK-
MNME_XANOM      LLGKIFSSFCIGK-
MNME_XANOR      LLGKIFSSFCIGK-
MNME_XANCP      LLGKIFSSFCIGK-
MNME_XANC8      LLGKIFSSFCIGK-
MNME_XANCB      LLGKIFSSFCIGK-
MNME_XYLFA      LLGRIFSNFCIGK-
MNME_XYLFT      LLGRIFSNFCIGK-
MNME_BLOFL      LLEEIFRAFCIGK-
MNME_BLOPB      LLKRIFSTFCIGK-
MNME_BAUCH      LLKKIFSRFCLGK-
MNME_WIGBR      FLNEIFSNFCIGK-
MNME_BUCCC      LLDKIFSKFCIGK-
MNME_BUCAI      LLNHIFSSFCIGK-
MNME_BUCMP      LLKRIFSSFCIGK-
MNME_BUCAP      LLKRIFSTFCIGK-
MNME_BUCBP      LLSEIFSEFCIGK-
MNME_CAUVC      VLGRVFSTFCIGK-
MNME_CAUSK      VLDRVFSSFCIGK-
MNME_MARMM      ILDRVFSQFCIGK-
MNME_RHORT      VLDVIFRDFCIGK-
MNME_MAGSA      ILDVIFHEFCIGK-
MNME_PARL1      LLDVIFRDFCIGK-
MNME_NITWN      ILDSLFKEFCIGK-
MNME_NITHX      ILDSLFHDFCIGK-
MNME_BRASO      LLDVIFREFCIGK-
MNME_BRASB      LLDVIFREFCIGK-
MNME_BRADU      VLGAIFQKFCIGK-
MNME_RHOP5      VLDALFRDFCIGK-
MNME_RHOPS      VLGEIFSRFCIGK-
MNME_RHOP2      VLGEIFGRFCIGK-
MNME_RHOPA      VLGEIFGRFCIGK-
MNME_RHOPB      ILDVIFREFCVGK-
MNME_METPB      MLDRLFAGFCIGK-
MNME_METRJ      VLDRLFSGFCIGK-
MNME_METS4      MLDRLFSSFCIGK-
MNME_AZOC5      VLESLFRTFCIGK-
MNME_BEII9      ILGEIFARFCIGK-
MNME_RHIEC      LLDVIFSEFCIGK-
MNME_RHIL3      LLGVIFSEFCIGK-
MNME_SINMW      LLDVIFSEFCIGK-
MNME_RHIME      LLDVIFSEFCIGK-
MNME_AGRFC      LLGVIFSEFCIGK-
MNME_BRUC2      ILDVIFSQFCIGK-
MNME_BRUSU      ILDVIFSQFCIGK-
MNME_BRUA2      ILDVMFSQFCIGK-
MNME_BRUAB      ILDVMFSQFCIGK-
MNME_BRUME      ILDVIFSQFCIGK-
MNME_BRUO2      ILDVIFSQFCIGK-
MNME_BRUSI      ILDVIFSQFCIGK-
MNME_OCHA4      ILDVIFSQFCIGK-
MNME_BARHE      LLDIIFSEFCIGK-
MNME_BART1      LLDIIFSEFCVGK-
MNME_BARQU      LLDIIFSEFCIGK-
MNME_BARBK      LLDIIFSQFCIGK-
MNME_CHESB      LLDAIFSTFCIGK-
MNME_RHILO      MLDVIFSQFCIGK-
MNME_HYPNA      VLGAVFSKFCIGK-
MNME_GRABC      ILDHVFSSFCIGK-
MNME_ACICJ      VLDQVFSSFCIGK-
MNME_GLUOX      LLDAIFGQFCIGK-
MNME_ERYLH      MLDALFGRFCIGK-
MNME_NOVAD      MLDTLFGRFCIGK-
MNME_SPHWW      MLDGLFGRFCIGK-
MNME_SPHAL      MLDTLFGRFCIGK-
MNME_ZYMMO      MLDNLFSRFCIGK-
MNME_RUEST      LLDEIFSSFCLGK-
MNME_RUEPO      LLDEIFASFCLGK-
MNME_ROSDO      LLDEIFSSFCLGK-
MNME_RHOS4      LLGEIFASFCIGK-
MNME_RHOS1      LLGEIFASFCIGK-
MNME_RHOS5      LLGEIFSSFCIGK-
MNME_DINSH      VLDEIFANFCLGK-
MNME_JANSC      LLGEIFSRFCIGK-
MNME_PARDP      YLDEIFSSFCIGK-
MNME_RICAH      ILGEIFQNFCIGK-
MNME_RICFE      ILGEIFKNFCIGK-
MNME_RICRO      ILGEIFKNFCIGK-
