CLUSTAL format seed alignment for MF_00382

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RK20_CHLRE      MTRVKRGNV-SRKRHK-KILNMSKGFRGAASTLFRTANQQNMKALRYSYRNRRQKKRDFR
RK20_TETOB      MTRVKRGNV-SRKRHK-KVLNLTKGFRGAASLLFRTANQQNMKALRYSYANRRKKKRNFR
RK20_STIHE      MTRVKRGIV-ARKRRK-KILNYTKGFRGAASKLFRTANQRYMKALKLSFVNRRKKKRDFR
RK20_OEDCA      MTRVKRGII-ARKRRQ-KILNMNKGFRGAASVLFRTANQRYMKSLRSAYENRHNKKRNFR
RK20_OLTVI      MTRVKRGYV-ARKRRK-KVLSLTKGFRGSSSVLFRSANQRNMKALKYAYRDRRKMKREFR
RK20_TUPAK      MTRIKRGFV-ARKRRK-KVLNLTKGFRGSSSVLFRPANQRKMKALRFSYRDRRQRKRDLR
RK20_PLETE      MTRVKRGNV-ARKRRK-KILKITKGFRGSSSTLFRTANQQQMKALRYSYRDRLTRKRNFR
RK20_NEPOL      MTRVKRGYV-ARKRRN-KILRANRSFRGTHSKLFRIANQQHMKALRYSYRDRACKKRDFR
RK20_OSTTA      MTRVKRGNV-ARKRRN-KILELNRGYRGSHSTLFRTAQQRTLKALTTAYTDRRKKKRTYR
RK20_CHLVU      MTRVKRGNV-ARKRRK-QVLNLASGFRGSSSRLFRTAQQQTMKALSYSYRDRQQKKREFC
RK20_PROWI      MTRVKRGNI-ARNRRN-EILDLAKGFRGSSSKLYRTAQQRTIKALTNSYKDRKNKKREFV
RK20_CHLAT      MTRVKRGYV-ARKRRK-RVLQLTQGFRGAHSVLFRTANQQNIKALRYASRDRARRKRDFR
RK20_MESVI      MTRVKRGNV-ARKHRN-KILNLAKGFRGAHSVLFRTANQQIIKSLRYAYRDRARKKRDFR
RK20_PHAAO      MTRVKRGYT-ARRRRK-KIRLFASTFIGAHSRLTRTTTQQRMRALISSHRDRSRKKRDFR
RK20_ILLOL      MIRVRRGYI-ARRRRT-KFFLFASTFRGAHSRLTRTTTQQKMRALVSAHRDRGRQKRDFR
RK20_POPTR      MTRIRRGYI-ARRRRT-KIRLFTSSFRGAHSRLTRTMIQQKIKALFSAYRDRDRHKRNFR
RK20_OENPA      MTRIRRGYI-ARRRRT-KTRFFASSWRGARGNLTRAIIQQRIRAWFSSHRDRTRQKRDFR
RK20_JASNU      MTRIKRGSI-ARRRRT-KAHSFASKFREAHARLTRAITQQQIRALFSADRDRDKQKIDFR
RK20_SPIOL      MTRVKRGYI-ARRRRK-KIRFFASSFRGAHSRLTRTIAQQKIRALVSAHRDRDRQKRDFR
RK20_CUSEX      MTRIKRGSI-ARRRRK-KMRFFASSFRGAHSRLTRTITQQGIRALVSAHRDSDRQKREFR
RK20_CUSOB      MTRIKRGSI-ARARRT-KIRFFASKFRGSHSRLTRSIIQQGIRAFVSSQRDRDKKKRDFR
RK20_EPIVI      MTRIKRGYI-ARRRIK-KFRLFASSFLNAHSRLTRTITQQKIRALVSSDRDRNNKKRKFR
RK20_TRACE      MTRISRGYI-ARRRRR-KTSLVVSSSGASLSK---LITQQEIKALASSDRDRDRQKRDFR
RK20_LOTJA      MTRIKRGYI-ARKRRT-KIRLFTSSFRGAHSRLTRTISQQKIKALVSAHRDRNRKKREFR
RK20_PELHO      MTRIKRGSI-ARRRRA-KTRLFASGARGAHSRLTRLIAQQTIRALASAHRDRDKKKRDFR
RK20_ORYSJ      MTRVPRGYI-ARRRRA-KMRSFASNFRGAHLRLNRMITQQVRRAFVSSHRDRVRQKRDFR
RK20_GNEPA      MTRVKRGFI-ARRRRN-KILTFASGFQGSHSKQFRVAKQQKKRALISAERDRMKRKRDFR
RK20_WELMI      MTRVKRGYI-ARRRRN-RIRLFASGFKGSHSKQFRAAKQQKQRALISAKGDRIKRKRAFR
RK20_PSINU      MTRVKRGYV-ARRHRN-RILALTSGFQGAHSKLFRTANQQGMKALTYAYRDRANCKRDFR
RK20_ANGEV      MTRVKRGYV-ARKHRK-NILKFTSGFQGAHSKLFRTANQQKMKALAYAQRDRNNRKRDIR
RK20_PHYPA      MTRVKRGYV-ARKRRK-NIFTLTSGFQGAHSKLFRTANQQGMRALASSYRDRNRRKRDLR
RK20_ANEMR      MTRVKRGYV-ARRRRK-NLFTLTSGFRGTHSKLFRTANQQGMRALVASYRGRVGRKKTLR
RK20_CYCTA      MTRIKRGYI-ARKRRK-KILAFASGFRGAHSKLFRTADQQKIRALVSAHRDRSKRKRDLR
RK20_ANTAG      MTRVKRGYV-ARRRRK-NILKLTSGFQGAHSTLFRTANQQGMKSLTSSHRDRGKRKRDFR
RK20_HUPLU      MTRVKRGSV-ARKRRK-NILKLASGFQGAHSTIFRTGNQQIIKALASSYRDRGKRKRDFR
RK20_ADICA      MTRVKRGSV-ARKYRK-NILDFVSGFRGAHSKLFRTANQRRGRSLAYAYVDKNNSKRAFR
RK20_CHAVU      MTRVKRGYV-ARKRRR-SILCQRAGSRGAHSILFRNAQQQNMKAMIYSHEHRKKRKRDFR
RK20_ZYGCR      MTRVKRGYV-ARKRHN-RILKLTAGSKRAHSRLVRPAQQQAMKTLAYSHRDRNRRKRDFR
RK20_STAPU      MTRVKRGYV-AVRRRN-RVLERAAGFRGAHSRLFRPAKQQVMKALVASKRDRDKRKRDFR
RK20_CHAGL      MTRVKRGYV-ARRRRK-KILHLTSGFYGAHSRLFRVANQKAIRALAYSHIDRAKRKRNMR
RK20_GRATL      MTRVKRGNV-ARKRRK-KVLKLAKGFRGSHAILFRTAKQQVLKALKYAYIGRKNRKRNYR
RK20_PYRYE      MSRVKRGNV-AKKRRA-KIFKLAKGFKGAHKCLFRTAKQQVLKALRYSYVGRKRKKRDFR
RK20_GUITH      MVRIKRGNI-ARKRHK-KILKLAKGFRGSHSKLFRIANQQVMKALRYGYHGRKRRKREFR
RK20_RHDSA      MPRIKRGNV-AVKRRK-KILKRAKGFRGTHSKLFRVANQQVMKALRYAYVGRKRKKREFR
RK20_THAPS      MVRVKRGNV-ARKRRK-KILQLAKGYRGAHSRLFRVANQQVMKALRYSYVGRKQKKRVFR
RK20_PHATC      MVRVKRGNV-ARKRRK-KILALASGYRGAHSVLFRVANQQVMKALRYSYVGRKQKKRIFR
RK20_EMIHU      MVRVKRGNV-AAKRRK-KILKLAKGFKGAHSRLFRTANGQVMKALVYSYVGRKRRKRDFK
RK20_CYACA      MVRVKRGNV-ARKRRK-KILKLASGFKGAHSKLFRVANQQVNKSLRYSYVGRKLKKRRFR
RK20_CYAPA      MTRVKRGNV-ARKRRK-KILKLASGFRGAHSRLFRVANQQVMKALRYAYNDRNKRKRDFR
RK20_CYAM1      MVRIKRGNV-ARKRRQ-KILKAAKGFYACTT--FRAANERVMKSWKASYRGRKLRKRDFR
RL20_SYNE7      MARVKRGNV-ARKRRN-KILKLAKGFRSGNSKLFRTANQRVMKALTNAYRDRRRRKRDFR
RL20_THEEB      MARVKRGNV-ARKRRK-KILKLAKGYRAGHSKLFRTANQVVMKALCNAYRDRRRRKRDFR
RL20_ACAM1      MTRVKRGNV-ARKRRK-KILKLAKGYRGSHSRLFRIANQQVMKALRNAYRDRRKRKRDFR
RL20_TRIEI      MPRVKRGNV-ARKRRK-KILKLAKGFRGAQSRLFKVANQRVMQALRNAYRDRRKRKRDFR
RK20_PAUCH      MARVKRGNI-ARKRRN-KILRLARGFRGSNGSLFRTANQRVMKALCNAYRDRRRRKRDFR
RL20_PROMA      MSRVKRGNV-ARKRRN-KILRLAKGFQGSNGSLFRTANQRVMKALCNAYRDRKRRKRDFR
RL20_PROM5      MARVKRGNI-ARKRRN-KILNLAKGFRGGNKNLFRTANQRVMKALCNAYRDRRRRKRDFR
RL20_SYNJA      -MRVKRGNV-ARKRRK-KILKLAKGFRGAGSKLFRTANQQVMKALRSAYRDRRRKKRDFR
RL20_GLOVI      MVRVKRGNV-ARKRRK-KILKLAKGFRGSHSKLFTAANQQVMKALRNAYRHRRTKKRDFR
RL20_ACIC1      MARVKRAVN-AQKKRR-VILEQASGYRGQRSRLYRKAKEQVLHSMAYSYRDRKARKGDFR
RL20_KINRD      MARVKRAVN-AQKKRR-TVLEQASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKARKGDFR
RL20_SALTO      MARVKRAVN-AQKKRR-TLLATASGYRGQRSRLYRKAKEQVLHSMQYSYRDRRDRKGDFR
RL20_SACEN      MARVKRAVN-AQKKRR-TILESAKGYRGQRSRLYRKAKEQMLHSMTYSYRDRRARKGDFR
RL20_CUTAK      MARVKRSVN-AKKKRR-EVLDQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFR
RL20_THEFY      MARVKRSLN-AKKKRR-VVLSQAKGYRGQRSRLYRKAKEQMLHSMTYAYRDRKDRKGQFR
RL20_BIFLO      MARVKRAVN-AHKKRR-VVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFR
