CLUSTAL format seed alignment for MF_00384

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

KHSE_BACHD            -----------------MTLPFQITVPGSSANLGPGFDSVGLAVNRYLTLTVTE--GSEW
KHSE_BACSU            --------------MNEADMLFSVTVPGSTANLGPGFDSVGMALSRYLKLTVFE--SDKW
KHSE_LACLA            ---------------------MKIIVPATSANLGAGFDSIGIAVNLYLTVEVLEE-SNDW
KHSE_LACLC            ---------------------MKIIVPATSANLGAGFDSIGIAVNLYLTVEVLGE-SRDW
KHSE_STRPN            ---------------------MKIIVPATSANIGPGFDSVGVAVTKYLQIEVCEE-RDEW
B4U351_STREM          ---------------------------------------MGIAVSKYLEVDILEE-SDQW
KHSE_LISIN            ---------------------MRIRVPATTANLGPGFDSCGLALTLYLTLDIGEK-ADSW
KHSE_LISMO            ---------------------MRIRVPATTANLGPGFDSCGLALTLYLTLDIGAE-ADSW
C2PUV9_BACMY          -------------------------------------------MSLYLEVSVKGE-ADKW
C3GHQ0_BACTU          ---------------------------------------------MYLHVVVKEK-SDKW
KHSE_STAAM            -----------------MSNVLELTIPASTANLGVGFDSIGMALDKFLHLSVKETSGTKW
KHSE_AQUAE            --------------------MIKIEVPATTTNFGSGFDTFGLALSLTNTFSVDFSDKYE-
KHSE_THEMA            ---------------------MKVLVPATTTNLGAGFDVFGLALDLFNEVEFSFDTKET-
KHSE_HELPY            ---------------------MVVSVPATSANLGPGFDCLGLSLNLRNRFFIEPSSFHA-
KHSE_HELPJ            ---------------------MVVSVPATSANLGPGFDCLGLSLNLRNRFFIEPSNIHA-
KHSE_CAMJE            ---------------------MKILVPATSANLGPGFDCLGLSLKLFNETQIQKSGVFS-
KHSE_CLOAB            --------------------MIRVKIPATSANMGAGFDTLGMALKLYNEITIEETEGET-
KHSE_MICDP            ---------------MSVVSSVTVTVPATTANLGPGFDCIGAALTLYNKVKFTRLDAG--
KHSE_SYNY3            ------------------MVSFTVSVPATTANIGPGFDCLGAALGLYNHVTVTDPTDPEV
KHSE_DEIRA            --------------MSSPARPFTVRAPASSANLGPGFDSLGLSVPLYTTLRVTPQDKAE-
B1ZVY5_OPITP          --------------MNRARHTVSVRVPASTSNCGAGFDSQGLALSLYNRVTLTRTQGLV-
D5ELM1_CORAD          ----------------MSEQSVLVQVPASTSNCGPGFDTLSIALSLYNFVRLTPRTDSE-
KHSE_MYCLE            ---------MVTW-MLPAGLVASAVVAASSANLGPGFDSIGLALSLCDEIVVETTDSGL-
KHSE_MYCTU            ---------MVTQALLPSGLVASAVVAASSANLGPGFDSVGLALSLYDEIIVETTDSGL-
KHSE_CORGL            ---------MAIE--LNVGRKVTVTVPGSSANLGPGFDTLGLALSVYDTVEVEIIPSGL-
KHSE_STRCO            -----------MAGPAFRAAAVRVRVPATSANLGPGFDALGLALGLYDDVVVRVADSGL-
B5GL70_STRCL          -----------MAGPAFRAAAVRVRVPATSANLGPGFDALGLSLGLYDDVVVRVADSGL-
