CLUSTAL format seed alignment for MF_00381

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

IHFB_HALHL      MTKSELIEAI----ASKQP-HLAHKDVEDAVKKMLEHMSETLANGKRIEIRGFGSFSLHH
IHFB_ALKEH      MTKSELIEVI----AGKQQ-HLAHKDVELAVKTLLEQMSETLASGERIEIRGFGSFSLHH
IHFB_METCA      MTKSELIESL----AGKYP-HLSPRDIEHAIKEMIGCMSEALAGGERIEIRGFGSFSLHH
IHFB_XANC8      MTKSELIEIL----ARRQA-HLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHY
IHFB_XANCP      MTKSELIEIL----ARRQA-HLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHY
IHFB_XANOM      MTKSELIEIL----ARRQA-HLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHY
IHFB_XANAC      MTKSELIEIL----ARRQA-HLKSDDVDLAVKSLLEMMGQALSDGDRIEIRGFGSFSLHY
IHFB_XYLFA      MTKSELIEIL----TKRQA-HLKSDDVDLAVKSLLEMMGGALSEGDRIEIRGFGSFSLHY
IHFB_XYLFT      MTKSELIEIL----TKRQA-HLKSDDVDLAVKSLLEMMGGALSGGDRIEIRGFGSFSLHY
IHFB_ECOUT      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ECO57      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ECOLC      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ECOL5      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ECO24      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SHIDS      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ECOHS      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SHIFL      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ECOLI      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SHIBS      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SHIF8      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ECOL6      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SHISS      MTKSELIERL----ATQQS-HIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SALTY      MTKSELIERL----ATQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SALCH      MTKSELIERL----ATQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SALPA      MTKSELIERL----ATQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SALPB      MTKSELIERL----ATQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SALTI      MTKSELIERL----ATQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_CITK8      MTKSELIERL----ATQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SALAR      MTKSELIERL----ASQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_ENT38      MTKSELIERL----ASQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_KLEP7      MTKSELIERL----ASQQS-HIPAKAVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHY
IHFB_SERMA      MTKSELIERL----AGQQS-HIPAKAVEDAVKEMLEHMAATLAEGERIEIRGFGSFSLHY
IHFB_SERP5      MTKSELIERL----AGQQS-HVPAKAVEDAVKEMLEHMAATLADGERIEIRGFGSFSLHY
IHFB_PECAS      MTKSELIERL----AGQQS-HIPAKVVEDAVKEMLEQMASTLAEGDRIEIRGFGSFSLHY
IHFB_DICD3      MTKSELIERL----AGQQS-HIPAKVVEDAVKEMLEQMATTLASGDRIEIRGFGSFSLHY
IHFB_YERPP      MTKSELIERL----AGQQS-HVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHY
IHFB_YERPN      MTKSELIERL----AGQQS-HVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHY
IHFB_YERPA      MTKSELIERL----AGQQS-HVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHY
IHFB_YERPE      MTKSELIERL----AGQQS-HVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHY
IHFB_YERPS      MTKSELIERL----AGQQS-HVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHY
IHFB_YERP3      MTKSELIERL----AGQQS-HVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHY
IHFB_YERE8      MTKSELIERL----AGQQS-HVPTKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHY
IHFB_SODGM      MTKSELIERL----AGQHA-HIQAKVVEDAVKEMLEHMATTLASGERIEIRGFGSFSLHY
IHFB_PHOLL      MTKSELIERL----AGQQS-HISAKTVEDAVKEILDHMAITLADGERIEVRGFGSFSLHY
IHFB_VIBCB      MTKSELIERL----CAEQT-HLSAKEVEDAVKDILEHMASTLESGDRIEIRGFGSFSLHY
IHFB_VIBPA      MTKSELIERL----CAEQT-HLSAKEVEDAVKDILEHMASTLESGDRIEIRGFGSFSLHY
IHFB_VIBVU      MTKSELIERL----CAEQT-HLSAKEIEDAVKDILEHMASTLESGDRIEIRGFGSFSLHY
IHFB_VIBVY      MTKSELIERL----CAEQT-HLSAKEIEDAVKDILEHMASTLESGDRIEIRGFGSFSLHY
IHFB_VIBCH      MTKSELIERL----CAEQT-HLSAKEIEDAVKNILEHMASTLEAGERIEIRGFGSFSLHY
IHFB_VIBC3      MTKSELIERL----CAEQT-HLSAKEIEDAVKNILEHMASTLEAGERIEIRGFGSFSLHY