RL20_RENSM      MARVKRAVN-AHKKRR-VILERAKGYRGQRSRLYRKAKEQLLHSFVYSYGDRRKRKGDFR
RL20_MYCLE      MARVKRAVN-AHKKRR-TVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDRRARKGEFR
RL20_RHOJR      MARVKRAVN-AQKKRR-SILEASSGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGDFR
RL20_CORJK      MARVKRSVN-AKKKRR-EVLKSAKGYRGQRSRLYRKAKEQMLHSKTYEFRDRKARKNEFR
RL20_TROWT      MVRVARSVN-ARKKRR-SILAAAKGYRGQRSRLYRKAKEQVLRSLVYAYRDRRKRKSNFR
RL20_SYNAS      MSRVKRSVT-AKKKRR-KIFKLAKGFFGARSRLLRTATEAVNRALNYAFRDRRVRKREFR
RL20_SULNB      -MRVKTGVV-RHRRHK-RLLKQARGFYSGRRKHFRKAKEQLERSLVYAYRDRRQKKRDFR
RL20_WOLSU      MPRVKTGTV-RRQRHK-KVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKRDFR
RL20_CAMJD      MARVKTGVV-RRRKHK-KVLKLARGFYSGRRKHFRKAKEQLERSLVYAYRDRRRKKTDFR
RL20_HELHP      -MRVKTGVV-RRRRHK-KILKLARGFYSGRRKHFRKAKEQLERSMCYAFRDRKQKKRDFR
RL20_SULDN      MPRVKTGVV-RRRRHK-KILKLAKGFYSGRRKHYRKAKEQLERSMYYSFRDRKQKKRDFR
RL20_DEIRA      MPRAKTGIV-RRRRHK-KVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFR
RL20_THET8      MPRAKTGVV-RRRKHK-KILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFR
RL20_AQUAE      -MRVK-GPS-SRRKKK-KILKLAKGYRGQRSRSYRRAKEAVMRALYYQYRDRKLRKREFR
RL20_RHOBA      -MRTTKGAA-RRQSKK-RLFKRAKGFRGGRGNLTRTVKETLLRSGAFAFRDRRVRKREFR
RL20_CHLPN      MVRATGSVA-SRRRRK-RILKQAKGFWGDRKGHIRQSRSSVMRAMAFNYMHRKDRKGDFR
RL20_PARUW      MVRATNAVA-SHRRKK-RLFKLAKGFVGDRKNHLRLTSGAVMRAMAYNYAHRKQKKRDFR
RL20_PELCD      MPRVKRGFK-ARRRRN-KVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFR
RL20_DESPS      MPRVTRGFK-ARRRRN-RVLKLAKGYRGARSRLFKTATEAVDRALCYAYRDRKQRKRDFR
RL20_ANADF      -MRVKKGYK-ARRRRN-RVLKLAKGFRGRRKNCYRRANQAVERALDYATRDRRQKRRDFR
RL20_MYXXD      -MRVKKGVK-ARRRRN-RILKLAKGYRGRRKNCYKRANEAVERALDYASRDRMQRKRDFR
RL20_SORC5      MPRVKRGFK-ARRRRN-RVLNQTEGYFLGRKNRFRQAVEVLRHAWEYGYISRKLKKRDFR
RL20_DESOH      -MRIKRGFK-ARHRRK-KILKLAKGFRGGHSKLFKTAKNTVDKALGYAYRDRKQRKRDFR
RL20_SYNFM      MPRVKKAVK-SRERRK-KILKLAKGYRGGRGKLIRSASETVDRALKFAYRDRKTRKRQFR
RL20_ALKOO      MARVKTGKT-AHKRHK-KVLKLAKGFRGARSKLFRPANQFVMKSLKYAYIGRKLRKRDFR
RL20_CLOD6      MARVKKAMN-ARKKHK-KILKLAKGFRGSRSKLYRPANTFVMKALKNAYIGRKLKKRDFR
RL20_CLOK5      MARVKRAVN-ARKHHR-KILKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKLKKRDFR
RL20_CLONN      MARVKRAMH-ARKKHK-KILKLAKGYYGRRSRTFKNANETVLRAMNFAYVGRKLKKRDFR
RL20_LACP7      MARIKGGLN-AKKKHN-KVLKLAKGYRGARSKQYRVAKQSVMRALTSAFAGRKERKRQFR
RL20_FERNB      -MRVKNAVN-SKKKKK-KILKFVKGFRGALRRRYSLAKQSYYRALKFAFDGRRNKKGNFR
RL20_THEM4      -MRVKNAVN-AKKKRK-KIMKAVKGYRGALSRRYRLAKQAYIKAKKHAYVGRKLKKRDYR
RL20_THEP1      -MRVKRAVH-AKKKRK-KYLKAAKGYRGALSRRYKLAKQMYVRSKWYSYVGRKLKKRDMR
RL20_PETMO      -MRIKRSVT-SHKKKK-KYIKAAKGYSGAVGRRYSLAKQQYYKSGKYSYAGRKNKKRDYR
RL20_PSELT      -MRIKRSVH-ARKKRREKFLKSAKGYRGAIKRRYRLAKQHYYRAKWYAYAGRKLKKRDFR
RL20_GEOTN      MPRVKGGPV-TRRRRK-KVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFR
RL20_STRMU      MARVKGGVV-SRKRRK-RVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQRKRDFR
RL20_LACAC      MPRVKGGTV-TRQRRK-KIMKLAKGYRGAKHMQFKAASTQLFVSYKYAFRDRRRRKSDFR
RL20_LACS1      MPRVKGGSV-TRQRRK-KIIKLAKGYRGAKHIQFKVAKQQVMKSYQYAFRDRRKTKSNFR
RL20_LACSS      MPRVKGGTV-TRKRRK-KILKLAKGYRGAKHLLFKSANTQVMVSYRYAFRDRRQRKRDFR
RL20_LISMF      MPRVKGGTV-TRKRRK-KIVKLAKGYYGSKHLLFKVANQAVMKSYQYAYRDRRQKKRDFR
RL20_LACBA      MPRVKGGTV-TRARRK-KVLKLAKGYRGSKHRLFKVAKDQVMKGRQYAFRDRKATKRNFR
RL20_OCEIH      MPRVKGGTV-TRQRRK-RVLKLAKGYYGSKRTLFKTAKQQVIKSGQYAYRDRRQKKRDFR
RL20_LEUMM      -MRVKGGTV-SRARRK-KFVKLAKGYRGQRRINYKVAKQQVYKSYLYAYRDRKNTKRNFR
RL20_KORVE      MPRVKRGTK-RRAKRK-KILERASGYYLTKSKLYRSAKESVERALKFAYTGRKQKKRQYR
RL20_SOLUE      MPRVKRGTH-RRASRK-KVLARASGYFLTKSKLYRAAMEAVDRGLKFAYVGRKRKKRDYR
RL20_RUBXD      MARASRSIH-ARKKRR-KLLKEARGYRGTKHTSYKRAKEQVWKSGVYAYVGRKQKKRDFR
RL20_DESAG      -MRVKRGMA-THRRHK-KYLKMAKGYRGGRSKLYRTAREAVERSLAYSTRDRKVRKREFR
RL20_LAWIP      -MRVKRGFS-AHRRHK-KYLEMAKGFRGGRSRLYRTAREAVERSLVYAYIGRKQRKREFR
RL20_ACHLI      MARVKNTPV-TRRRRK-KILKLAKGYFGSKSTLYRTAHEQVMRALQYAYRDRKQNKRNFR
RL20_ECOLI      MARVKRGVI-ARARHK-KILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFR
RL20_BUCAP      MARVKRGVT-AHARHK-KVLKQAKGYYGARSRIYRVACQAVIKAGQYAYRDRRQRKRQFR
RL20_BUCBP      MAHVKRGVI-ARARHK-KVLKQAKGYYGARSRTYRTARQAIIKAGQYSYRDRRQRKRYFR
RL20_BUCCC      MARVKRGVI-AHARHK-KVIKLAKGYYGARSRVYRVANQAVIKSGQYSYRDRRNKKRDFR
RL20_BAUCH      MARVKRGVV-ARARHK-KVLKLANGYYGARSRVYRVAFQAVLKAGQYCYRDRRCKKRQFR
RL20_WIGBR      MTRIKRGVS-SKFRHK-KILKKTKGYYGARSRSYRIAFQAFIKAGQYAYRDRKNKKRTFR
RL20_BLOFL      MVRVKNSVT-AHSRHK-KILKRATGYYGARSRTYRVAYQAIIKAGQYAYRDRKQKKRIFR
RL20_BLOPB      MTRVKNSVV-ARARHK-KILKQAAGYYGARSRTYRVAYQSVIKSGQYSYRDRRQKKRLFR
RL20_ALCBS      MARVKRGVQ-ARRRHK-KILKQAKGYYGARSRVFRVAVQAVTKAGQYAYRDRKVRKRQFR
RL20_XYLFT      MARVKRGVQ-ARRRHK-KILSLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFR
RL20_SACD2      MARVKRGVV-ARRRHK-KVLKAAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRVKKRNFR
RL20_LEGPH      MPRVKRGVT-AKARHK-KILDQAKGYYGARSRTYRVAKQAVIKAGQYAYRDRRQKKRQFR
RL20_COXBR      MPRVKRGVT-ARARHK-KVLTKAKGYYGARSRVFRVAKQAVIKAAQYAYRDRKQRKRQFR
RL20_FRAP2      MSRVKRGVT-ARARHK-KVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFR
RL20_DICNV      MARVKRGVQ-AHARHK-KVLKAAKGYYSARRKTFRVAKQAVIKAGQYAYRDRKTKKRQFR
RL20_HYDCU      MARVKRGVI-ARKRHN-KVLKQAKGYYGARKKIFRVAKQAVIKAGQYAYRDRRNKKRQFR