F8AVP8_9ACTN          ---MNRPAAAPLLAASRTAQAARVRVPATSANLGPGFDACGLALGLYDELTVTVTGAGL-
KHSE_XANCP            -MNQMVDMSH-AVPTARGLREARAFAPASVANVAVGFDLLGYPLDGVGDTVTVRRIDAPV
Q5H0M4_XANOR          MSGTGLSSPR-AGAGHSAPREARAFAPASVANVAVGFDLLGYALDGVGDTVTVRRIDAPQ
KHSE_XYLFA            -MNRTLQPDRGASQTAPAAHQARAFAPASVANVAVGFDLLGYPMDQVGDTVTVRRIDTPQ
Q2S4Q3_SALRD          --------------------------------------MLGGALSGLGDRVTVRRLETPT
KHSE_PYRAB            -------------------MKKRIYAPATIANFGPGFDVFGMAIEEPGDEVIVKESDSFE
KHSE_PYRHO            -------------------MRIKVRAPATIANFGPGFDVFGMAIDKPFDEVVVEEFNEFE
KHSE_HALSA            -------------------MVVTVRAPATSANLGSGFDVFGVALSKPADVVRVERADTTT
KHSE_AERPE            ----------------MACSRARARAYSSAANLGPGFDALAVALDAYYDEVEVRVCSGGN
KHSE_PYRAE            -----------------------MKAPSTSANLGAGFDIVAVAHDAYFAEAYTAVGSGCG
KHSE_SACS2            ------------------MECKRARAYSSSANLGSGFDILSIAHTAFFDTVEICVENKNL
KHSE_SULTO            ---------------------MIVKAFSSSANLGAGYDILALAHDAFEDTIEIYAQNSSE
KHSE_THEAC            ----------------MPQVKVTASAPCSSANLGSGFDTLAIALDAFHDRVTISDHDG--
KHSE_THEVO            ----------------MPSMELSVISPCSSANLGPGYDVLAIAFDAFYDQVNVMLSDK--
KHSE_METJA            -------------------MKVRVKAPCTSANLGVGFDVFGLCLKEPYDVIEVEAIDDKE
KHSE_ECOLI            --------------------MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEA
KHSE_ECO57            --------------------MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVES
KHSE_SALTY            --------------------MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEA
KHSE_SERMA            --------------------MVKVYAPASIGNVSVGFDVLGAAVSPIDGTLLGDCVSVEA
KHSE_YERPE            --------------------MVKIYAPASIGNVSVGFDVLGAAVSPIDGTLLGDCVSVTA
KHSE_VIBCH            -------------------MSVVVYAPASIGNVSVGFDVLGAAVSPIDGTLLGDRVKVEA
KHSE_HAEIN            --------------------MLRIYAPASSANISVGFDTLGAAISPIDGSLLGDVVQIES
KHSE_PASMU            --------------------MLRIYAPASSANLSVGFDTLGTAVSPIDGSLLGDVVQIEA
KHSE_BUCAI            --------------------MIKIYAPASIGNVGVGFDILGAAIIPVNGSLLGDFVTVKL
KHSE_BUCBP            --------------------MIKIYAPASIGNVGVGFDVLGAAISPIDNSLLGDVITITS
G4QID9_GLANF          ----------------MTVKTTKAFAPASIGNVSLGFDLLGAALHPIDGTTLGDWVSVSD
E8LIK3_SUCHY          -----------------MTKAYRAYAPASAANLSVGFDLLGAALRPISGQPLGDFVTVNE