IHFB_PHOPR      MTKSELIERL----CSQQT-HLSAKQVEDAIKEILEHMAGTLAEGDRIEIRGFGSFSLHY
IHFB_COLP3      MTKSELIEKL----ADKLS-HLSAKEVEKSIKEILELMAQSLSKGERIEIRGFGSFSLHY
IHFB_PSYIN      MTKSDLIERL----TSKHF-QLSVKEVEDSVKETLTLMANSLAQGERIEVRGFGSFSLHY
IHFB_ALIF1      MTKSELIEQL----CSKKP-QLSAKQVEDTVKEILEQMATTLEGGDRIEIRGFGSFSLHY
IHFB_SHESW      MTKSELIEKL----ATRQS-QLSAKEVESAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHEPC      MTKSELIEKL----ATRQS-QLSAKEVESAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHESM      MTKSELIEKL----ATRQS-QLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHESR      MTKSELIEKL----ATRQS-QLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHESA      MTKSELIEKL----ATRQS-QLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHEON      MTKSELIEKL----ATRQS-QLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHEB9      MTKSELIEKL----ATRQS-QLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHEB8      MTKSELIEKL----ATRQS-QLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHEB5      MTKSELIEKL----ATRQS-QLSAKEVEGAIKEMLEQMATTLESGDRIEIRGFGSFSLHY
IHFB_SHEDO      MTKSELIEKL----ATRQS-QLSAKEVESAIKEMLEQMATTLEGGDRIEIRGFGSFSLHY
IHFB_SHELP      MTKSELIEKL----ATRQS-QLSAKEVESAIKEMLEQMATTLEGGDRIEIRGFGSFSLHY
IHFB_SHEFN      MTKSELIEKL----ATRQS-QLSAKEVESAIKEMLEQMATTLETGDRIEIRGFGSFSLHY
IHFB_SHEAM      MTKSELIEKL----ATRQS-QLSAKEVESAVKEMLEQMATTLESGERIEIRGFGSFSLHY
IHFB_SHEPA      MTKSELIEKL----ATRQS-QLSAKEVEAAIKEMLEQMADTLETGDRIEIRGFGSFSLHY
IHFB_SHEHH      MTKSELIEKL----ATRQS-QLSAKEVEAAIKEMLEQMADTLEAGDRIEIRGFGSFSLHY
IHFB_SHESH      MTKSELIEKL----ATRQS-QMSAKEVESAIKEMLEQMAQTLEGGDRIEIRGFGSFSLHF
IHFB_PSEA6      MTKSELIERL----ADKAR-HVPSRDVELAIKEMLEQMAQTLQKGERIEIRGFGSFSLHY
IHFB_PSEHT      MTKSELIETL----AQQHA-HVPVKDVENAVKEILEQMAGSLSSSDRIEIRGFGSFSLHY
IHFB_AERHH      MTKSDLIEQL----AASRM-HMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHY
IHFB_AERS4      MTKSDLIEQL----AASRM-HMPAKDVEAAIKEILEQMASTLQNGDRIEIRGFGSFSLHY
IHFB_MARMS      MTKSELIELL----IDQQS-HLPVKDVEQAIKAMLEHMSDSLANGERIEIRGFGSFSLHY
IHFB_BUCAI      MIKSELFERI----AEQKI-NISNKMIERAAKEMLEHMIISLANGKRIEIRGFGSFSLHY
IHFB_BUCAP      MTKSELFERI----AERKA-HISNKIIECAVKEMLEYISISLSKGKRIEIRGFGTFSLHY
IHFB_BUCCC      MIKSELFERI----TEKKT-YIPAKIIEYVVKNILEYMSLSLEKGNRIEIRGFGSFSLHY
IHFB_PSEAB      MTKSELIERI----VTHQG-QLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHY
IHFB_PSEAE      MTKSELIERI----VTHQG-QLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHY
IHFB_PSEA7      MTKSELIERI----VTHQG-QLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHY
IHFB_PSEMY      MTKSELIERI----VTHQG-QLSSKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHY
IHFB_PSEPK      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSEPU      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSESM      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSEU2      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSE14      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSEP1      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSEPG      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSEPF      MTKSELIERI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSEE4      MTKSELIDRI----VTHQG-LLSSKDVELAIKTMLEQMSQCLATGDRIEIRGFGSFSLHY
IHFB_PSEU5      MTKSELIERI----VTQQG-LLSSKDVELAIKTMLEQMAQALATGERIEIRGFGSFSLHY
IHFB_HAHCH      MTKSELVEII----AQKQP-QLSIKDVELAVKTIIEYMSQSLSQGQRIEIRGFGSFSLHY
IHFB_MARHV      MTKSELVELI----ASKQT-QLSVKDVELAVKSIIEHMSQSLADGQRIEIRGFGSFSLHH
IHFB_CHRSD      MTKSELIEQI----AIRQP-ELSAKEVEAAVKIILEDITQSLSSGGRVEIRGFGSFSLHF
IHFB_SACD2      MTKSELIERI----AERQD-QLSAKDIELAVKLVLEYMSQALSTGERIEIRGFGSFSLHF
IHFB_HISS2      MTKSELIENL----ASTNP-NVPLKDIENAVKDILEQLSQALENGERIEIRGFGSFSLHF
IHFB_HAES1      MTKSELIENL----ASTNP-NVPLKDIENAVKDILEQLSQALENGERIEIRGFGSFSLHF
IHFB_ACTP2      MTKSELIENL----VSLNP-ALQVKSVEDGVKEILEQIMLFLERGERVEVRGFGSFSLHY
IHFB_HAEDU      MTKSELIEKL----IALNP-SLPEKAVEDGVKDILENIMLTLEQAKRVEIRGFGSFSLHY
IHFB_MANHA      MTKSELIESL----ASKNP-SLPIKMVEHCVKELLEQLTATLEEGERIEVRGFGSFSLHY
IHFB_HAEIG      MTKSELMEKL----SAKQP-TLPAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHH
IHFB_HAEIN      MTKSELMEKL----SAKQP-TLPAKEIENMVKGILEFISQSLENGDRVEVRGFGSFSLHH
IHFB_HAEI8      MTKSELMEKL----SAKQP-TLSAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHH
IHFB_HAEIE      MTKSELMEKL----SAKQP-TLSAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHH
IHFB_DICNV      MTKSELIERL----VMKYP-QLRAQDVEDTVKLMIERICHTLEKGDRVEIRGFGSFSLHY
IHFB_ACTSZ      MTKSELIELL----AKKNP-SISTKIVENSVKEILEQMSGSLENSDRIEIRGFGSFSLHY
IHFB_MANSM      MTKSELIESL----VEKNH-SISVKSVENAVKEILEHMSQALESGDRIEIRGFGSFSLHF
IHFB_PASMU      MTKSELIERL----VQKCH-AVAAKDVENAVKEILDQMSFALESGKRIEVRGFGSFSLHY
IHFB_AZOSB      MTKSELIAQL----AARFP-QLVAKDADYAVKMILDAMSDALARGDRIEIRGFGSFALNY
IHFB_DECAR      MTKSELIAQL----AERFP-QLVAKDADFAVKMILDAMSEALVRGDRIEIRGFGSFALNY
IHFB_RALSO      MTKSELVEKL----AARFP-QLLLRDADIAVKTILDAMSDALADGHRIEIRGFGSFGLNR
IHFB_JANMA      MTKSELIARL----AERYP-QLVAKDADYAVKTILDAMSDALATGQRIEIRGFGSFALNS
IHFB_HERAR      MTKSELIARL----AERYP-QLVAKDADYAVKTILDAMSDALATGQRIEIRGFGSFALNS
IHFB_NITMU      MTKSELIARL----AARHP-QLGTKDAELAVKVILDAMAKSLSQGQRIEIRGFGSFDLNY
IHFB_CHRVO      MTKSELIARLSERLAERNS-QLVYKDAELAVKTILDAMANNLAQGSRIEIRGFGSFDLNY
IHFB_NEIGO      MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNH
IHFB_NEIMB      MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNH
IHFB_NEIMA      MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNH
IHFB_NEIMF      MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNH
IHFB_NITWN      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKH
IHFB_NITHX      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVTALARGDRVELRGFGAFSVKH
IHFB_BRASB      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKH
IHFB_BRASO      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKH
IHFB_BRADU      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILEEIVAALARGDRVELRGFGAFSVKH
IHFB_RHOPS      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKH
IHFB_RHOP2      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKH
IHFB_RHOPB      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVAALARGDRVELRGFGAFSVKH
IHFB_RHOPA      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILDEIVDALARGDRVELRGFGAFSVKH
IHFB_RHOP5      MIKSELVQRI----AEHNP-HLYQRDVENIVNAILEEIVAALARGDRVELRGFGAFSVKH
IHFB_AZOC5      MIKSELVQKI----AEANP-HLYQRDVENIVNAILDQIVDALAQGDRVELRGFGAFSVKQ
IHFB_BRUO2      MIKSELVQII----ASRNP-HLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_BRUSI      MIKSELVQII----ASRNP-HLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_OCHA4      MIKSELVQII----ASRNP-HLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_BRUSU      MIKSELVQII----ASRNP-HLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_BRUC2      MIKSELVQII----ASRNP-HLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_BRUAB      MIKSELVQII----ASRNP-HLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_BRUA2      MIKSELVQII----ASRNP-HLFQRDVENIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_BRUME      MIKSELVQII----ASRNP-HLFQRDVVNIVGAVFDEITNALAEGNRVELRGFGAFSVKN
IHFB_RHILO      MIKSELVQII----ATRNP-HLFLRDVENIVGAIFDEITDALAEGNRVELRGFGAFSVKN
IHFB_CHESB      MIKSELVQTI----ANRNP-HLFLRDVENIVNAIFDEITEALAQGNRVELRGFGAFSVKN
IHFB_RHIL3      MIKSELVQIV----AARNP-HLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKN
IHFB_RHIEC      MIKSELVQIV----AARNP-HLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKN
IHFB_AGRFC      MIKSELVQIV----AARNP-HLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKN
IHFB_SINMW      MIKSELVQIV----AARNP-HLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKN
IHFB_RHIME      MIKSELVQIV----AARNP-HLYHRDVENIVNAVLDEITDALAAGNRVELRGFGAFSVKN
IHFB_ROSDO      MIRSELIQKI----ADENP-HLYQRDVERIVNTIFEEVTGAMARGDRVELRGFGAFSVKK
IHFB_RUEPO      MIRSELIQKI----ADENP-HLYQRDVERIVNTVFEEVTDAMARGDRVELRGFGAFSVKK
IHFB_RUEST      MIRSELIQKI----ADENP-HLYQRDVERIVNTVFEEVTNAMSRGDRVELRGFGAFSVKK
IHFB_RHOCA      MIRSELIAKI----AEENP-HLFQRDVEKIVNTIFEEIIEAMARGDRVELRGFGAFSVKK
IHFB_PARDP      MIRSELIQKI----SEENP-HLFQRDVERIVNTVFEEIIDAMARGDRVELRGFGAFSVKK
