CLUSTAL format seed alignment for MF_00383

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TF2B2_SACS2      ---------------------------------------MKCPYCKTDNAITYDVEKGMY
TF2B_AERPE       ---------------------------MASEIPYDESPSGEESGEIKCKNIVTDPVRGLK
TF2B_SACSH       -------------------------------MLYLSEENKSVSTPCPPDKIIFDAERGEY
TF2B1_SACS2      -------------------------------MLYLSEENKSVSTPCPPDKIIFDAERGEY
TF2B_SULAC       ---------------------------------MVEQSKVPSSSLCPPDKIIFDEERGEY
TF2B_METJA       -MVWLMEALKTKENETTKEKKLTTKVEKSEKKEENVREEEIVCPICGSKEVVKDYERAEI
TF2B_METTL       MATKPVVKEKKKLENKKEIYKLIEHNDSSNKNVILEKEEELICPMCGSKNIIKDYERAEI
TF2B_METTH       -----------------------------MRSDVSEIEKETKCPECGSDDLRGDYERAEI
TF2B_ARCFU       -------------MAEVEKVREKEVEKEVERKEIEREEDVEVCPECGSPRLIRDYRRGEF
TF2B1_THEAC      ---------------------------MVENTKKKKVEEIERCPECGSTNLIRDYEHGEL
TF2B2_THEAC      --------------------------------MTVEGETPKRCPECNSEHLIRDYEHGEL
TF2B_PYRAB       ------------------------------------MTKQRVCPVCGSTEFIYDPERGEI
TF2B_PYRHO       ------------------------------------MTKQKVCPVCGSTEFIYDPERGEI
TF2B_PYRFU       ------------------------------------MNKQKVCPACESAELIYDPERGEI
TF2B2_THEKO      ---------------------------------MRGISPKRVCPICGSTEFIYDPRRGEI
TF2B1_HALSA      ------------------------------------MQHPHRCPECDG---TIRETDTEH
TF2B5_HALSA      --------------------MTTSEPYERAFDEDIQRGTTEPCPECGG---PVRTNSAET
TF2B2_HALSA      -------MSDSTIRTYSSDQR----QTDNDETVSTPDEDVLTCPECGG-QVIDDEEHGES
TF2B6_HALSA      -------MTDARMRSR-----------EQERTDETESESTDGCPECGG-LVVNDEEHGES
TF2B2_HALVD      ------MSDTITTRTYSADAKSRDVRPRESERDETQQDETQVCPECSG-HLVTDEEHGET
TF2B4_HALSA      ------MTNQRTTRDGSHGTE-----SVPTQRSRESTDEDHGCPECNG-DLVTDEDRGET
TF2B3_HALSA      ------MERATREREK------------EQREQAQTNDEAQQCPECNSANVITD--QSER
TF2B7_HALSA      ------MTRSTRQRERETA--------AKQEEEEDSEEGVRECPECGSDNLVKSSDRAEL
                                                                             

TF2B2_SACS2      VCTNCASVIEDSAVDPGPDWRAYNAKDRNEKERVGSPSTPKVHDWGFHTIIGYGRAKDRL
TF2B_AERPE       ICADTGEIIGEDIIGTESDVKAYTPEERQQKTHYGGPLKYSHHYMGVEASLEHPRDHGPK
TF2B_SACSH       ICSETGEVLEDKIIDQGPEWRAFTPEEKEKRSRVGGPLNNTIHDRGLSTLIDWKDKDAMG
TF2B1_SACS2      ICSETGEVLEDKIIDQGPEWRAFTPEEKEKRSRVGGPLNNTIHDRGLSTLIDWKDKDAMG
TF2B_SULAC       ICTETGEVIEERIIDQGPEWRAFTPEEKEKRSRVGGPLNQTIHDMGISTVIDWKDKDAMG