KHSE_BLOFL            --------------------MIRVYAPASIANIGVGFDTLGMSISPVNGDKLGDFVSIKD
A0A1F5B8U4_9BACT      -----------------MSREIIVRSPATIANFGPGFDIFALALEGPSDVLKIRPARRGD
B5YEX4_DICT6          -------------------MKYLIKVPATSANLGPGFDTLGICWDLFLKIYVDLNSNEK-
Q8F4A7_LEPIN          ---------------MSSILQYSIRVPGTSANLGPGFDLFGLAFRIYNQFQFQFLPGKE-
E0SS97_IGNAA          ------------------------------MAIKDLYDIVEVCISSGNNNIYVYSHSKDF
C7LXZ6_ACIFD          -------------MVAPHGPWRFARAPGSTANLGPGFDALGLAIPFETRVWARPNSRFVV
J9ZCM9_LEPFM          MAEQLNLSGKHFPSTPLVEKSVTVYAPASVGNIGPGFDTLGMAVTEMGDTLTGYLQKREG
                                                                                  

KHSE_BACHD            H-------FSTQSADLVGIPSGKENLVYQVAEHVASQLEKTLPP----CHVQMESNIPLA
KHSE_BACSU            S-------FEAETETVAGIPAGTDNLIYQVAKRTADLYGKEMPP----VHVKVWSDIPLA
KHSE_LACLA            K-------IDHDLGNN--IPTDEKNLLLTTLSAVLKAKNSSLSAK---YHLKMTSEVPLA
KHSE_LACLC            K-------IDHDLGEN--IPTDERNLLLTTLSAVLEDKNVALSAK---FHLKMTSEVPLA
KHSE_STRPN            L-------IEHQIGKW--IPHDERNLLLKIALQIVPDLQP--------RRLKMTSDVPLA
B4U351_STREM          F-------IEHDLGD---IPNDDSNLLIQTALRLAPNIPA--------HRLKMTSDIPLA
KHSE_LISIN            Y-------IEHNIGGG--IPHDETNVIIETALNLAPNLTP--------HHLVMTCDIPPA
KHSE_LISMO            Y-------IEHNIGGG--IPHDETNVIIETALNLAPNLTP--------HHLVMTCDIPPA
C2PUV9_BACMY          Q-------VIHSFDDS--IPKDDKNLIVSTACKVCPSLSP--------HIIEVTSNIPLT
C3GHQ0_BACTU          Q-------VIHSFEDS--IPTDDKNLIVSTACKVCPSLSP--------HIIEVTSNIPLT
KHSE_STAAM            E-------YIFHDDASKQLPTDETNFIYHVAQQVASKYSVDLPI----LCIEMRSDIPLA
KHSE_AQUAE            --------VQIEGYSSGIPKDQKN-LFIKVYKKTCQSIGKKPKP----LKLIQENRVPPA
KHSE_THEMA            --------TIESTGKYASDLKDHN-LFFEVLRFFERKTGYRVPP----VRIKQTCNIPVS
KHSE_HELPY            --------VKLVGEGEGIPKFLTNNIFTKVFYEILKKH-GNDGS----FKFLLHNKVPIT
KHSE_HELPJ            --------VKLVGEGEGIPKFLTNNIFTKVFYEILKKH-GNDGS----FKFLLHNKVPIT
KHSE_CAMJE            --------ISIGGEGSDNIFLKKNNIFVNIFYEIYEKLSGKKDN----FRFIFQNNIPLS
KHSE_CLOAB            --------EIKLLGGELDRNYRNNLTYISIIKVYEFFNKEFKGF----KIDMSKTNIPLS
KHSE_MICDP            GL-----IIHVTGKEAEGVNTDESNLLYQAFVKLYQHIEQIPPS----VKIEIDLGVPLA
KHSE_SYNY3            DL-----LIEARGRDGEKISTTKDNLLYQAIAYFYQQTGQAIPP----LKLEIDLEIPLA
KHSE_DEIRA            --------VVPLGTELADTPADESNYVYRAMTLAAKRAGRTLPP----ARVEIETEVPLA