IHFB_RHOS1      MIRSELIQKI----ADENP-HLTQRHVERIVNTVFEEIIEALARGDRVELRGFGAFSVKA
IHFB_RHOS4      MIRSELIQKI----ADENP-HLTQRHVERIVNTVFEEIIEALARGDRVELRGFGAFSVKA
IHFB_DINSH      MIRSELIQIV----ADENP-HLYQRDVERIVNTVFEEIIEAMSNGDRVELRGFGAFSVKH
IHFB_JANSC      MIRSELIQKL----SDENP-HLYQRDVERIVNSIFEEVIDALAAGDRVELRGFGAFSVKK
IHFB_PARL1      MIKSELVARL----AQANP-HLYQRDVERIVSTIFDEISAALARGDRVELRGFGAFSVKS
IHFB_GLUDA      MTKSELIAEL----AAANP-HLLSRDVELIVQTIFSEISAALARGDRVELRGFGAFTVKK
IHFB_MARMM      MIKSELIDQL----AEANP-HLYHRDVERVVNTILDGITDALARGERVELRGFGAFSVRH
IHFB_CAUVC      MIKSELIARL----ANENP-HLTQKDVERVVGVILERMIGALEDGGRVELRGFGALSVRS
IHFB_RHIRD      MIKSELVDFV----AAKNP-YLHRRDAENAVDAVLDEITGALERGERVDIRSFGTFVVRH
IHFB_AGRT9      MIKSELVDFV----AAKNP-YLHRRDAENAVDAVLDEITGALERGERVDIRSFGTFVVRH
                * :*:*.  :           :            .  :   :  . *:::*.**:: :. 

IHFB_HALHL      RPARMGRNPKTGEPVALPAKYVPHFKPGKELRERVNSSRHQAPLRSQ-------------
IHFB_ALKEH      RPPRIGRNPKTGEPVALPGKYVPHFKPGKELRDRVNAGRHN-PIQS--------------
IHFB_METCA      RPPRVGRNPKTGESVHLPSRRVPHFKPGKELRDRVNSIKD--------------------
IHFB_XANC8      RPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPV-DMVDAAD-----------
IHFB_XANCP      RPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPV-DMVDAAD-----------
IHFB_XANOM      RPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPV-DMSDTTD-----------
IHFB_XANAC      RPPRLGRNPKTGESVALPGKHVPHFKPGKELRERVSSVVPV-DVADTAD-----------
IHFB_XYLFA      RPPRCGRNPKTGESVALPGKYVPHFKPGKELRERVASVVPLAECGDITE-----------
IHFB_XYLFT      RPPRCGRNPKTGESVALPGKYVPHFKPGKELRERVASVVPLGECGDITE-----------
IHFB_ECOUT      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ECO57      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ECOLC      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ECOL5      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ECO24      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SHIDS      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ECOHS      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SHIFL      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ECOLI      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SHIBS      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SHIF8      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ECOL6      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SHISS      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SALTY      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SALCH      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SALPA      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SALPB      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SALTI      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_CITK8      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SALAR      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_ENT38      RAPRTGRNPKTGDKVDLEGKYVPHFKPGKELRDRANIYGN--------------------
IHFB_KLEP7      RAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYEG--------------------
IHFB_SERMA      RAPRVGRNPKTGDKVELDGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SERP5      RAPRVGRNPKTGDKVELDGKYVPHFKPGKELRDRANIYG---------------------
IHFB_PECAS      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_DICD3      RAPRVGRNPKTGEKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_YERPP      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_YERPN      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_YERPA      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_YERPE      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_YERPS      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_YERP3      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_YERE8      RAPRVGRNPKTGAKVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_SODGM      RAPRIGRNPKTGDRVELEGKYVPHFKPGKELRDRANIYG---------------------
IHFB_PHOLL      RAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRVNIYD---------------------
IHFB_VIBCB      REPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNLGS---------------------