TF2B_METJA       VCAKCGCVIKEKLFDIGPEWRAFDHEQKIKRCRVGAPMT><IHDKGLSTVIDWRNKDSYG
TF2B_METTL       VCETCGCVLQQNLFDVGPEWRAFDHEQRVKRSRVGPPMTYTIHDKGLSTVIDWRNKDSYG
TF2B_METTH       VCGKCGLVIDDNLVDMGPEWRAFDHEQRDKRTRVGAPITYTIHDKGLSTMIDWRNKDIYG
TF2B_ARCFU       ICQDCGLVIEDTYIDAGPEWRAFDSEQRDKRSRVGAPVTYTIHDKGLSTIIDWSNKDYYG
TF2B1_THEAC      VCGECGAVIEDAYIDQGPEWRAFDSEQNESRARAGSPMTYTIHDKGLSTDISWKNKDSYG
TF2B2_THEAC      ICADCGAVIEDAYIDQGPEWRAFDSDQDERRARTGSPMTYLSHDKGLATEISWSNKDYYG
TF2B_PYRAB       VCARCGYVIEENIVDMGPEWRAFDASQREKRSRTGAPESILLHDKGLSTDIGI------D
TF2B_PYRHO       VCARCGYVIEENIIDMGPEWRAFDASQREKRSRTGAPESILLHDKGLSTDIGI------D
TF2B_PYRFU       VCAKCGYVIEENIIDMGPEWRAFDASQRERRSRTGAPESILLHDKGLSTEIGI------D
TF2B2_THEKO      VCAKCGYVIEENVVDEGPEWRAFEPGQREKRARTGAPMTLMIHDKGLSTDIDWRDKDIHG
TF2B1_HALSA      VCADCGLVVTDAPIDHGPEWRTFSDDPDHAPERTGAPLTRSRHDRGLSTEIGYS------
TF2B5_HALSA      VCADCGLIIDEQSIDRGPEWHRDDAD---TAKRTGAPLTPARHDRGLSTVIGSGQ-DARG
TF2B2_HALSA      VCVDCGLVVEENGIDRGPEWRAFNSTEKDEKSRVGAPTTNMMHDKGLSTNIGWQDKDAYG
TF2B6_HALSA      VCADCGLVVEEDGIDRGPEWRAFDSKEKDEKSRVGAPTTNTMHDKGLSTNIDWRDKDAYG
TF2B2_HALVD      ICEDCGLVVEDTVVDRGPEWRAFDSAERDSKSRVGAPTTKMMHDKGLSTNIGWQNKDAYG
TF2B4_HALSA      TCGECGLVVEEDGIDHGPEWRAFNAQEQDEKSRVGAPTTNMMHDKGLSTNIGWQDKDAYG
TF2B3_HALSA      VCEDCGLVLEDDQIDHGPEWRAFNSSERDQKSRVGAPTTKTMHDKGLTTQIDWKDKDAYG
TF2B7_HALSA      VCNDCGLVVEEEQIDPGPEWRAFNHQERQEKSRVGAPTTQTMHDKGLTTTIDWKDKDAYG
                  *   . :: :  ..  .: :           : * * .   *  *. : :         

TF2B2_SACS2      KTL----KMQRMQNK------IRVSPKDKKLVTLLSILNDESSKLELPEHVKETASLIIR
TF2B_AERPE       GIK----QRKILPRRPPRLSARPLTSVDKNLQTALSLINEVASRMGMPEIVVEDASKIYR
TF2B_SACSH       RTLDPKRRLEALRWRKWQIRARIQSSIDRNLAQAMNELERIGNLLNLPKSVKDEAALIYR
TF2B1_SACS2      RTLDPKRRLEALRWRKWQIRARIQSSIDRNLAQAMNELERIGNLLNLPKSVKDEAALIYR
TF2B_SULAC       RSLDPKRRLEVLRWRKWQIRTRIQSSIDRNLAQAMNELERIGNLLNLPKAVKDEAALIYR
TF2B_METJA       KDLSANKRAQLYRLRKWQRRIRVSDAAERNLAFALSELDRITSKLGLPRHVRENAAIIYR
TF2B_METTL       KDISADKRAQLYRLRKWQRRIRVSDASERNLAFALSELDRIASKLGLPRNVRENAAVLYR
TF2B_METTH       RDIPARNRAQWYRLRKWQRKIRISGATERNLAFALSELDRDSSRLGLPRSVREAASMVYR
TF2B_ARCFU       KAISVRNRAQLFRLRKWQRRIRISNATERNLAFALSELDRMASALGLPKSVRETAAVIYR
TF2B1_THEAC      RSIPTRNRAQLYRLRKWQKRIKVSNAAERNLSQALQELERMASNLSIPDDVKETAAVIYR
TF2B2_THEAC      KRIPHKNRAQIYRVRKWHQRIRVSNAAERNLSLALQLLNDIGAKLGIPKDIKETAALIYR
TF2B_PYRAB       RSLTGLMREKMYRLRKWQSRLRVSDAAERNLAFALSELDRITAQLKLPKHVEEEAARLYR