B1ZVY5_OPITP          ------------PLPEQPVDESTHALVVQSAERFWRVAGTVPVG----FYYRIEGEVPAA
D5ELM1_CORAD          ------------IRPVGELLPSTQVMVSKAASAFVAAAGVASTG----FDYEIWGEVPRA
KHSE_MYCLE            -------VVVVDGEGADQVPMGPEHLVVRAVRRGLQAVGVSAAG----LVVRCRNAIPHS
KHSE_MYCTU            -------TVTVDGEGGDQVPLGPEHLVVRAVQHGLQAAGVSAAG----LAVRCRNAIPHS
KHSE_CORGL            -------EVEVFGEGQGEVPLDGSHLVVKAIRAGLKAADAEVPG----LRVVCHNNIPQS
KHSE_STRCO            -------HIDIAGEGSETLPRDEKHLLVRSLRTAFDLLGGQPRG----LEIVCANRIPHG
B5GL70_STRCL          -------HIDIAGEGASTLPRDESHLLVRSLRTAFDLLGGQPRG----LEVVCANRIPHG
F8AVP8_9ACTN          -------SIEVTGE--DDGVRDETHLVVRALRAGFAAAGITPAG----IRLNCVNRIPHG
KHSE_XANCP            V------RIAAIRGTTVALPLEAERNTAGAALMSLRAALALPF----GFELEIDKGIALS
Q5H0M4_XANOR          V------RIAAIRGTAVELPLEAERNTAGAALVALRSALALPF----GFELEIDKGIALS
KHSE_XYLFA            V------RIAAIRGIAQPLPLQTERNTAGAALLSMHRDLALPF----GFELEIDKGIPLS
Q2S4Q3_SALRD          V------RVGSITGRVPDLPTTPADNTATVALQSLRDAAGMNG----GFEVSIEKGIPLG
KHSE_PYRAB            I------EVEGYDVP------RDENNVAVISAKALFKMVGEEG----GVKIRLKKGVRPK
KHSE_PYRHO            I------ISSGYPVP------NGEDNIALFSAKTLFKMLNIEG----GLRIKLKKGIRPK
KHSE_HALSA            I------TVTGAGAQ------YVPTDPQENTAGVVAAAL--DA----PATIHINKGVRPS
KHSE_AERPE            S------VYVDEVEGKFSSGVLQGPNTAAEAVRGLLNMEGVEA----EVGIRVYKGVPPG
KHSE_PYRAE            ------------VHVKFKGYDPGPENTVTRSFKKFFELTGICR----GVEVEVENNIPIA
KHSE_SACS2            --------NNIIVESNSKIPLEPNKNSATYPIVKIMEEIGIKA----SLKVRVIKGIPEG
KHSE_SULTO            --------LDIKVEGNG-VPLSIDKNSASFALLELLRSYDIKA----KIRLKIIKGIPAG
KHSE_THEAC            ----------FKLTGEG-IPLDPERNTAGLAAIALLDELGLER----DIEIRIEKGVPKG
KHSE_THEVO            ----------LRILADE-IPVQPDKNTAGLTALKMIEDFGIKD----GIKISIKKGIPYG
KHSE_METJA            --------IIIEVDDKN-IPTDPDKNVAGIVAKKMIDDFNIGK----GVKITIKKGVKAG
KHSE_ECOLI            ---AETFSLNNLGRFADKLPSEPRENIVYQCWERFCQELGKQ----IPVAMTLEKNMPIG
KHSE_ECO57            ---AETFSLNNLGRFADKLPSEPRENIVYQCWERFCQELGKQ----IPVAMTLEKNMPIG
KHSE_SALTY            ---ADHFRLHNLGRFADKLPPEPRENIVYQCWERFCQALGKT----IPVAMTLEKNMPIG
KHSE_SERMA            ---AETFSLQNAGRFVSKLPAEPKENIVYQCWERFCQEIGRE----VPVAMRLEKNMPIG
KHSE_YERPE            ---AERFSLHNEGRFVSKLPDDPKQNIVYQCWERFCQEMGKE----IPVAMVLEKNMPIG
KHSE_VIBCH            G--AEAFTLKTAGRFVDKLPANPQENIVYDCWQVFARELEKKSVVLKPLTMTLEKNMPIG