IHFB_VIBPA      REPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNLG----------------------
IHFB_VIBVU      REPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNIG----------------------
IHFB_VIBVY      REPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVHIG----------------------
IHFB_VIBCH      REPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNL-----------------------
IHFB_VIBC3      REPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNL-----------------------
IHFB_PHOPR      RAPRVGRNPKTGDKVELDGKYVPHFKPGKELRDRVNAAIAA-------------------
IHFB_COLP3      RAPRVGRNPKTGESVELSGKYVPHFKPGKELRERVNLSVA--------------------
IHFB_PSYIN      RAPRVGRNPKTGDRVELDGKYVPHFKPGKALRERVNAANA--------------------
IHFB_ALIF1      REPRLGRNPKTGDKVELDGKFVPHFKPGKELRERVNYS----------------------
IHFB_SHESW      RAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHEPC      RAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHESM      RAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHESR      RAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHESA      RAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHEON      RAPRTGRNPKTGSSVELEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHEB9      RAPRTGRNPKTGSSVDLEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHEB8      RAPRTGRNPKTGSSVDLEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHEB5      RAPRTGRNPKTGSSVDLEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHEDO      RAPRTGRNPKTGTSVELDGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHELP      RAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAINS--------------------
IHFB_SHEFN      RAPRTGRNPKTGTSVDLEGKYVPHFKPGKELRERVDAVNP--------------------
IHFB_SHEAM      RAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAVNV--------------------
IHFB_SHEPA      RAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAINT--------------------
IHFB_SHEHH      RAPRTGRNPKTGTSVELEGKYVPHFKPGKELRERVDAINT--------------------
IHFB_SHESH      RAPRTGRNPKTGTSVDLDGKYVPHFKPGKELRERVDAINA--------------------
IHFB_PSEA6      RAPRVGRNPKTGETVELDGKHVPHFKPGKELRERVNEDLIA-------------------
IHFB_PSEHT      RAPRTGRNPKTGETVELDGKHVPHFKPGKELRDRVNESIA--------------------
IHFB_AERHH      RAPRVGRNPKTGDKVELTGKYVPHFKPGKELRERVNIAE---------------------
IHFB_AERS4      RAPRVGRNPKTGDKVELTGKYVPHFKPGKELRERVNIIE---------------------
IHFB_MARMS      RAPRIGRNPKTGESVELSAKYVPHFKPGKELRELVNLPENSEINELN-------------
IHFB_BUCAI      RSSRIGRNPKTGKSVKLNEKYVPYFKPGKKLRDRAN--IHK-------------------
IHFB_BUCAP      RSSRIGRNPKTGKKIKLNERYIPYFKPGKQLRDRAN--YK--------------------
IHFB_BUCCC      RFARIGRNPKTGEKVYLKEKYVPHFKPGKQLRDRINNIYKKI------------------
IHFB_PSEAB      RAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE---------------------
IHFB_PSEAE      RAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE---------------------
IHFB_PSEA7      RAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE---------------------
IHFB_PSEMY      RAPRVGRNPKTGQSVRLDGKFVPHFKPGKELRDRVNEDES--------------------
IHFB_PSEPK      RAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEDEHEEAHT---------------
IHFB_PSEPU      RAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEDEHEEAHT---------------
IHFB_PSESM      RAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEDEEEGF-----------------
IHFB_PSEU2      RAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEDEEEGF-----------------
IHFB_PSE14      RAPRVGRNPKTGRSVSLDGKFVPHFKPGKELRDRVNEDEEEGF-----------------
IHFB_PSEP1      RAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEEDEAEA-----------------
IHFB_PSEPG      RAPRVGRNPKTGQSVSLEGKFVPHFKPGKELRDRVNEEDEAEA-----------------
IHFB_PSEPF      RAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNEEEEGEL-----------------
IHFB_PSEE4      RAPRVGRNPKTGQSVSLEGKYVPHFKPGKELRDRVNEEEHVPH-----------------
IHFB_PSEU5      RAPRVGRNPKTGQSVSLDGKFVPHFKPGKELRDRVNDD----------------------
IHFB_HAHCH      RAPRVGRNPKTGETVHLPAKYVPHFKPGKELRDEVNASLKAGY-----------------