RL20_RALSO      MPRVKRGVT-ARARHK-KVIDAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFR
RL20_THIDA      MPRVKRGVT-ARASHK-KILDAAKGYRGRRKNVFRVANEAVMKAGQYQYRDRRQRKRQFR
RL20_CHRVO      MPRVKRGVT-ARARHK-KILALAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQKKRQFR
RL20_METPP      MPRVKRGVT-ARARHK-KVLELAKGFRGRRKNVYRIAKQAVMKAGQYAYRDRRNRKRVFR
RL20_NITOC      MPRVKRGVT-AHARHK-KVIAQAKGYRGRRKNVYRVANQAITRASQYAYRDRRQRKRQFR
RL20_VESOH      MARVSRGVQ-AHAKHK-KILKKAKGYYGARSKVYRIAKQAIIKAGQYAYRDRRQRRRQFR
RL20_ALKEH      MSRVKRGVT-ARAKHN-KVLKKAKGYYGARRKSFRIARQAVIKSGQYAYRDRRQRKRQFR
RL20_HALHL      MSRVKRGVT-NRAKHK-KVLKAAKGYYGMRGSAFRIARQQVIKSGQYAYAHRRLRKREFR
RL20_GRABC      MARVKRGVT-THARHK-KVLKASKGFFGRSSTNYRIALERLEKSLQYAYRDRRVKKRDFR
RL20_ACICJ      MARVKRGVT-THARHK-KVLKQSKGFVGRSSTNYRIALERLEKALRYAYRDRRNKKREFR
RL20_NEOSM      MARVKRGVQ-VRQRHK-KVIKQAKGFHGRSKNCYRIALRRLEKSWQYAYRDRKVRKRDFR
RL20_ANAMM      MARVKRGVT-ARARHK-KVVALAKGYRGRSKNCYRAALQRLEKALVYAYRDRRNRKRDFR
RL20_ANAPZ      MARVKRGVT-TRARHK-KVIALAKGYRGRSKNCYRAALQRLEKALAYAYRDRRARKRDFR
RL20_EHRRW      MARVKRGVT-TRARHK-KVIKLAKGYRGRSKNCYRVALQRVEKALQYAYRDRRNRKRFFR
RL20_WOLTR      MARVKRGVT-THARHK-KILNLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRNRKRDFR
RL20_RICTY      MTRAKSGKI-SKKRHK-KILKLAKGYRGRANSCFRVAIEKVEKALLYAYRDRRNRKRDFR
RL20_ORITB      MSRARSGKV-NKNRHK-KILKLAKGYRGRAKNCFRIAIQKVEKALQYSYRDRRNRKRQFR
RL20_RHORT      MSRATNAKT-NHARHK-KVLDLAKGYRGRNSTNFRIAIEKVEKGLQYAYRDRRAKKRNFR
RL20_MAGMM      MPRVKRGVT-SQARHK-KVLKAAKGYTGRNNSCFRIAKQKVEKGLQYAYRDRKNLKREMR
RL20_MARMM      MSRVTSGPA-TAKRHK-SVIKKAKGYYGRRKNTFRVAVQAVEKAGQYAYRDRRAKKRNFR
RL20_PARL1      MSRVKRGVT-AHARHR-KIIKKAKGYYGRRKNAFRTANQAVEKAGQYAYRDRRTRKRNFR
RL20_MAGSA      MARVKRGVT-THARHK-KILKLAKGYRGRSSTCFRVAIQKVEKALRYAYRDRRAKKRNFR
RL20_AZOC5      MARVKRGVT-SHAKHK-KVFKAAKGFYGRRKNTIRAAKSAVERSMQYNYRDRKVKKRTFR
RL20_RHILO      MARVKRGVT-SHAKHK-KVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFR
RL20_RHOPB      MARVKRGVT-AHAKHK-KVYKLAKGFRGRRKNTIRTAKAAVDKAGQYAFRDRKRKKRTFR
RL20_CAUSK      MARVKRGVT-AHAKHK-KVLEQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRKVRKRAFR
RL20_PELUB      MARVKRGVT-SHAKHK-KVLKAVKGQWGRRKSTIRVAKQAMEKAMQYAYRDRRTKKREFK
RL20_ZYMMO      MARVKRGTT-TRAKHN-RILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFR
RL20_PARDP      MARVKSGKI-THARHK-KVLDAAKGYYGNRSRNFRTATQAVDKANQYATRDRKTRKRNFR
RL20_HYPNA      MPRSR-AKVPAHARHK-KIIKQAKGFRGRRKNTFSNAAAAVWKAGEYAYVGRKVKKRSFR
RL20_CALS8      -MRIKNGVW-ARKRHK-KWLKLAKGYWGAKSRVFKQAHIAVMRSLRYAYIGRRLKKRDFR
RL20_CALS4      MARVKSGKV-TRRRHK-KILKLAKGYWGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFR
RL20_PELTS      MPRAKSSVV-SRKRHK-KILKLAKGYRGAKSKLYRIANQQVMKSLVYAYRDRKARKRDFR
RL20_DESRM      MPRAKSSVV-SRNRHR-KILKLAKGYRGSRSKLFRVANQAVMKGLFYAYRDRRQKKRDFR
RL20_HUNT2      MSRVKGGVR-TRARHK-KILKLAKGYFGAKSKNFRIANQAVMKSLVYAYRDRRARKRDFR
RL20_DESHY      MARVKRGVT-KHQRHK-KVLKLAKGFRGAKSKLYRPANEQVMKSLAYAYAHRRDKKGDFR
RL20_MOOTA      MARVKRGVT-KHQRHK-KILKLAKGYFGAKSKLFRPANEQVIKSLAYAYAHRRQRKGDFR
RL20_SYNWW      MPRVKGGVT-SHKRHK-KILKLAKGYRGSKSKLYRVANEQVMKSGQYAYIHRRLKKRDFR
RL20_SYMTH      MARTKPGKT-TRARHK-KILKLAKGYYGARSKHFRPANETVMKALFYARRDRRQRKRNFR
RL20_ROSS1      MARVKRGVM-VRKRHK-KLLEQAKGYRGSRSRRVKVARETVMKALWYAYRDRRNRKRDFR
RL20_CHLAA      MARVKRGIM-VRKRHK-KLLEQAKGYRGARSRHYKVAHEAVMHALADAYRDRRRRKRDFR
RL20_DEHM1      MARIKGGIA-THKRHK-KVLALTKGHASARHSLFKRAHESMVHAMSYAFAHRRARKGDMR
RL20_BDEBA      MARVKSGKT-NRARHK-KVLKRAKGYYSAGSRAYIHAVEKNDRGMAFAYRDRKVNKRNFR
RL20_FUSNN      -MRVKTGII-RRKRHK-RVLKAAKGFRGASGDAFKQAKQATRRAMAFATRDRKVNKRRMR
RL20_GRAFK      MPRSVNSVA-KRARRK-KVLKQAKGYFGRRKNVWTVAKNAVDKAMLYAYRDRKAKKRNFR
RL20_CYTH3      MPRSVPSVA-SRERRK-KILKLAKGYFGRRKNVWTVAKNAVERGKVFAYIGRKQKKRHFR
RL20_PORGI      MPRSVNHVA-SRAKRK-RILKLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRKSKKRNFR
RL20_SULMW      MPRSVNAVA-SKKHRK-KILNFAKGFYGARSKLYTVAKNAVEKSFKYSYFGRKNKKRNFR
RL20_SALRD      MPRATNKPA-TRRRRK-KILNKAKGYWGRRSKVYKVAKHAVEKGLQYAYRDRRQKKRRFR
RL20_CHLPM      MPKANNAVA-AKARRK-RVLKKAKGYWGSRGNVLTVVKHAVDKAEQYAYRDRRAKKRTFR
RL20_CHLTE      MPKSTNSVA-SKARRK-RILKKAKGYWGSRGNVLTVVKHAVDKAEQYAYRDRRVKKRNFR
RL20_CHLCH      MPKANNAVA-SRARRK-RILKKAKGFWGARGNVLTVVKHSVDKAEQYAYRDRRAKKRTFR
RL20_LEPIC      MPRAVNGTI-HKNRRR-RILKDAKGFRGARSKLYRTAKSAVMKAGQWAYRDRRAKKRDFR
RL20_TREDE      MSRSTSSDR-RITRRK-AILKQAKGFRGRRGTNFKAARDAVRKALLHSYVGRKDKKSDMR
RL20_TREPA      MSRSLSSNG-RVRRRK-RILKLAKGFRGRCGTNYKAAKDAVSKALAHSYVARRDRKGSMR
RL20_BORBP      MARAKNGTV-HVARRK-RILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKARKRDFR
RL20_MYCS5      MARVKGGTV-TRARRK-KWIKLAKGYFGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRNFR
RL20_MYCMO      -MRVKTGPI-TRKRRK-KWLKLAKGYFGHKSIGFKVAKQQVVKSWTYAFRDRKQVKRHFR
RL20_MYCH7      -MRVKGGSI-TRQRRR-RWLKLAKGYWGHKSIGFKTAKQAVVKSWTYAFRDRKQRKRDFR
RL20_MESFL      MARVKFGKV-TRARRK-RWIKRAKGYYGTKHSSYKKAHEQVVRSMAYAFIGRKQKKRDFR
RL20_MYCGE      -MRVKGTNT-TRIRRK-KWLKQASGSFGTRKASFKAAKQTVIQASKYAYRDRRQKKREFR
RL20_MYCPN      -MRIKGGKQ-TRVRRK-KWLKQASGSFGTRHASYKVAKQTVIQAAKYAYRDRRNKKRDFR
RL20_MYCGA      -MRVKGGPT-TRRRRK-KWLNQAEGTFGTRHASYKVAKQTVIKSAKYAFRDRKNKKREFR
RL20_UREP2      -MRVKGGSV-TRQRRK-RWLEKAEGSWGTRNTSYRIARQTVIRAAEYAYRDRRNKKRDFR
RL20_MYCPE      -MRVKTGPT-TRRRRK-SWLKKAEGAWGINSTSYRNAKQTVMQASKYAYRDRKNKKRDFR