KHSE_HAEIN            I--STGFELESAGYFVRKLPKEPQKNIVYQAYVLFSEQLKLRGANVKPLRLTLEKNMPIG
KHSE_PASMU            L--PSGFELESAGYFVRKLPKEAQKNIVYQAYVLFSERLKLRNIAVRPLRLTLEKNMPIG
KHSE_BUCAI            ---SNKFNLVNKGIFSNKLPKNTEQNIVWKCWLKFCNTIKRN----IPVSIILEKNMPIG
KHSE_BUCBP            ---SKQFSLTSTGTFSNQLPKDINKNIVKKCWTYFCKILKKN----LPVSITLEKNMPIG
G4QID9_GLANF          ---ADEFSLSVDGQFADRLPPGTENNIVTKCYAYFQSSLSSSGHAPLKVKMHLHKTLPIG
E8LIK3_SUCHY          NPGCNGCQVTTKGRFVHKLPTDPRKNIVFDAYNAYKKALESQGKKALNLSIVLEKNLPVC
KHSE_BLOFL            ---ADNFSIKISGLFYDQIPIKLEQNIVFKCWKRFCEISNQI----RPVEIKLEKNVPVE
A0A1F5B8U4_9BACT      -------IVIRVSGGYPDLPTKPEDNTAGLAALHFFRRTGADGG----ADIEIIKRMPSC
B5YEX4_DICT6          -----------VVINKNKQEIKKNDLFIQALNYTLEYLNIPNKF----YKIELDSEIPIG
Q8F4A7_LEPIN          --------FKTSVKGMETLPFGPDEDLVLSSYRSYFKRFLSGKE-IIPYSLLMDLKLPMK
E0SS97_IGNAA          E------------------IPSGEGNVAYHIAKNFREIYNIHNI---DIYINVIKGVPPG
C7LXZ6_ACIFD          R----------LAGTGGSERLDSGHLIARALSQVAREP----------VELVVASDIPLA
J9ZCM9_LEPFM          PD-----LITSISGAWTSLPTDPSQNTATIAARYLLDKAGYSDL---KLTVSIQKGVP-G
                                                                              :   

KHSE_BACHD            RGLGSSAAAIVAGIELANQLLGQ----PLAAEDKVRFGSLWEG--HPDNIAPSVYGGLVI
KHSE_BACSU            RGLGSSAAAIVAAIELADELCGL----KLSEADKLHLASLEEG--HPDNAGASLVGGLVI
KHSE_LACLA            RGLGSSSSVIIAGIELANQLAKL----NLTTEEKLELACEIEG--HPDNVAPALLGNLVI
KHSE_LACLC            RGLGSSSSVIIAGIELANQLAKL----NLTSDEKLKLACEIEG--HPDNVAPALLGNLVI
KHSE_STRPN            RGLGSSSSVIVAGIELANQLGQL----NLSDHEKLQLATKIEG--HPDNVAPAIYGNLVI
B4U351_STREM          RGLGSSSSVIVAGIELANQLGHL----NLTADRKLAIATRIEG--HPDNVAPAIFGQLVI
KHSE_LISIN            RGLGSSSAAVVAGIELANTLAEL----NLSKEEKVRIAAEIEG--HPDNVAPAVLGNWVV
KHSE_LISMO            RGLGSSSAAVVAGIELANTLAEL----NLSKEEKVRIAAEIEG--HPDNVAPAVLGNWVV
C2PUV9_BACMY          RGLGSSASAIVAGIELANQLGNL----HLTTDQKVQIATNFEG--HPDNVAASILGGTVI
C3GHQ0_BACTU          RGLGSSASAIVAGIELANQLGKL----NLTTDQKVQIATNFEG--HPDNVAASILGGTVI
KHSE_STAAM            RGLGSSASALVGAIYIANYFGDI----QLSKHEVLQLATEIEG--HPDNVAPTIYGGLIA
KHSE_AQUAE            RGLGSSATAIVGGIEAALALHKV----ELPLKEKLKIAFEFEK--HPDNIIPAFVGGFTV
KHSE_THEMA            SGLGSSAAVIVAALHIANEGTGR----NLSREDLMKLAVELEG--HPDNVVPAFTGGLVV
KHSE_HELPY            RGMGSSSAMIVGAVASAFAFLGF----DFDRENIVNTALIYEN--HPDNITPAVFGGYNA