IHFB_MARHV      RAARTGRNPKTGDAVQLPAKFVPHFKPGKELREQVNDSMKKGF-----------------
IHFB_CHRSD      REPRTGRNPKTGDPVDLQGKYVPHFKPGKELREQVNASRALGY-----------------
IHFB_SACD2      RAPRTGRNPKTGESVTLPGKYVPHFKPGKEMRDRVNESIQSEG-----------------
IHFB_HISS2      RQSRIGRNPKTGEKVDLSAKYVPHFKAGKELKERVNIYS---------------------
IHFB_HAES1      RQSRIGRNPKTGEKVDLSAKYVPHFKAGKELKERVNIYS---------------------
IHFB_ACTP2      RQPRVGRNPKTGESVKLDAKYVPHFKAGKDLKERVDLV----------------------
IHFB_HAEDU      RQPRIGRNPKTGASVKLDAKYVPHFKAGKDLKERVDLV----------------------
IHFB_MANHA      RQPRLGRNPKTGESVLLGAKYVPHFKAGKDLKERVDLL----------------------
IHFB_HAEIG      RQPRLGRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA---------------------
IHFB_HAEIN      RQPRLGRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA---------------------
IHFB_HAEI8      RQPRLGRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA---------------------
IHFB_HAEIE      RQPRLGRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA---------------------
IHFB_DICNV      RESRQGRNPKTGESVRVPAKSIPYFRAGKELRERVDEEINQ-------------------
IHFB_ACTSZ      RQPRLGRNPKTGESVKLDAKCVPHFKAGKELKERVDFKA---------------------
IHFB_MANSM      RQPRVGRNPKTGAQVKLDAKCVPHFKAGKELRERVDFNA---------------------
IHFB_PASMU      RQPRLGRNPKTGEQVKLDAKSVPHFKAGKELRERVDIYA---------------------
IHFB_AZOSB      RPPRVGRNPKSGEKVHVPEKYVPHFKAGKELRERVDIVE---------------------
IHFB_DECAR      RPPRVGRNPKSGEKVSVPAKWVPHFKAGKELRERVDQAI---------------------
IHFB_RALSO      RPPRVGRNPKSGEKVLVPEKRVPHFKAGKELRERVDRSLERQGDSSSEGEPVSLTAVKAA
IHFB_JANMA      RPPRIGRNPKSGDKVMVPEKRVPHFKPGKQLRERVDAMVGQPIIED--------------
IHFB_HERAR      RPPRIGRNPKSGDKVMVPEKRVPHFKPGKQLRERVDAMVGQPIIED--------------
IHFB_NITMU      RPPRVGRNPKSGEKVRVPEKYVPHFKAGKEMRERVD-----QKN----------------
IHFB_CHRVO      RPPRVGRNPKSGASVSVPEKYVPHFKAGKELRERVDLSLLEQTQA---------------
IHFB_NEIGO      RPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN----------------
IHFB_NEIMB      RPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN----------------
IHFB_NEIMA      RPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN----------------
IHFB_NEIMF      RPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN----------------
IHFB_NITWN      RPARAGRNPRTGEHVPVDQKSVPFFKTGKEMRERLNRDNATSEANA--------------
IHFB_NITHX      RPARAGRNPRTGEHVPVDQKSVPFFKTGKEMRERLNRENATSEASA--------------
IHFB_BRASB      RPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDNP--AGAADTDD----------
IHFB_BRASO      RPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDNPEGAAADDADD----------
IHFB_BRADU      RPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDHPD-PGAAD-------------
IHFB_RHOPS      RPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNREPGN--TDTGA------------
IHFB_RHOP2      RPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRETGD--TDTGA------------
IHFB_RHOPB      RPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNRDTGA--PDSGA------------
IHFB_RHOPA      RPARAGRNPRTGAHVPVDQKTVPFFKTGKEMRERLNRDSGDDAPTSDTA-----------
IHFB_RHOP5      RPARAGRNPRTGEHVPVEQKSVPFFKTGKEMRERLNRDNGISAETGA-------------
IHFB_AZOC5      REARTGRNPRTGKQVDVSSKVVPYFKTGKEMRERLNGAA---------------------
IHFB_BRUO2      RPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV---------------------
IHFB_BRUSI      RPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV---------------------
IHFB_OCHA4      RPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV---------------------
IHFB_BRUSU      RPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV---------------------
IHFB_BRUC2      RPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV---------------------
IHFB_BRUAB      RPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV---------------------
IHFB_BRUA2      RPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV---------------------
IHFB_BRUME      RPARSGRNPRTGETVDVEEKWVPFFKTGKKLRDRLNGAV---------------------
IHFB_RHILO      RPARTGRNPRTGESVEVEEKWVPFFKTGKELRERLNGGK---------------------
IHFB_CHESB      RPARTGRNPRTGESVHVEEKWVPFFKTGKELRERLNADE---------------------