RK20_EUGLO      MIRIKDNFKN-YKKHK-KILKLSKGFIGSNSKIFKISNQKIMKALYFSFSDRKKKKRSNK
RK20_EUGGR      MTRIKNNGIS-KKKRK-RKISKMKGWVGGHSKLFRTGNQQLMKARHYAFYDRKKKKNLNK
RK20_HELSJ      MTRVKRSIQR-IIKKE-FILKKAKGYKGGNSSLFKATKQTLLKAEKNAYRDRRYKQRLWN
RK20_BIGNA      MTRVKRGKI-TCRTRK-KRMQSVKGFRGAWSTLSRPAMQGSLRALNYSYKHRRKNVKTFR
                  :                                                         

RK20_CHLRE      RMWITRVNSAVRRYG------LNYSEFMNYLKTHKIQL------NRKVIAQLSICDPEAF
RK20_TETOB      RLWITRVNAAIRAYG------FNYSEFLYVLKNSNILL------NRKILAQLAICDPDTF
RK20_STIHE      SLWISRLNAAVRKNG------LNYNEFIFALKICNINL------NRKTLSQISICDPQTF
RK20_OEDCA      KLWISRLNSAVRLNG------LNYSQFVYMLKKSGIIL------NRKILSQLSICDPQIF
RK20_OLTVI      KLWITRINAATRMSN------MTYSTFIHKLKKANIVL------NRKLLAQLAVRDQQVF
RK20_TUPAK      SLWITRINSASRLYN------LNYSQFVYKLKQLNIHI------NRKWLAQLAIRDYKVF
RK20_PLETE      ALWIVRINAMARHLG------LNYNQFINNITKAQIII------NRKTLSQLAIYDSTIF
RK20_NEPOL      HLWITRINAVVRSYG------LNYSRFMHQLRLGNMVL------NRKVLSQLASLDPASF
RK20_OSTTA      RLWIRRINAAVRTKG------TTYSKFIHTMKKDQIML------NRKVLSQLVILDPPSF
RK20_CHLVU      GLWVTRLNAAARLYG------LNYTNFRHNLKKAGIQL------NRKVLSQVALRDKQAF
RK20_PROWI      KIWVSRINAAVRLSG------LNYSSFQNQLKFHKIRL------NRKICSQIALQDQESF
RK20_CHLAT      RLWITRINAGARKQG------LSYSQLMHRFKKCGILI------NRKVLAQLALLDTKTF
RK20_MESVI      KLWIARINAASRQNN------ISYSQLINQLKTSNILL------NRKILAQIALLDGPVF
RK20_PHAAO      RLWITRINAVTRED----RLFYSYSLFIHNLYKRQLLL------NRKILAQIALSNKNCF
RK20_ILLOL      RLWITRINAVTREN----GG--SYSRLIHDLYKGQLLL------NRKIPAQLAISNGNCL
RK20_POPTR      CLWVTRINAAIREN----GVSYSYSTLINNLYKRQLLL------NRKILAQLAILNRNCL
RK20_OENPA      RLWITRINAAIREN----GRSSIYSKLIHNLYKRQLFL------NRKMLAQLAILNRNCL
RK20_JASNU      RLWITRINALIREK----GVFHNYSKFINDLYKSQLLL------NRKILAQIAISNRNCL
RK20_SPIOL      RLWITRINAAIRER----GVYYNYSKFIHDLYKRQLLL------NRKILAQIAILNPNCI
RK20_CUSEX      RLWITRLNAVIRDM----GISYTYSKLIHDLYNNQLLL------NRKILSQIAISNSKCL
RK20_CUSOB      RLWITRLNAAIRAI----GVGYSYSASIHNLYKSQLIL------NRKILTQIAILNRNCL
RK20_EPIVI      SLWITRINAVIREE----GVSYSYKNFIYAQYKIQLLI------NRKILAQIAILNRNFF
RK20_TRACE      CLWITRINSVIREGWV--SYSYSYSKFIHDLYKRQLLL------NRKILAQIAIANKNFL
RK20_LOTJA      GLWISRINAGIGDNDKKKNIYYSYSNFMYNLYKKQLLL------NRKIVAQIAIFKGNCL
RK20_PELHO      RLWITRINGVIRQN----VLSYSYSQLITNLKKEQLLL------NRKMLAQIAISNRNCL
RK20_ORYSJ      RLWISRINAATRIH----KVFDNYSKLIHNLYKKELIL------NRKILAQVAVLNSNNL
RK20_GNEPA      RLWIARINAAVRFS------GLSYSQFVYCMYKNRLSQ------NRKNLAQIATLCTPFF
RK20_WELMI      RLWIARINAAVRFY------GVSYSKFVHCMYKNQLPL------NRKTLAQMATLHNPCF
RK20_PSINU      RLWITRINAAAREN------QITYNNMIHSLYMNQIHL------NRKILAQIAALDKDCF
RK20_ANGEV      RLWITRINAACRNN------GIVYNGIIHSMSEKKVHL------NRKILAQIAILDSNSF
RK20_PHYPA      RLWITRINAAARNN------GISYNKLIQNLYQNQILL------NRKMLAQIALLDTNCF
RK20_ANEMR      RLWIVRINAAVRSD------GISYNKLIQYLYKNQILL------NRKILAQIAILDRFAF
RK20_CYCTA      RLWITRINAAARNN------GVSYNKFIRYLYKRQLLS------NRRILAQIAVLDKNCF
RK20_ANTAG      RLWITRINAAARRS------KKSYHTLIQELYKRKILL------NRKMLAQIAILDTYCF
RK20_HUPLU      RLWITRINAAARNN------GVSYTKFIRHLYKNQVSS------NRKVLAQIAIFDTNSF
RK20_ADICA      RLWIARINAAARRD------GITYSSVIHSLYKNRIAL------NRKTLAQIATLDAYCF
RK20_CHAVU      SLWVTRINAAVREQ------GLSYNKFIFLLKTHKVLL------NRKMLAQIAILDITSF
RK20_ZYGCR      HLWIARINATVRQY------DVSYSQAISLIQKSKMLL------NRKMLAQIAVLDNSSF
RK20_STAPU      KLWITRINAAVRKQ------GMSYSRFIHQLYQSKILI------NRKMIAQIAVLDENGF
RK20_CHAGL      SLWICRINAVAREQ------NISYSYLIKSLKEKKILL------NRKMLAQLAVLDKPSF
RK20_GRATL      SLWIVRINAAVRPYG------ITYNEFIKQLKNSSIAL------NRKMLSQLAILDHSVF
RK20_PYRYE      RLWITRINAAAHNQG------MNYSTFISALKKENIAL------NRKMLAQLASNDIQTF
RK20_GUITH      SLWITRINAAVRIEG------TNYSCFINSLKRQHIAL------NRKMLAQLAVSDQNAF
RK20_RHDSA      SLWITRINAAARLNG------TKYSSVIHSLKESKIAI------NRKMLAQMAVADPDSF
RK20_THAPS      KLWISRINASSREKG------VTYSTLINSFKKSKINL------NRKMLAQIAVLDCSTF
RK20_PHATC      RIWISRINAASRLNG------ISYSQLIHRFKKSNIDL------NRKMLSQIAVLDTVAF
RK20_EMIHU      RLWICRVNAASRSHG------LNYSKLRNLMKQASLNI------NLKMLAQLVLFDKKAF
RK20_CYACA      RLWILRLNAASREEG------LNYSKLVNSLKLLRIQL------NRKSLSQLAMIDNDAF
RK20_CYAPA      ALWIARINASARLEG------MTYSKLMGSLKKLNIIL------NRKSLSQLAIYDKDAF
RK20_CYAM1      RLWITRLNAILP---------YKYSKFVHQLKQNQIAL------NRKMLYQLSCLDQKGF
RL20_SYNE7      RLWIARINAAARLHG------VSYSRLIGALKKADIQI------NRKMLAQLAVLDSAGF
RL20_THEEB      RLWIARINAAARQYG------MSYSQLMGALKKADIQL------NRKMLAQLAVLDAPAF
RL20_ACAM1      RLWIARINAATRQHG------VSYSKFMGQLKRADIQL------NRKMLAQLAATDPDSF
RL20_TRIEI      RLWITRINAAARQQG------MTYSQLICNMKRANIAI------NRKMLAQLAVLNPEAF
RK20_PAUCH      RLWIARINAASRLNG------LSYSRLVGSLKKANIKL------NRKMLALLALADPTSF
RL20_PROMA      RLWIARINAAARMNG------MSYSKLIGNLKKADIRI------NRKMLAQIAILDPTNF
RL20_PROM5      RLWIARINASARING------TNYSKLINGLKTSEIII------NRKMLAQLALNDPQSF
RL20_SYNJA      RLWIARINAATRAQG------LRYSEFIDGLKKGNIQL------NRKMLARLAFLDPEAF
RL20_GLOVI      SLWIVRINAQARTEG------LSYSRLIDGLHKADVAL------NRKMLAQLAVTDPEAF
RL20_ACIC1      RLWIQRINAAARAQG------ITYNRLIQGLKLAGVDV------DRKMLADLAVRDEATF
RL20_KINRD      RLWIQRINAAARAEG------MTYNRFIQGLKAAEIEV------DRRMLAELAVSDPAAF
RL20_SALTO      QLWIQRINAGARANG------LTYNRLIQGLKLAGIEV------DRKILADLAVNDAAAF