KHSE_HELPJ            RGMGSSSAMIVGAVASAFAFLGF----AFDRENILNTALIYEN--HPDNITPAVFGGYNA
KHSE_CAMJE            RGLGSSSAVIVGAIASAYYMSGF----KVEKECILDEALIYEN--HPDNIAPATLGGFVC
KHSE_CLOAB            RGLGSSAACIVGGIVGANALLNE----KMTIKDMLKIAVDIEG--HPDNVAPALLGGVII
KHSE_MICDP            RGLGSSATAIVGGLVAANQLAGE----PLSQLQVMELAIAMEG--HPDNVVPALLGGCRL
KHSE_SYNY3            RGLGSSATAIVGGLLAANQAAGN----PCTTSEILQMAIAMEG--HPDNVAPALLGGCQL
KHSE_DEIRA            RGLGSSAAALVAGVVAGNELLGR----PLDDETVLDVTAREEG--HPDNVAPALFGGIVV
B1ZVY5_OPITP          RGLGSSATIIAGVLVGLDSLHET----RLPRPAMVKIATAVEG--NPENVSASLLGGFTV
D5ELM1_CORAD          RGLGSSSTVRAGIVAGLNELNGR----LLDQEAMIRLTTQLDN--APDNACAAFAGGFCI
KHSE_MYCLE            RGLGSSAAAVVGGLAVVNGFVAQIDSTPLSNAQLIQLASEFEG--HPDNAAAAVLGGAVV
KHSE_MYCTU            RGLGSSAAAVVGGLAAVNGLVVQTDSSPSSDAELIQLASEFEG--HPDNAAAAVLGGAVV
KHSE_CORGL            RGLGSSAAAAVAGVAAANGLA----DFPLTQEQIVQLSSAFEG--HPDNAAASVLGGAVV
KHSE_STRCO            RGLGSSSAAICAGIVAARAVTIGG-EARLDDAALLDLATEIEG--HPDNVAACLLGGFTL
B5GL70_STRCL          RGLGSSSAAICAGIVAARAVTIGG-ESRLDDTALLELATEIEG--HPDNVAACLFGGFTL
F8AVP8_9ACTN          RGLGSSAAAIVGGLLAASALGGG----RPDIPEVFTLACRLEG--HPDNVAAALYGGFTI
KHSE_XANCP            SGMGGSAASCVAALVAANALLDTPISTDQLYQHALDGEAVASGSRHGDNLGPLFLGGLVL
Q5H0M4_XANOR          SGMGGSAASCVAALVAANALLEAPLSRDQLYLNALDGEAVASGSRHGDNLGPMLLGGLVL
KHSE_XYLFA            SGMGGSAASCVAALLAANALLEEPLRREHLYRYALDGEAVASGSRHGDNLGPLFLGGLVL
Q2S4Q3_SALRD          SGLGGSAASAVGAVVAGAELLSASWSQADLLPHALAGEAVASGDLHPDNVAPCLFGGLVL
KHSE_PYRAB            SGLGSSGASSVAGALAAARVLGVD-NDELIIMAALEGEKAASGSPHGDNVIPSYYGGFNI
KHSE_PYRHO            SGLGSSGASAVAGALGAAKLLGVS-NDELILKAAMKGEEKASGEPHPDNVVPSYYGGFTV
KHSE_HALSA            SGLGSSAASAAAATVALAELYDRPLDDDALVRAAAQGEAAASGVAHADNVAPAILGGFTI
KHSE_AERPE            RGLGSSGASAAAAVAAVSHALALEVPVDRLVFYAGLGERAAAGQPHFDNAAASILGGLAV
KHSE_PYRAE            RGLGSSGAAAVAALAAFIREAGIKTDPRAVIEAAGYGETAAAGSPHFDNVAGAALGGAVV
KHSE_SACS2            LGLGSSGASAAAAVMAFNNLFNLNLSKEDLVRYAMYGEIASSGSPHPDNVAASVFGGVVS
KHSE_SULTO            LGLGSSGASAAAAVYAANEIFKLNLSRQELVNFAMKGEIASSGSPHPDNVAASLVGGLVS
KHSE_THEAC            LGLGSSGASAAAAVKALDAYFGLGLTQEEMIGYAMIGEIASSGSPHPDNVSASIIGGLVL
KHSE_THEVO            LGLGSSGSSAAAAAYAINNLFALGLERKDLIKYAAVGELASSGSPHPDNVSASILGGLVI
KHSE_METJA            SGLGSSAASSAGTAYAINELFKLNLDKLKLVDYASYGELASSGAKHADNVAPAIFGGFTM