IHFB_RHIL3      RPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADE---ED-------------
IHFB_RHIEC      RPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADE---ED-------------
IHFB_AGRFC      RPSRSGRNPRTGESVFVEEKWVPFFKTGKELRERLNPGMGDE---EDD------------
IHFB_SINMW      RPSRSGRNPRTGDSVFVEEKWVPFFKTGKELRERLNPGMNGNDNGEDD------------
IHFB_RHIME      RPSRSGRNPRTGDSVFVEEKWVPFFKTGKELRERLNPGMNDNNNGEDD------------
IHFB_ROSDO      RDARIGRNPRTGETVHVEEKHVPFFKTGKLLRDRLNGKS---------------------
IHFB_RUEPO      RDARIGRNPRTGDTVHVEEKHVPFFKTGKLLRDRLNGKA---------------------
IHFB_RUEST      RDARVGRNPRTGETVHVEEKHVPFFKTGKLLRDRLNGKEE--------------------
IHFB_RHOCA      RDARTGRNPRTGTSVAVDEKHVPFFKTGKLLRDRLNGGEE--------------------
IHFB_PARDP      RDARQGRNPRTGETVSVDEKHVPFFKTGKLLRERLNGLDE--------------------
IHFB_RHOS1      RDARVGRNPRTGEAVEVEDKKVPFFKTGKLLRDRLNTK----------------------
IHFB_RHOS4      RDARVGRNPRTGEAVEVEDKKVPFFKTGKLLRDRLNAK----------------------
IHFB_DINSH      RDARTGRNPRTGEAVAVEAKSVPFFKTGKLLRDRLNGKED--------------------
IHFB_JANSC      RDARIGRNPRTGESVSVEEKHVPFFKAGKLLRDRLNGHES--------------------
IHFB_PARL1      RPARTGRNPRTGEPVHVDEKSVPFFKTGKELRERLNNADIADDKLMVDDSDDGDD-----
IHFB_GLUDA      RDARTGRNPRTGEMVAVDEKVVPFFKAGKELRERVNNGAPAED-----------------
IHFB_MARMM      RPARVGRNPRTGESVAVKEKHVPFFKTGKELRERVDASRESNPEIA--------------
IHFB_CAUVC      RPARTGRNPRTGEAVDVRAKHVPFFKSGKELRARLNADGDE-------------------
IHFB_RHIRD      RPARSGRNPLNGNAVFIEEKWVPFFRAGKEIRDRLNTAEKSQGRGNL-------------
IHFB_AGRT9      RPARSGRNPLNGNAVFIEEKWVPFFRAGKEIRDRLNTAEKSQGRGNL-------------
                * .* **** .*  : :  : :*.*:.** ::                            

IHFB_HALHL      -----------------------
IHFB_ALKEH      -----------------------
IHFB_METCA      -----------------------
IHFB_XANC8      -----------------------
IHFB_XANCP      -----------------------
IHFB_XANOM      -----------------------
IHFB_XANAC      -----------------------
IHFB_XYLFA      -----------------------
IHFB_XYLFT      -----------------------
IHFB_ECOUT      -----------------------
IHFB_ECO57      -----------------------
IHFB_ECOLC      -----------------------
IHFB_ECOL5      -----------------------
IHFB_ECO24      -----------------------
IHFB_SHIDS      -----------------------
IHFB_ECOHS      -----------------------
IHFB_SHIFL      -----------------------
IHFB_ECOLI      -----------------------
IHFB_SHIBS      -----------------------
IHFB_SHIF8      -----------------------
IHFB_ECOL6      -----------------------
IHFB_SHISS      -----------------------
IHFB_SALTY      -----------------------
IHFB_SALCH      -----------------------
IHFB_SALPA      -----------------------
IHFB_SALPB      -----------------------
IHFB_SALTI      -----------------------
IHFB_CITK8      -----------------------
IHFB_SALAR      -----------------------
IHFB_ENT38      -----------------------
IHFB_KLEP7      -----------------------
IHFB_SERMA      -----------------------
IHFB_SERP5      -----------------------
IHFB_PECAS      -----------------------
IHFB_DICD3      -----------------------
IHFB_YERPP      -----------------------
IHFB_YERPN      -----------------------
IHFB_YERPA      -----------------------
IHFB_YERPE      -----------------------
IHFB_YERPS      -----------------------
IHFB_YERP3      -----------------------
IHFB_YERE8      -----------------------
IHFB_SODGM      -----------------------
IHFB_PHOLL      -----------------------
IHFB_VIBCB      -----------------------
IHFB_VIBPA      -----------------------
IHFB_VIBVU      -----------------------
IHFB_VIBVY      -----------------------
IHFB_VIBCH      -----------------------
IHFB_VIBC3      -----------------------
IHFB_PHOPR      -----------------------
IHFB_COLP3      -----------------------
IHFB_PSYIN      -----------------------
IHFB_ALIF1      -----------------------
IHFB_SHESW      -----------------------
IHFB_SHEPC      -----------------------
IHFB_SHESM      -----------------------
IHFB_SHESR      -----------------------
IHFB_SHESA      -----------------------
IHFB_SHEON      -----------------------