RL20_SACEN      KLWITRINAATRQNG------MSYNRFVQGLKAAGVEV------DRKILAELAVNDSQAF
RL20_CUTAK      SLWIQRINAASRAQG------MTYNRFINGLKNAGVEV------DRKMLAELAVSDINAF
RL20_THEFY      RLWIQRINAASRAHG------LTYNRFMQGLKAAGIEV------DRRMLAELAVNDAAAF
RL20_BIFLO      KLWIQRINAAVRAEG------ITYNRFIQGLRLAGIEL------DRRALAEIAVSDPNTF
RL20_RENSM      RLWIQRINAASRANG------LTYNRLIQGLKAASIEV------DRRMLSELAVNDAAAF
RL20_MYCLE      KLWISRINAAARAND------ITYNRLIQGLKAADVDV------DRKNLADIAISDPAAF
RL20_RHOJR      KLWITRINAAARAND------ITYNRLIQGLRLAEIEV------DRKNLAELAVSDAAAF
RL20_CORJK      KLWIQRINAGARQNG------MTYNRLIQGLRLAEIEV------DRKNLAELAVNDFDAF
RL20_TROWT      KLWIIRINAAARMEG------VTYNRFLQGLKLANIEL------DRRSLAHLAVHNPDTF
RL20_SYNAS      KLWIARINAASRAQG------LTYSRLIDGLRKSHVEI------DRKVLADIAVNDPRGF
RL20_SULNB      KLWIVRINAAARLND------LNYSRFMHGLKLANIEL------DRKILADMAMNSPESF
RL20_WOLSU      SLWITRINAACRINE------ISYSRFMHGLKLANIEL------DRKILADMAMNEPANF
RL20_CAMJD      RLWIVRINAACRLND------LSYSRFINGLKKAGIEL------DRKILADLAMNDVAAF
RL20_HELHP      RLWITRINAACKMNG------VSYSRFIHALKLANIEL------DRKTLADMAMNDINAF
RL20_SULDN      KLWIIRINAACRLNG------MNYSTFINGLSKAGIEL------DRKILADMAMNDAAAF
RL20_DEIRA      RLWIQRINAGARLHG------MNYSTFINGLKRANIDL------NRKVLADIAAREPEAF
RL20_THET8      RLWIVRINAACRQHG------LNYSTFIHGLKKAGIEV------DRKNLADLAVREPQVF
RL20_AQUAE      RLWIARINAAVRAYG------LNYSTFINGLKKAGIEL------DRKILADMAVRDPQAF
RL20_RHOBA      KLWIIRINAAVKQHG------LRYSEFIHGLNKAGIQL------DRKSLSEMAIHDAAGF
RL20_CHLPN      SLWIARLNVASRIHS------LSYSRLINGLKCANISL------NRKMLSEIAIHNPEGF
RL20_PARUW      SLWIMRLNAAARING------ISYSKFIYGLKKAQCEL------DRKVLADMAIRDPGSF
RL20_PELCD      ALWIARINASARENG------LSYSRLVHGLKKAEIAL------DRKILAELAVTDPAGF
RL20_DESPS      RLWITRINAGAKMND------INYSRFIGGLAKAGIEL------DRKVLANLAVLDAPAF
RL20_ANADF      ALWIVRINAAARQNG------TTYSRLLAGLKKAGVAI------DRKILADLALALPGDF
RL20_MYXXD      RLWIVRINAAARTVG------LSYSKLIAGLAKAKIGL------DRKVLSDMAIADPSGF
RL20_SORC5      RLWITRINAAARLNG------TTYSRLVSGLKKAGIAL------DRKILSEIAIHDPASF
RL20_DESOH      RLWIARINAAVRMHS------LSYSRFMHGLKKAGVEL------DRKVLAELAISDPSGF
RL20_SYNFM      SLWIMRINAAAREHD------LSYSRFMHALKKANIDM------DRKALAHLAVNDPAAF
RL20_ALKOO      KLWITRINAATRANG------LSYSKFMNGLKLAGIDM------NRKVLSEMAIYDKEGF
RL20_CLOD6      KLWIQRINAAARMNG------ISYSRLMNGLKLSGVEV------NRKMLSEMAIQDPEGF
RL20_CLOK5      KLWIVRINAAARING------LSYSKFMNGIKTAGINI------NRKMLSEIAINDPKTF
RL20_CLONN      RLWIARINAAARMNG------LSYSKFMNGIKLAGINM------NRKMLSEIAINDEKAF
RL20_LACP7      QLWIARINAAARMNG------LSYSKFMYGLKLAEVSV------NRKMLAELAVNDAEGF
RL20_FERNB      KIWITRINIAARNAG------LKYNELIHGLKLANVAI------NRKMLAELAVNDPESF
RL20_THEM4      KLWITRINIAARNEG------LKYNELIHGLKISGINI------NRKMLAELAVNDPESF
RL20_THEP1      KLWITRINIAARNEG------LKYSEFIHGLKLAGVSI------NRKMLSELAVNDPEAF
RL20_PETMO      NLWITRINAAARAQG------LKYNELIHGLKLANVDI------NRKMLSELAVNDPDGF
RL20_PSELT      SLWITRINIAARQNG------LKYSQLMHGLKLANISV------NRKMLAELAINDPPAF
RL20_GEOTN      KLWIARINAAARQNG------LSYSRLMHGLKLAGVEV------NRKMLADLAVNDQAAF
RL20_STRMU      KLWITRINAAARMNG------LSYSQLMHGLKLAEVEV------NRKMLADLAVNDAAAF
RL20_LACAC      KLWIARINAAARQND------ISYSKLMHGLKLAGVDM------NRKMLADIAYNDSKTF
RL20_LACS1      KLWIARINAAARQND------ISYSKLMHGLKLANVEV------NRKMLADLAITDAAAF
RL20_LACSS      KLWIARINAAARMND------MSYSQLMHGLRVAEIDM------NRKMLADLAVNDAAAF
RL20_LISMF      RLWIARINAAARMQD------LSYSKLMHGLKLAGIDI------NRKMLADLAVNDIASF
RL20_LACBA      KLWIARINAAARMNG------LSYSKLMHGLKLANIDV------NRKMLADLAVNDAAAF
RL20_OCEIH      KLWITRINAAARMHD------LSYSKLMHGLKVAGIDI------NRKMLSDLAISDEKAF
RL20_LEUMM      KLWIARINAAARMNG------LSYSKLMHGLTLAGVEL------NRKMLAEIAVSDFDTF
RL20_KORVE      SIWIVRIGAAAKLNG------LSYSRFISGLKKAGVEL------DRKMLSEIAIHDPQAF
RL20_SOLUE      RLWIVRINASCRAAG------LSYSKFVHGLKAAGLDL------NRKVLADVALHDDAAF
RL20_RUBXD      ALWIQRINAAARRHG------LSYSRFVHGLRLAGFDL------DRKVLADLAVSEPEAF
RL20_DESAG      KLWILRINAAARENG------VSYSKFIHGLALAGIEL------NRKVLADLAVREKEDF
RL20_LAWIP      KLWILRINAGAREHG------LSYSKMMAGLSQAGIML------NRKILAELAVKQKEDF
RL20_ACHLI      RLWISRINAGAVQNG------FKYSKLIHGLSLANVQL------NRKVLADLAISEPTVF
RL20_ECOLI      QLWIARINAAARQNG------ISYSKFINGLKKASVEI------DRKILADIAVFDKVAF
RL20_BUCAP      QLWITRINAAVRQSQ------MSYSSFMYGLKKASINI------DRKILSDIAIFDGFSF
RL20_BUCBP      KLWITRINAAVRENQ------ISYSKFMYGLKKASIAV------DRKMLSELAIFDNVSF
RL20_BUCCC      KLWIIRINAAVKNYN------LSYSKFIYGLKLSSINI------NRKILSEIAIFDKISF
RL20_BAUCH      KLWITRINAAVRQHG------ITYSCFMNSLKKASIHI------DRKILAEIAISDKVAF
RL20_WIGBR      KIWICRINSAVRKHG------LSYSCFMYKIKKLSIFI------DRKILSDLAVLNKEAF
RL20_BLOFL      QLWISHINAVARQYG------LSYNNLINNLYKSSIYI------NRKMLAELATSDQVAF
RL20_BLOPB      RLWINRINAASRKYG------MSYNHLINGLQKCNVCI------NRKMLADIAIFDRETF
RL20_ALCBS      RLWIVRINAAARLNG------LSYSRLINGLKKASIDI------DRKVLADIAVRDQATF
RL20_XYLFT      SLWIVRINAAARMNG------LSYSRFMNGILKCGITL------DRKMLADIAVHDPAGF
RL20_SACD2      ALWITRINAQSRAEG------LSYSRLIAGLKKASIAL------DRRVLADLAIHDKTAF
RL20_LEGPH      ALWITRINAQARECG------LSYSRLIDGLKKASIEL------DRKILADMAVHDKVAF
RL20_COXBR      ALWIVRINAAAREHG------LSYSRLINGLMKASVAI------DRKNLAELAVYDKAAF
RL20_FRAP2      SLWIVRINAAARQHD------ISYSQLINGLNKAGVEL------DRKALAELAVYNKDAF
RL20_DICNV      QLWIIRINAGARIHG------LSYSRFINGLKKSGIAV------DRKILSELAVYDKSVF