TF2B_PYRHO       RSLTGLMREKMYRLRKWQSRLRVSDAAERNLAFALSELDRITAQLKLPKHVEEEAARLYR
TF2B_PYRFU       RSLSGLMREKMYRLRKWQSRLRVSDAAERNLAFALSELDRITAQLKLPRHVEEEAARLYR
TF2B2_THEKO      NQITGMYRNKLRRLRMWQRRMRINDAAERNLAFALSELDRMAAQLRLPRHLKEVAASLYR
TF2B1_HALSA      ARLTGRKRRKFARLRRQHKRATIPSKADYNRIYGFTEIRRLIGTFGIGTGLRDQACTLFA
TF2B5_HALSA      TALSSEKRRRLARMRREQSRGRWRSTKERNLGHGLTEIRRIASALGLADSVRDQACQLFR
TF2B2_HALSA      NSLSSNQRQKMQRLRKWNERFRTRNSKERNLKQALGEIERMASALGLPKEVRETASVIYR
TF2B6_HALSA      NSLSSNQRQKMQRLRKWNERFRTRDAKERNLKQALGEIDRMASALGLPDNVRETASVIYR
TF2B2_HALVD      KSLSPRQREQMQRLRTWNERFRTRDSKERNLKQALGEIDRMASALGLPENVRETASVIYR
TF2B4_HALSA      NTLSGRQRRKMQRLRKWNERFRTRNSKERNLKQALGEIERMASAFGLPDSVRETASVIYR
TF2B3_HALSA      RSLDAKKRNQMNRLRKWQERIRTKDAGERNLQFALSEIDRMASALGVPRSVREVASVIYR
TF2B7_HALSA      RSISSKKRSQMHRLRKWQERIRTKDAGERNLQFALSEIDRMASALGVPRSVREVASVIYR
                        : .    :            : :    :  :      : :   : : *. :  

TF2B2_SACS2      KMVETGLTKRIDQYTLIVAALYYSCQVNNIPRHLQEFKVRYSIS--SSEFWSALKRVQYV
TF2B_AERPE       EAMEKGLTRGRSIESIVAASLYAASRIHGLPHSLTDIIKAMKGNVDAETRRDVARSYRLL
TF2B_SACSH       KAVEKGLVRGRSIESVVAAAIYAACRRMKLARTLDEIAQYTKAN-----RKEVARCYRLL
TF2B1_SACS2      KAVEKGLVRGRSIESVVAAAIYAACRRMKLARTLDEIAQYTKAN-----RKEVARCYRLL
TF2B_SULAC       KAVEKGLVRGRSIESVVAASIYAACRRMKMARTLDEIAQFTKAN-----RKEVARCYRLI
TF2B_METJA       GAVEKGLIRGRSIEGVVAAAIYAACRRCRVPRTLDEIAEASRVD-----RKEIGRTYRFL
TF2B_METTL       GAVEKGLIRGRSIEGVAAAALYAACRRCKVPRTLDEIAEGSRVD-----RKEIGRTYRFI
TF2B_METTH       RAVENKLIRGRSIEGVVAASLYAACRKCNVPRTLDEIAEVSRVS-----KKEVGRTYRFL
TF2B_ARCFU       KAVEKNLIRGRSIEGVVAAALYAACRQAGVPRTLDEIATYSRVD-----RKEIGRTYRFI
TF2B1_THEAC      KAVKQNMIRGRSIEGVVAGALYAACRITNVPRTLGEIASVTRVK-----KKEIGRTYRIM
TF2B2_THEAC      KAVEKNLIRGRSIESIVCASIYAACRKVNIPRTLDEISKASEVN-----KKKIGKAYRHL
TF2B_PYRAB       EAVRKGLIRGRSIESVIAACVYAACRLLKVPRTLDEISDIARVE-----KKEIGRSYRFI
TF2B_PYRHO       EAVRKGLIRGRSIESVIAACVYAACRLLKVPRTLDEISDIARVE-----KKEIGRSYRFI
TF2B_PYRFU       EAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD-----KKEIGRSYRFI
TF2B2_THEKO      KAVMKKLIRGRSIEGMVSAALYAACRMEGIPRTLDEIASVSKVS-----KKEIGRSYRFM
TF2B1_HALSA      SAQTAGLLHGRTIEGFAAAGVYATCRTNGVTRTLDEIAAAARAT-----RPELTTAYDAM
TF2B5_HALSA      TAQNERLLKGRSIEAMAAASVFGACRCNGESWLIDDVAPMAQVG-----QNRVENAYTVL
TF2B2_HALSA      RALSEDLLPGRSIEGVATAALYASARQLSTPRSIDEVANVSRID-----EMEFKRTYRYI