KHSE_ECOLI            SGLGSSACSVVAALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQL
KHSE_ECO57            SGLGSSACSVVAALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQL
KHSE_SALTY            SGLGSSACSVVAALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQL
KHSE_SERMA            SGLGSSACSVVAGLMAMNEFCDRPLDKTTLLGLMGELEGRISGSVHYDNVAPCYLGGLQL
KHSE_YERPE            SGLGSSACSVVAGLMAMNEFCGQPLDKVTLLGMMGELEGRVSGSIHFDNVAPCYLGGMQL
KHSE_VIBCH            SGLGSSACSIVAALDALNQFHASPLDETELLALMGEMEGKISGSIHYDNVAPCYLGGVQL
KHSE_HAEIN            SGLGSSACSIVAALVALNQFHNEPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGVQF
KHSE_PASMU            SGLGSSACSIVAALVALNKFHAEPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGVQL
KHSE_BUCAI            SGLGSSACSIVATLVAMNEFCDKPLNSKELLLLMGEVEGEISGSIHYDNVAPCYLGGLQL
KHSE_BUCBP            SGLGSSACSIVATVVAINTFFNKPINNFELLKLMGKLEGKISGSVHYDNVAPSYLGGMQL
G4QID9_GLANF          SGLGSSASSIVAAFHAMNEHAGKPFSENTLLVMMGELEGQISGSVHYDNVAPSYIGGLVL
E8LIK3_SUCHY          SGLGSSAASVVAAVVALDAIHGNALGEEGKIKLMGELEGKISGSIHYDNVAPCYYGGLQL
KHSE_BLOFL            SGLGSSACSIVASLVAINNYYGNLLNNDQLLQLMGEMEGKVSGSIHFDNVAPCFLGGMRI
A0A1F5B8U4_9BACT      AGLGSSAASAVAAVFGLDKIYRTGLEPHDIIEMASLGEAASGGTPHADNVAACALGGFVF
B5YEX4_DICT6          KGLGSSAAAILGGISTAEIISTK------KVDKIEKIKIALNFENHIDNLSACLEGGVVT
Q8F4A7_LEPIN          GGLGSSASAAVAGVCSARFVHKKFYPEISIPKENEFLFHLGQIEGHPDNTIPAYLGGFVF
E0SS97_IGNAA          YGLGSSGATSAATAFGLSKLLQPSLSDIEILRIAGVGEKFASGSIHYDNVAASLFGGIVI
C7LXZ6_ACIFD          RGLGSSGSLALALAAALGATDPL------------AAAIVLEG--HPENAAASALGGAVV
J9ZCM9_LEPFM          SGLGSSAASAVGGAMLTQLLLGSPFGDSELLDAAAQSESSVSGGYFLDNVSASLFGGISV
                       *:*.*.    .                                   :*      *    

KHSE_BACHD            G--THLST------ETHVIHGGVPDLDLVLLVPK---EELLTKKARGILPESLSYKEAVR
KHSE_BACSU            G--LHEDD------ETQMIRVPNADIDVVVVIPF---YEVLTRDARDVLPKEFPYADAVK
KHSE_LACLA            A--STVAD------KTNYVSSDFPSCKLLAFVPD---YELKTVESRKVLPKELAYKEAVA
KHSE_LACLC            A--STVAG------KTSHIVADFPSCALLAFVPD---YELKTVESRKVLPNELTYKEAVA
KHSE_STRPN            A--SSVEG------QVSAIVADFPECDFLAYIPN---YELRTRDSRSVLPKKLSYKEAVA
B4U351_STREM          A--SQIGK------DVDYIIAPFPDLSLVCFIPD---YELKTSDSRDVLPKQLSYKQAVA
KHSE_LISIN            G--AKLDG------EDFYVRHLFPDCALIAFIPK---AELLTSESRGVLPETLPFKEAVK