RL20_HYDCU      RLWIARINAAARLNG------MTYSRFISGLNKAGVEV------DRKVLSDIAVHDAAAF
RL20_RALSO      ALWIARINAGAREHG------LSYSKFMNGLKKASIEL------DRKVLSDMAIHDKVAF
RL20_THIDA      ALWIARINAAARQHG------LTYSVFMNGLSRAEIGV------DRKVLSDIAIFDKDAF
RL20_CHRVO      QLWIARINAAARENG------LPYSKFMNGLKKAAIEI------DRKVLADLAVFDKPAF
RL20_METPP      RLWIARINAASRSHG------ITYSRFIAGIKKAAIDI------DRKMLAELAVNDPAAF
RL20_NITOC      ALWIVRINAAARECG------LSYSRLISGLKRAAIEI------DRKVLADLAVRDKAAF
RL20_VESOH      RLWIVRINAEARNNG------LSYSRMINGMSKAGIEI------DRKVLSDIAIFDKVAF
RL20_ALKEH      ALWIQRINAGARQHG------LSYSRFINGLQQAGVDL------DRKVLADLAVNDKAAF
RL20_HALHL      SLWIQRINAAARQHG------LSYSRLMNGLQQAGIEV------DRKQLADLAVHEPQSF
RL20_GRABC      ALWIQRINAAVREHG------MTYSVFINGLKKAEIDM------DRKVLAAIAFDDAAAF
RL20_ACICJ      ALWIQRINAAVREQG------MTYSQFIAALKAANIEL------DRKVLAAMAFDDPAGF
RL20_NEOSM      SLWIQRINAAVRSFG------LVYSVFMKGLKAAGVDV------NRKVLSELAISQPSAF
RL20_ANAMM      RLWIVRINAAARQWG------IKYSQLMKGMALCGIEL------NRKMLAEMAVNDKAAF
RL20_ANAPZ      SLWIVRINAAAGLYG------LRYSEFMHGVSLCSIGL------NRKMLAEMAVRDKGAF
RL20_EHRRW      SLWIMRINAAVRQYG------LLYSDFIYGLSLANITL------NRKILADMAVHNKDNF
RL20_WOLTR      SLWIIRINAAAREHG------LTYGRFMHGLALAGVDL------NRKILAEMAVNYKDDF
RL20_RICTY      GLWIQRINAAVREHG------LIYSQFMGALKKAGINI------DRKVLAELAVNNNDGF
RL20_ORITB      ALWIQRINAAVRQYD------MTYSQFINGLKQANITV------DRKVMANLAVHNADSF
RL20_RHORT      SLWIQRINAGAREQG------LTYSQFINGLIRAGIEL------DRKILADLAVTEPAAF
RL20_MAGMM      RLWIARINAATRLHG------MSYSQFMNGLNKAGIEL------DRKVLSELAISEPESF
RL20_MARMM      ALWIQRINAGARQHE------MSYSVFMNGLTKAGIEV------DRKVLADIAMHEPDAF
RL20_PARL1      ALWIQRINAGVREHG------LTYSRFIDGLAKAGIEV------DRKVLSDIAIHEPEAF
RL20_MAGSA      ALWIQRINAGSRAYG------LPYSRFMDGLKKAGIAL------DRKVLSDIAIREPDAF
RL20_AZOC5      ALWIQRINAGVRELG------MTYGRFIDGLGKAGIEV------DRKVLSDIAVHEPETL
RL20_RHILO      ALWIQRINAATHEHG------LTYGRFIDGLNKAGIEI------DRKILSDMAIHEPQAF
RL20_RHOPB      ALWIQRINAAVRPLG------MTYSVFINGLAKSGVMV------DRKVLSDLAITEPAAF
RL20_CAUSK      SLWIQRINAGARVEG------FTYSQFIHGLDVAGIVI------DRKVLSDIAGQDPVAF
RL20_PELUB      SLWIQRINAGVRSEG------ITYSKFINGLTKCGIKL------DRKILAEIAYDSPEAF
RL20_ZYMMO      ALWIQRINAAVRAEG------LTYGVFMYGLKLAGLDL------DRKVLADLAMNESAAF
RL20_PARDP      ALWIQRINAAVRAVDAE----MTYSRFIAALAKAGIEV------DRKVLADLAVHEPEAF
RL20_HYPNA      SLWIQRINAAVRIHDEN----LNYSTFINGLTKAGIEV------DRKVMADLAVREPEAF
RL20_CALS8      RLWITRINAAARQNG------LSYSKFINGLKKAGISL------NRKVLADMAINDQKAF
RL20_CALS4      RLWITRINAAARAYG------ISYSRFINGLKKAGIEI------NRKMLSEMAIHDEKAF
RL20_PELTS      KLWITRINAAARMNG------ISYSRLMNGLKLAGVDI------NRKMLADMAVNDAQAF
RL20_DESRM      KLWIARINAATRMNG------LSYSRFINGLKKAGVEV------NRKMLADLAVNDAKAF
RL20_HUNT2      KLWITRINAAARMNG------LSYSKFMNGLKKSGIAL------NRKMLAEMAVNDAEAF
RL20_DESHY      KLWIARINAAARLNG------LSYSRMMNGLKIAGVSV------NRKMLADLAINDAAAF
RL20_MOOTA      KLWIARINAAARMNG------INYSRLVNGLKKAGVEI------NRKMLADMAVNDQAGF
RL20_SYNWW      KLWIARINAAARNNG------TTYSRMVHGLKVAGVDI------NRKLLAELAISDPQGF
RL20_SYMTH      RLWIARINAAARMNG------LTYSQFINGLNKAGVQL------NRKVLADIAVNDAAGF
RL20_ROSS1      RLWIVRINAAARMHG------MSYSRFMNGLKRAGIDL------DRKILADMAVRDPAAF
RL20_CHLAA      RLWIMRINAAARLHG------TTYSRLINSLKQANIEI------DRKMLADLAVRDPQAF
RL20_DEHM1      RLWITRINAAARAEG------LTYGELMSGLKTAGIDI------NRKVLADMAVSDSVAF
RL20_BDEBA      TLWNQRINAAARLNG------TTYSRLIGGLIKAGIQV------DRKILADLAINDAAAF
RL20_FUSNN      QLWITRINSAARMNG------VSYSVLMNGLKKAGILL------DRKVLADIALNNATEF
RL20_GRAFK      SLWIMRINAAARQEG------LSYSQFMGKLKTSDIGL------NRKVLADLAMNSPEAF
RL20_CYTH3      GLWIQRINAGTRQHG------LSYSQFIGALDKANIKL------NRKVLADLAMNDPEAF
RL20_PORGI      ALWIQRINAAARLEG------MSYSRLMGALHANGIEI------NRKVLADLAMNHPEAF
RL20_SULMW      KLWIKRINAAARENG------ISYSNLIFLIRKNNIKL------NRKCLADLAMKNNSSF
RL20_SALRD      RLWITRINAATRQHD------VSYSQFMGQYRKSDLDM------NRKVLADLAVHDPDAF
RL20_CHLPM      ALWIMRINAAARLNG------TTYSRLVDAMNKKSVEI------DRKAMAEIAVKDPEAF
RL20_CHLTE      SLWIMRINAAARQNG------VSYSRLMDAIHKKNIEI------DRKALAEIAVKDPAAF
RL20_CHLCH      SLWIMRINAAARLNG------TTYSQLINGMAKNNIQI------DRKALAEIAVKDAAAF
RL20_LEPIC      KLWIIRINAAARENG------LSYSVFMNSLKKLGIHM------DRKSLAELAFNDREVF
RL20_TREDE      QIWITRINAAVRAEG------ITYSRFIAGMNKAGIQL------NRKALSNMAIEDPTAF
RL20_TREPA      RLWISRINASVRTQG------LSYSRFMNGLLQAGIAL------NRKVLSNMAIEDPGAF
RL20_BORBP      RLWISRISAALSDTG------ISYSRFIEGLLKSNIKI------NRKILSNLAIEDAEAF
RL20_MYCS5      KLWIARINAAVRPHG------LSYSQFINGLKKAEVLI------NRKMLSELAINQPQTF
RL20_MYCMO      RLWIARINAATRAQG------VSYSLFINGLKKSNIQI------NRKMLSEIAIHQPKVF
RL20_MYCH7      KLWISRINAAARNQG------ISYSQLMYKIKQSNIEI------NRKMLAEMAVHHQSDF
RL20_MESFL      KLWIVRINAAVRPYG------LSYSKFMNGLKLANIDV------NRKMLSELAISNPEQF
RL20_MYCGE      SLWILRLNAALRAQG------MTYSVFINELKKAKIVI------NRKVLSELAIKEPNKL
RL20_MYCPN      SLWILRLNAALREQG------MTYSVFINLLKKHNIEI------NRKVLSELAIKEPSKF
RL20_MYCGA      ALWIQRLNGALRELG------VTYSVFINLLKKQQITI------NRKMLSEIAIHDHEAF
RL20_UREP2      KLWISRINAAVRELG------YTYSQFMNALVKANVVTKDGQGLNRKMLSELAINNPEAF
RL20_MYCPE      KLWIARINAAIRKEN------YTYSAFMHKLKQKEIAI------NRKMLSELAIQNPEEF
RK20_EUGLO      KIWINRINYFLKNYFFN---NFNYNKIINKIKLNKICI------NKKILSEIIINDYKTI
RK20_EUGGR      TLWITRINGGLKYYLTI---NEKYNIFVSFLRKTKTYV------NKKLLSEINVRDSKSF