TF2B6_HALSA      RALEDDLLPGRSIEGVATSCVYAAARQAGVPRSLDEIADVSRVE-----KAEIARTYRYV
TF2B2_HALVD      RALNDDLLPGRSIEGVATSALYASARMAGTPRSLDELEKVSRVD-----KMELTRTYRYI
TF2B4_HALSA      RALGEDLLPGRSIEGVATSALYAAARQANTPRSLDEVASVSRVD-----RGEIARTYRYV
TF2B3_HALSA      RALKEDLIRGRSIEGVATACLYAACRQEGIPRTLEEVTEVARID-----QKEIGRTYRYV
TF2B7_HALSA      RALKEDLIRGRSIEGVATSALYAACRKEGIPRSLEEISEVSRVE-----RKEIGRTYRYI
                       :        .  . :: :.:    .  : :.                      :

TF2B2_SACS2      ANSIPGFRPKI--KPAEYIPKILYKLNLPPIIGTKASELVDLMHKQGLTSGKGYLSLSAA
TF2B_AERPE       VRDLNIKIPVR--KPENFVYTIISALGLPEHVAIEAIKIIDLSRKKGLTAGKDPGGLAGA
TF2B_SACSH       LRELDVSVPVS--DPKDYVTRIANLLGLSGRVMKTAAEIIDKAKGSGLTAGKDPAGLAAA
TF2B1_SACS2      LRELDVSVPVS--DPKDYVTRIANLLGLSGAVMKTAAEIIDKAKGSGLTAGKDPAGLAAA
TF2B_SULAC       LRELDIEVPVS--DPKDYVTRIGTLLSLSGITMKHAAEIIEKAKNSGLTAGKDPAGLAAA
TF2B_METJA       ARELNIKLTP--TNPIDYVPRFASELGLPGEVESKAIQILQQAAEKGLTSGRGPTGVAAA
TF2B_METTL       SRELNIRLTP--TNPIDYVPRFASELKLPGEVESKAISILQKANEKGLTSGRGPTGVAAA
TF2B_METTH       TRELNIKLPP--TSPVDYVPRFASELGLSGEVQSKAIEIIEMAMENGLTSGRGPTGVAAA
TF2B_ARCFU       TRELGLKLMP--TSPADYIPRFCAALGLSGEVQKKAIEIIKKAEERELTSGRGPTGVAAA
TF2B1_THEAC      SRYLKLNIMP--SKAEDYISRFCSKLKLSMDTRNKALEILRSAENAGLTSGKGPTGVAAA
TF2B2_THEAC      AKELDLNLKP--TTPFSYISQFCNKLDLDKQAIVISEDIVRQAMSMGISSGKGPTGIAAA
TF2B_PYRAB       ARNLNLTPKKLFVKPTDYVNKFADELGLSEKVRRRAIEILEEAYKRGLTSGKSPAGLVAA
TF2B_PYRHO       ARNLNLTPKKLFVKPTDYVNKFADELGLSEKVRRRAIEILEEAYRRGLTSGKSPAGLVAA
TF2B_PYRFU       ARNLNLTPKKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYKRGLTSGKSPAGLVAA
TF2B2_THEKO      ARGLGLNLRP--TSPIEYVDRFGDALGVSARTKKRAKEILNEAIKRGITSGKGPTGLAAA
TF2B1_HALSA      NRDLGLPTGPI--DPREYLPRYADALSLPARIERQARELVAALETDGLVAGRNPSGVAAG
TF2B5_HALSA      NEELGLPTPPV--SLDQFVPRLASDLGCTDVVRRRAEELVVQAVDAGITTGVHPSGFAAA
TF2B2_HALSA      VRELSLEVAPA--DPAQYVPRFASDLDLPDEVERRSRELISNAQADGVTSGKSPVGLAAA
TF2B6_HALSA      VRELGLEVAPA--DPESYVPRFASDLGLSDEASHRARELLKTAKDKGVHSGKSPVGLAAA
TF2B2_HALVD      VRELKLEIKPA--DPEQYVPRFASELGLSDEAERQARQLLRDAKETGIHSGKSPVGLAAA
TF2B4_HALSA      ARELSLEVAPT--DPASYVPRFCSDLELSGDVERRARDLLAAAADAGITSGKSPVGLAAA
TF2B3_HALSA      AQELSLEIQPT--DPKEYLPRFASDLELSEEVIAKAREIIDTSAEQGLLSGKSPSGFAAA
TF2B7_HALSA      SQELGLEMKPV--DPKKYVPRFCSELELTEEVQSKANEIIETTAEEGLLSGKSPTGYAAA
                  . :            .::      *         : .::       : :*    .  ..