IHFB_SHEB9      -----------------------
IHFB_SHEB8      -----------------------
IHFB_SHEB5      -----------------------
IHFB_SHEDO      -----------------------
IHFB_SHELP      -----------------------
IHFB_SHEFN      -----------------------
IHFB_SHEAM      -----------------------
IHFB_SHEPA      -----------------------
IHFB_SHEHH      -----------------------
IHFB_SHESH      -----------------------
IHFB_PSEA6      -----------------------
IHFB_PSEHT      -----------------------
IHFB_AERHH      -----------------------
IHFB_AERS4      -----------------------
IHFB_MARMS      -----------------------
IHFB_BUCAI      -----------------------
IHFB_BUCAP      -----------------------
IHFB_BUCCC      -----------------------
IHFB_PSEAB      -----------------------
IHFB_PSEAE      -----------------------
IHFB_PSEA7      -----------------------
IHFB_PSEMY      -----------------------
IHFB_PSEPK      -----------------------
IHFB_PSEPU      -----------------------
IHFB_PSESM      -----------------------
IHFB_PSEU2      -----------------------
IHFB_PSE14      -----------------------
IHFB_PSEP1      -----------------------
IHFB_PSEPG      -----------------------
IHFB_PSEPF      -----------------------
IHFB_PSEE4      -----------------------
IHFB_PSEU5      -----------------------
IHFB_HAHCH      -----------------------
IHFB_MARHV      -----------------------
IHFB_CHRSD      -----------------------
IHFB_SACD2      -----------------------
IHFB_HISS2      -----------------------
IHFB_HAES1      -----------------------
IHFB_ACTP2      -----------------------
IHFB_HAEDU      -----------------------
IHFB_MANHA      -----------------------
IHFB_HAEIG      -----------------------
IHFB_HAEIN      -----------------------
IHFB_HAEI8      -----------------------
IHFB_HAEIE      -----------------------
IHFB_DICNV      -----------------------
IHFB_ACTSZ      -----------------------
IHFB_MANSM      -----------------------
IHFB_PASMU      -----------------------
IHFB_AZOSB      -----------------------
IHFB_DECAR      -----------------------
IHFB_RALSO      RQAGGHHAAGFPAEATPTLVMSR
IHFB_JANMA      -----------------------
IHFB_HERAR      -----------------------
IHFB_NITMU      -----------------------
IHFB_CHRVO      -----------------------
IHFB_NEIGO      -----------------------
IHFB_NEIMB      -----------------------
IHFB_NEIMA      -----------------------
IHFB_NEIMF      -----------------------
IHFB_NITWN      -----------------------
IHFB_NITHX      -----------------------
IHFB_BRASB      -----------------------
IHFB_BRASO      -----------------------
IHFB_BRADU      -----------------------
IHFB_RHOPS      -----------------------
IHFB_RHOP2      -----------------------
IHFB_RHOPB      -----------------------
IHFB_RHOPA      -----------------------
IHFB_RHOP5      -----------------------
IHFB_AZOC5      -----------------------
IHFB_BRUO2      -----------------------
IHFB_BRUSI      -----------------------
IHFB_OCHA4      -----------------------
IHFB_BRUSU      -----------------------
IHFB_BRUC2      -----------------------
IHFB_BRUAB      -----------------------
IHFB_BRUA2      -----------------------
IHFB_BRUME      -----------------------
IHFB_RHILO      -----------------------
IHFB_CHESB      -----------------------
IHFB_RHIL3      -----------------------
IHFB_RHIEC      -----------------------
IHFB_AGRFC      -----------------------
IHFB_SINMW      -----------------------
IHFB_RHIME      -----------------------
IHFB_ROSDO      -----------------------
IHFB_RUEPO      -----------------------
IHFB_RUEST      -----------------------
IHFB_RHOCA      -----------------------
IHFB_PARDP      -----------------------
IHFB_RHOS1      -----------------------
IHFB_RHOS4      -----------------------
IHFB_DINSH      -----------------------
IHFB_JANSC      -----------------------
IHFB_PARL1      -----------------------
IHFB_GLUDA      -----------------------
IHFB_MARMM      -----------------------
IHFB_CAUVC      -----------------------
IHFB_RHIRD      -----------------------
IHFB_AGRT9      -----------------------