RK20_HELSJ      KIWITRINGLLRSY------NINWSVIKFFLKNNKIKL------NRHILSQVSIYDPVLL
RK20_BIGNA      RLSIVRFNALIRNSG----LPFTYNRLIALINLYNCRL------NRNVLSQLGIRDSNTF
                 :   :..               :                    : .    :       :

RK20_CHLRE      MQLLLF----------------------------
RK20_TETOB      FKFIMSIQ--------------------------
RK20_STIHE      NLLYDTLKPLLIKHLNTK----------------
RK20_OEDCA      HELYSYIASKNLI---------------------
RK20_OLTVI      QQLFSYIEGV------------------------
RK20_TUPAK      DELIKTVF--------------------------
RK20_PLETE      SSLISIKNN-------------------------
RK20_NEPOL      NRLIRAT---------------------------
RK20_OSTTA      STLTK-----------------------------
RK20_CHLVU      EQLILLVKD-------------------------
RK20_PROWI      TKLLDLII--------------------------
RK20_CHLAT      NQLVFYTDL-------------------------
RK20_MESVI      SQIVMESNS-------------------------
RK20_PHAAO      DIISNKIIN-------------------------
RK20_ILLOL      YMISNEIGSAN-KEIGRSSSE-------------
RK20_POPTR      YLISNDMIK-------------------------
RK20_OENPA      YMISNQILKEV-DWQESATILEI-----------
RK20_JASNU      YMIANEIIKKV-GFESAVII--------------
RK20_SPIOL      YMIYNEIIKKEDCKKYLEII--------------
RK20_CUSEX      YMISNGILQI------------------------
RK20_CUSOB      YMISNEILKSG-V---------------------
RK20_EPIVI      YMIFNEIRKEA-DLKEYIRIN-------------
RK20_TRACE      YLISNQILKSEVNWKESAGVI-------------
RK20_LOTJA      FMIANEIIT-------------------------
RK20_PELHO      SIIYSAIIILETKEEGQK----------------
RK20_ORYSJ      YTISNKIKIIN-----------------------
RK20_GNEPA      STFSQKIMT-------------------------
RK20_WELMI      STISQKIVA-------------------------
RK20_PSINU      VEILRIIK--------------------------
RK20_ANGEV      FGIVKEIGM-------------------------
RK20_PHYPA      STIMKKINE-------------------------
RK20_ANEMR      FLIIRSIQREEG----------------------
RK20_CYCTA      STIINNIIE-------------------------
RK20_ANTAG      STLLGD----------------------------
RK20_HUPLU      STILKKLSSGESIRYRNFSPEFYSGEVRTP----
RK20_ADICA      SMIIEKVSKIKI----------------------
RK20_CHAVU      KKLLLVIN--------------------------
RK20_ZYGCR      NSILTAAIYST-----------------------
RK20_STAPU      TSIVNNI---------------------------
RK20_CHAGL      IKLINTHLN-------------------------
RK20_GRATL      KTILDSCTPGFK----------------------
RK20_PYRYE      QTVLETVKN-------------------------
RK20_GUITH      KQLTKITH--------------------------
RK20_RHDSA      VKVLSSAKAS------------------------
RK20_THAPS      YKLIDDAKSPN-----------------------
RK20_PHATC      KTLLNA----------------------------
RK20_EMIHU      SQIIDLVNK-------------------------
RK20_CYACA      KRLVASSRV-------------------------
RK20_CYAPA      MEILKTIP--------------------------
RK20_CYAM1      EQLYGLSLTRNHLIC-------------------
RL20_SYNE7      KAIVDLALKA------------------------
RL20_THEEB      ATVIQTARAL------------------------
RL20_ACAM1      SKIVELAGKA------------------------
RL20_TRIEI      AKVLELASLAKK----------------------
RK20_PAUCH      ANVVVVAKS-------------------------
RL20_PROMA      QKVVADVKK-------------------------
RL20_PROM5      EKIVSAVSK-------------------------
RL20_SYNJA      TQVVEAARQARAS---------------------
RL20_GLOVI      AEVARVAKSARPV---------------------
RL20_ACIC1      AALVGTARDALSVAPTSS----------------
RL20_KINRD      GALVRTAKAALPVAPVAAEGTAA-----------
RL20_SALTO      AAIVEKARAAVAEEGTGGAAAQAA----------
RL20_SACEN      AALVDVARQNL---PEGAA---------------
RL20_CUTAK      NSLVEVAKANQPQ--NAAA---------------
RL20_THEFY      AALVETAKKAIPAPSESAA---------------
RL20_BIFLO      KTIVDAAKAALPEDVNAPV----EA---------
RL20_RENSM      AGLVKLAKAALPADTSAPV----AN---------
RL20_MYCLE      TALVEVARSGLPEDVNVPS--GEAA---------
RL20_RHOJR      AGLVALAKAALPADVNAPA--GEAA---------
RL20_CORJK      TALCEAAKAALPEDVNAPA----AS---------
RL20_TROWT      SALVGVAKDSLKNAPDPVAAARLRGTSSRT----
RL20_SYNAS      SEIVLLAKGETVS---------------------
RL20_SULNB      TKIADASKAALTK---------------------
RL20_WOLSU      AKIVEAAKKAL-----------------------
RL20_CAMJD      AKIAEAAKKAL-----------------------
RL20_HELHP      NAVLASVKNKLK----------------------
RL20_SULDN      SAVAASAKAALK----------------------
RL20_DEIRA      KALVDASRNARQ----------------------
RL20_THET8      AELVERAKAAQG----------------------
RL20_AQUAE      EQVVNKVKEALQVQ--------------------
RL20_RHOBA      KQVCDKVKETLAA---------------------
RL20_CHLPN      AEIANQAKKALEATV-------------------
RL20_PARUW      AAIVGFAKEALA----------------------
RL20_PELCD      TAIADKAKAQLQ----------------------
RL20_DESPS      TKLSVIAKEANA----------------------
RL20_ANADF      AAVVKAAKA-------------------------
RL20_MYXXD      AAVANIAKAA------------------------
RL20_SORC5      GAVAKLASPAAAK---------------------
RL20_DESOH      SKVVAVAAEQQ-----------------------
RL20_SYNFM      AKLARIAKEAA-----------------------
RL20_ALKOO      AQLVETAKQKLNA---------------------
RL20_CLOD6      AKLAEVAKAKLA----------------------
RL20_CLOK5      TELVQVAKAQLNV---------------------
RL20_CLONN      ADLVEVAKKQLNA---------------------
RL20_LACP7      KALVEVAKSKLA----------------------
RL20_FERNB      KEYVNIAKAALGK---------------------
RL20_THEM4      KEYVNIAKQAIGK---------------------
RL20_THEP1      REYVKIAKEALAS---------------------