TF2B2_SACS2      SVYLISALMDIKKTQKEVADSLDITEVTIRNRYKDIVDNFDIVVTL---------
TF2B_AERPE       AVYLAALKHGIRKTQKEIAHVVGVTEVTIRNRYKEIAQALGIEEELEEKGGEEKG
TF2B_SACSH       AIYIASLLHDERRTQKEIAQVAGVTEVTVRNRYKELTQELKISIPTQ--------
TF2B1_SACS2      AIYIASLLHDERRTQKEIAQVAGVTEVTVRNRYKELTQELKISIPTQ--------
TF2B_SULAC       AIYIAALLNDERRTQKEIAQVAGVTEVTVRNRYKELTQELKIQIPSQ--------
TF2B_METJA       AIYIASVLLGCRRTQREVAEVAGVTEVTIRNRYKELTEHLDIDVTL---------
TF2B_METTL       AIYIASVLHGTRRTQREVADVAGVTEVTIRNRYKELTEHLDIDVTL---------
TF2B_METTH       ALYIASVLLGEHKTQRDVAEVAGVTEVTIRNRYKELTEQLDLGVTL---------
TF2B_ARCFU       ALYVASILLGERRTQREVAEVAGVTEVTIRNRYKELAEKLGIEIIL---------
TF2B1_THEAC      AIYIASLMTGERRTQRAVAEVAGVTEVTIRNRYKELTEKLQLNVEQ---------
TF2B2_THEAC      AIYIASVKVGKPRTQKEIARISGVTEVTIRNRYKEISKALNISISE---------
TF2B_PYRAB       ALYIASLLEGEKRTQREVAEVARVTEVTVRNRYKELVEKLGIKVPVT--------
TF2B_PYRHO       ALYIASLLEGEKRTQREVAEVARVTEVTVRNRYKELVEKLGIKVPIT--------
TF2B_PYRFU       ALYIASLLEGEKRTQREVAEVARVTEVTVRNRYKELVEKLKIKVPIA--------
TF2B2_THEKO      ALYIAALLEGEKKTQREVAEVAHVTEVTVRNRYKELVEKLGINVPI---------
TF2B1_HALSA      CLYTAATETDHAVTQSAAAAVADVTPVTLRATYQNLTDA----------------
TF2B5_HALSA      CLYMAACVHDAPLTQADAAAAAGVTVETIRSHRDRLLSIVE--------------
TF2B2_HALSA      AIYASSLLTNHKVTQSEVSEVTDVSEVTIRNRYQELLEATEAAA-----------
TF2B6_HALSA      AVYAAALLTNEKTTQAKVSEVADISEVTIRNRYHELLEAEDTIPV----------
TF2B2_HALVD      AVYAAALLTNEKVTQSEVSTVADISEVTIRNRYKELLEVQDGTLLA---------
TF2B4_HALSA      SVYAAALLTNERVTQNEVSTVANVSEVTIRNRYHEILDAGGEPGVEA--------
TF2B3_HALSA      AIYAASLLCNEKKTQREVANVANVTEVTIRNRYQEQIEAMGFGV-----------
TF2B7_HALSA      AIYAASLLCNEKKTQREVADVAQVTEVTIRNRYQEQIEAMGIHG-----------
                 .:*  :   .   **   :    ::  *:*   .   .