MNME_RICRS      ILGEIFKNFCIGK-
MNME_RICCN      ILGEIFKNFCIGK-
MNME_RICM5      ILGEIFKNFCIGK-
MNME_RICCK      ILGEIFKNFCIGK-
MNME_RICPR      ILNEIFKNFCIGK-
MNME_RICTY      ILNEIFKNFCIGK-
MNME_RICB8      ILGEIFKNFCIGK-
MNME_RICBR      ILGEIFKNFCIGK-
MNME_ORITB      ILAEIFASFCIGK-
MNME_ANAMM      ILDNIFKRFCIGK-
MNME_ANAPZ      ILDDIFSKFCIGK-
MNME_EHRCJ      ILDNVFGKFCIGK-
MNME_EHRCR      ILDNVFGKFCIGK-
MNME_EHRRW      ILDNVFGKFCIGK-
MNME_EHRRG      ILDNVFGKFCIGK-
MNME_WOLTR      VLDDIFNNFCVGK-
MNME_WOLPM      ILSSVFSNFCVGK-
MNME_NEOSM      VLDEIFSSFCIGK-
MNME_PELUB      ILGSIFNDFCIGK-
MNME_DEIRA      VVDAVFRNFCVGK-
MNME_DEIGD      VVDAVFRNFCVGK-
MNME_THET8      VVARVFQNFCVGK-
MNME_THET2      VVARVFQNFCVGK-
MNME_HALHL      LLGRIFSGFCIGKE
MNME_MYXXD      LLDAIFQRFCIGK-
MNME_RHOBA      ILDRVFGRFCIGK-
MNME_AQUAE      LLGKIFSTFCIGK-
MNME_MAGMM      VLGMVFSSFCVGK-
MNME_KORVE      ILNLIFSTFCIGK-
MNME_SOLUE      ILNRIFSTFCIGK-
MNME_CHLTR      VLGEIFSKFCIGK-
MNME_CHLTB      VLGEIFSKFCIGK-
MNME_CHLT2      VLGEIFSKFCIGK-
MNME_CHLTA      VLGEIFSKFCIGK-
MNME_CHLMU      VLGEIFSKFCIGK-
MNME_CHLCV      ILGEIFSRFCIGK-
MNME_CHLFF      ILGEIFSRFCIGK-
MNME_CHLAB      ILGEIFSRFCIGK-
MNME_CHLPN      ILGEIFSKFCIGK-
MNME_PARUW      ILSAIFSKFCIGK-
MNME_OPITP      VLDELFATFCIGK-
MNME_BDEBA      IMDRVFKEFCIGK-
MNME_DESHY      LLDDIFSRFCIGK-
MNME_ALKMQ      LLDHIFQNFCIGK-
MNME_ALKOO      IIDHIFKNFCIGK-
MNME_CLOD6      LLDNIFHNFCIGK-
MNME_FINM2      VLNKIFSDFCIGK-
MNME_FUSNN      LLDHIFSNFCVGK-
MNME_CLOB1      IIDKIFSEFCLGK-
MNME_CLOBK      IIDKIFSEFCLGK-
MNME_CLOBH      IIDKIFSEFCLGK-
MNME_CLOBL      IIDKIFSEFCLGK-
MNME_CLOBM      IIDKIFSEFCLGK-
MNME_CLOK5      IIDKIFSQFCLGK-
MNME_CLOTE      IIDKIFSEFCLGK-
MNME_CLONN      IIDKIFSKFCLGK-
MNME_CLOAB      LIDKIFKDFCLGK-
MNME_CLOPE      LVNKIFAEFCCGK-
MNME_CLOP1      LVNKIFAEFCCGK-
MNME_CLOPS      LVNKIFAEFCCGK-
MNME_CLOB8      LLNKIFSEFCVGK-
MNME_LACP7      LVNTIFKEFCMGK-
MNME_THEP3      LINEIFERFCVGK-
MNME_THEPX      LINEIFERFCVGK-
MNME_CALS4      VINQIFERFCVGK-
MNME_HUNT2      VMHEIFSKFCLGK-
MNME_CARHZ      IINEIFSQFCVGK-
MNME_DESRM      LIDRIFSDFCIGK-
MNME_PELTS      LIDRIFADFCIGK-
MNME_CALS8      MVDRIFSMFCIGK-
MNME_SYNWW      VIERIFHDFCIGK-
MNME_NATTJ      LVDRIFNDFCIGK-
MNME_DESPS      VFDVIFSEFCLGK-
MNME_MOOTA      LLDRIFSDFCIGK-
MNME_DESAP      LLDRIFSHFCIGK-
MNME_ROSS1      LLHAIFSRFCIGK-
MNME_ROSCS      LLHAIFSRFCIGK-