RL20_PETMO      NEYVNIAKQSLAESVQ------------------
RL20_PSELT      SEYVKIAKEQLQKEAVK-----------------
RL20_GEOTN      AQLADLAKANLNK---------------------
RL20_STRMU      TVLADAAKEKLGK---------------------
RL20_LACAC      AQLADTAKKALN----------------------
RL20_LACS1      TALVDEAKKALAAE--------------------
RL20_LACSS      TSVVEAAKAALNK---------------------
RL20_LISMF      NTLADSAKKALAK---------------------
RL20_LACBA      AALAEQAKTALAA---------------------
RL20_OCEIH      AQLVSQAKEALK----------------------
RL20_LEUMM      TKLADQAKAALSSDNVLVQARTAATTDTTVSVER
RL20_KORVE      AVLAEQAKAAQPAAA-------------------
RL20_SOLUE      RNLAELAKSALAVKESARLALEKE----------
RL20_RUBXD      GAVAAQAKNALEGRPVERRVELGGAGR-------
RL20_DESAG      AKLAELVKSKLS----------------------
RL20_LAWIP      AKLVEIAKNQVH----------------------
RL20_ACHLI      ASYVELAKDAIANPAKYQVK--------------
RL20_ECOLI      TALVEKAKAALA----------------------
RL20_BUCAP      NILIKKAKEALL----------------------
RL20_BUCBP      CSLIKSSKDALTSIELNKNL--------------
RL20_BUCCC      KKLVDYSKNALSI---------------------
RL20_BAUCH      ATLAEKAKSILCVT--------------------
RL20_WIGBR      SELIKKVKSIS-----------------------
RL20_BLOFL      LNLVNNIKIHSK----------------------
RL20_BLOPB      SALIDKAKINCEHT--------------------
RL20_ALCBS      SALAEKAKASLTA---------------------
RL20_XYLFT      TALAEKAKTMLAA---------------------
RL20_SACD2      AAIVAKAQEALAA---------------------
RL20_LEGPH      AAIAEQAKAALAG---------------------
RL20_COXBR      GKLAEKAKQALGG---------------------
RL20_FRAP2      AAVVEKAKAALA----------------------
RL20_DICNV      ATLAEKAKAALSA---------------------
RL20_HYDCU      SAIVEKAKAALA----------------------
RL20_RALSO      AAIVNQVKANVA----------------------
RL20_THIDA      AKIVDQVKAKLAA---------------------
RL20_CHRVO      AQIVEKAKASLAA---------------------
RL20_METPP      GSIVEKVKAQLA----------------------
RL20_NITOC      TTIAEQAKVALSD---------------------
RL20_VESOH      AKIVDQVKQALSV---------------------
RL20_ALKEH      GALAEKAREALAA---------------------
RL20_HALHL      AALAERAQGALSN---------------------
RL20_GRABC      AEIVKKVQGALAA---------------------
RL20_ACICJ      TAIVEAAKAVRG----------------------
RL20_NEOSM      GEIVNKAKAAL-----------------------
RL20_ANAMM      EKVVSAVAGTCGYACAVNQQDK------------
RL20_ANAPZ      EKIAHAAAQACGRTCVVAQSNS------------
RL20_EHRRW      KQIVDLTKEALTKSRVG-----------------
RL20_WOLTR      TKLAETVSSKLAENS-------------------
RL20_RICTY      TSIVQQSKAYI-----------------------
RL20_ORITB      VHLVELTKKSLAKTA-------------------
RL20_RHORT      ASLVAQAKAALDTTAEQAA---------------
RL20_MAGMM      GTLVEQAKAAL-----------------------
RL20_MARMM      KALVDQARAALG----------------------
RL20_PARL1      KALVEQAQAALK----------------------
RL20_MAGSA      KSLVEKAQAALQ----------------------
RL20_AZOC5      KALVEKAQAALAA---------------------
RL20_RHILO      AALVAKAKVALEYLKNTT-PNAFESAVA------
RL20_RHOPB      LAIAEKAKAALAA---------------------
RL20_CAUSK      KAIADKVRAALAA---------------------
RL20_PELUB      KTIVQKAQSALN----------------------
RL20_ZYMMO      GAIIAQVKSALPEGARVAA---------------
RL20_PARDP      AAVVAQAKAAA-----------------------
RL20_HYPNA      GALVAQAKAALA----------------------
RL20_CALS8      AELVEIAKKQING---------------------
RL20_CALS4      AELVNIAKQQLNA---------------------
RL20_PELTS      GRLVEIAKAKL-----------------------
RL20_DESRM      GQLVELAKSKLA----------------------
RL20_HUNT2      AQLVEKVKAVI-----------------------
RL20_DESHY      TELVNVAKAQVSAK--------------------
RL20_MOOTA      NRLVDIAKEKLGLGA-------------------
RL20_SYNWW      TQLAELAKRSVQ----------------------
RL20_SYMTH      SALVEKAKASL-----------------------
RL20_ROSS1      SRVVEQARQAV-----------------------
RL20_CHLAA      ARIVEQAQAAVTA---------------------
RL20_DEHM1      AAVAAKAAAAKAN---------------------
RL20_BDEBA      TALCKHALA-------------------------
RL20_FUSNN      TKLVEAAKSAL-----------------------
RL20_GRAFK      KAIVEKVK--------------------------
RL20_CYTH3      KAVVEKVKK-------------------------
RL20_PORGI      RAIVAKVKN-------------------------
RL20_SULMW      KKMIKKFQILYLDL--------------------
RL20_SALRD      EQIVDHVME-------------------------
RL20_CHLPM      TTLVKAIID-------------------------
RL20_CHLTE      SLIVKTALD-------------------------
RL20_CHLCH      SAIVQAANK-------------------------
RL20_LEPIC      NSLVEKIKVAG-----------------------
RL20_TREDE      KAVVEASKKALGV---------------------
RL20_TREPA      QTVIDASKKALGGGAC------------------
RL20_BORBP      KKIVLEIRR-------------------------
RL20_MYCS5      EKLVKLVQGK------------------------
RL20_MYCMO      DKILTKVKSHLK----------------------
RL20_MYCH7      ENIVKLAIAKSA----------------------
RL20_MESFL      KLLVDASNKALTSK--------------------
RL20_MYCGE      NLIINTIKKPTNKPTVAKT---------------
RL20_MYCPN      NLIVQKVKSEQPKAAKPAALGN------------
RL20_MYCGA      KKLVKEVTGK------------------------
RL20_UREP2      NQLVDKVMK-------------------------
RL20_MYCPE      KKFVHSVMLK------------------------
RK20_EUGLO      YKLKNMLT--------------------------
RK20_EUGGR      SHLSKPIMKSTGINL-------------------
RK20_HELSJ      QIYILFYINTLCRI--------------------
RK20_BIGNA      TKLMKFYYH-------------------------