MNME_CHLAA      LLDMIFSRFCIGK-
MNME_SYMTH      LLDQIFSRFCIGK-
MNME_HELMI      ILDKIFSSFCIGK-
MNME_GEOSL      ILDVIFDRFCIGK-
MNME_GEOMG      ILELIFQRFCIGK-
MNME_GEOUR      VLDLIFQRFCIGK-
MNME_PELPD      VLDLIFSSFCIGK-
MNME_PELCD      ILERIFTRFCIGK-
MNME_SYNAS      ILDRIFSSFCIGK-
MNME_SYNFM      LLDRIFSDFCIGK-
MNME_DESVH      ILDAIFASFCIGK-
MNME_DESVV      ILDAIFASFCIGK-
MNME_DESAG      ILNRIFDSFCIGK-
MNME_LAWIP      VLNRIFASFCIGK-
MNME_NOSS1      VLDRIFSRFCIGK-
MNME_TRIV2      VLDRIFSRFCIGK-
MNME_TRIEI      VLDIIFSRFCIGK-
MNME_ACAM1      VLDRIFSRFCIGK-
MNME_SYNY3      VLDRIFSRFCIGK-
MNME_MICAN      VLDRIFSRFCIGK-
MNME_SYNP2      VLDRIFSRFCIGK-
MNME_SYNE7      MLDLIFSRFCIGK-
MNME_SYNP6      MLDLIFSRFCIGK-
MNME_THEEB      VLTEIFSRFCIGK-
MNME_SYNJA      VLDQIFSRFCIGK-
MNME_SYNJB      VLDQIFSRFCIGK-
MNME_GLOVI      VLERIFSKFCIGK-
MNME_PROM1      LLDNIFSKFCIGK-
MNME_PROMT      LLDNIFSKFCIGK-
MNME_PROMA      LLDRIFSRFCIGK-
MNME_PROM3      VLDRIFSRFCIGK-
MNME_PROMM      VLDRIFSRFCIGK-
MNME_SYNSC      VLDRVFSRFCIGK-
MNME_SYNPX      VLDRVFSRFCIGK-
MNME_SYNS9      VLERVFSRFCIGK-
MNME_SYNPW      VLDRIFSRFCIGK-
MNME_SYNS3      VLDRIFSRFCIGK-
MNME_SYNR3      VLDRVFSRFCIGK-
MNME_PROMS      LLDNIFSKFCIGK-
MNME_PROM0      LLDNIFSKFCIGK-
MNME_PROM2      LLDNIFSKFCIGK-
MNME_PROM9      LLDNIFSKFCIGK-
MNME_PROM5      LLNNIFSKFCIGK-
MNME_PROMP      LLNNIFSKFCIGK-
MNME_CYACA      VLDAIFSKFCVGK-
MNME_CYAM1      TLNAIFSQFCIGK-
MNME_BACFR      VLQNIFAHFCIGK-
MNME_BACFN      VLQNIFAHFCIGK-
MNME_BACTN      VLQNIFQHFCIGK-
MNME_BACV8      TLQNIFQNFCIGK-
MNME_PARD8      VLGNIFRHFCIGK-
MNME_PORGI      TLHYIFAHFCIGK-
MNME_FLAJ1      LLGNIFANFCIGK-
MNME_FLAPJ      LLGNIFANFCIGK-
MNME_GRAFK      LLGNIFANFCIGK-
MNME_CYTH3      LLDNIFSKFCIGK-
MNME_SALRD      VLDQIFSRFCIGK-
MNME_CHLTE      VLNTIFDKFCIGK-
MNME_CHLPD      ILHAIFERFCIGK-
MNME_CHLPM      LLNTIFDQFCIGK-
MNME_PELLD      LLNTIFGQFCIGK-
MNME_CHLCH      ILSLIFERFCIGK-
MNME_BORAP      VLDNMFKNFCLGK-
MNME_BORBU      VLDNMFKNFCLGK-
MNME_BORBP      VLDNMFKNFCLGK-
MNME_TREPA      ILDALFEKLCVGK-
MNME_TREDE      ILDKVFSGFCVGK-
MNME_LEPBJ      VLGRIFSKFCIGK-
MNME_LEPBL      VLGRIFSKFCIGK-
MNME_LEPIN      VLGRIFSKFCVGK-
MNME_LEPIC      VLGRIFSKFCVGK-
MNME_LEPBA      ILGRIFSKFCVGK-
MNME_LEPBP      ILGRIFSKFCVGK-
MNME_UNCTG      ILDTIFSTFCIGK-
MNME_SULMW      ILSNIFSKFCIGK-
MNME_CARRP      IINSCFRNFCIGK-
                 .   *   * **