KHSE_LISMO            G--AKLDG------EDFYVRHLFPDCALIAFIPK---AELLTSESRGVLPDTLPFKEAVQ
C2PUV9_BACMY          G--ALDGK------NVSVVRIESKELGVISLIPN---EELNTEESRSVLPEMFPFHEAVK
C3GHQ0_BACTU          G--ALDGK------NVSVVRIESKELGVISLIPN---EELNTDESRSVLPDVFPFHEAVK
KHSE_STAAM            GFYNDVSK------ETSVAHIDIPDVDVIVTIPT---YELKTEASRRALPQKLTHSEAVK
KHSE_AQUAE            CATSE-------SGVIFKKLPFPEDIKIVFVIPD---FEVSTSEARRVLPKKVELKEAVF
KHSE_THEMA            CYQNG-------SHLDFEK--FEIDLSLTFLVPN---FPVCTNEMRKILPEKVPFEDAVF
KHSE_HELPY            AFVEK-------KKVISLKTKIPSFLKAVMVIPN---RAISTKQSRHLLPKRYSVQESVF
KHSE_HELPJ            AFVEK-------KKVISLKTKIPSFLKAVMVIPN---RVISTKQSRHLLPKRYSVQESVF
KHSE_CAMJE            SLVEK-------NKVYSIKKEIDKDLAAVVVIPN---LAMSTEQSRQALAKNLSFNDAVF
KHSE_CLOAB            SIKDM-------ENIIYSRINVKSQLKYAVMVPD---FKVSTELSRKVLPNEYSREDALF
KHSE_MICDP            AATSA-------EGWEICDVPWDENVVPVVAIPD---FELSTQEARRVLPTEFSRADAIF
KHSE_SYNY3            AVKNG-------DHWQLVALDWPSKFVPVLAIPN---FELSTEAARAVLPHQYDRSAAIF
KHSE_DEIRA            ATLDK-------LGTHYVRLDPPAHLGVTVLVPD---FELSTSKARAVLPREYSRADTVH
B1ZVY5_OPITP          SRTDPATG----EYVDAVRVTVPREIAFVVASPS---MELRTVESRGALPPTLPFADAVK
D5ELM1_CORAD          ARTEPKDF----SYREHVRFDLPNTLNFIAVSPD---YEVLTEDSRLVLPRGVLFDDVVR
KHSE_MYCLE            SWVDRSYD---QPDYCAVPLRLHPDIHLFAAIPE---ERSSTAESRVLLPARVSHDDARF
KHSE_MYCTU            SWTDHSGD---RPNYSAVSLRLHPDIRLFTAIPE---QRSSTAETRVLLPAQVSHDDARF
KHSE_CORGL            SWTNLSIDGKSQPQYAAVPLEVQDNIRATALVPN---FHASTEAVRRVLPTEVTHIDARF
KHSE_STRCO            SWMES-GAAR------AIRMEPSDSIVPVVFVPG---KPVLTQTARGLLPRSVPHVDAAA
B5GL70_STRCL          AWTDG-GAAR------AIRMEPADSVVPVVFVPE---KPVLTQTARGLLPPTVPHVDAAA
F8AVP8_9ACTN          AWHDSDGPPR------VARTDPPEDLRPVVFVPT---RRQSTAQSRVALPAGVPHADAAM
KHSE_XANCP            CTLER-----------LVPIAVPEAWHSLVVHPE---AVLETRRAREALAGDYRLSEFVA
Q5H0M4_XANOR          STLER-----------MVPVPVPAAWHSLVVHPD---AVLETRRARAALAGNYRLDEFVA
KHSE_XYLFA            CTLER-----------LVPVTVPAAWHSLLVHPD---TLLETRRAREVLKDPYLLPDIVT
Q2S4Q3_SALRD          TREMDPPD--------VVPIPVPSDIRCVLVHPD---RVLPTREARACLPDTIPLSESVR
KHSE_PYRAB            LESLNP----------LRVHRVDVELNVVVVLPE---VEVPTKEARRIVPEKVPLKDAIK
KHSE_PYRHO            IESKSP----------LRVHFVDAKLRGVVVLPE---VEIPTAKARKILPSMVPLKDAVK
KHSE_HALSA            VREDG-------------IEHVDASLALAVCLPE---TTVSTRDARGVVPESAAMEAVVS
KHSE_AERPE            VASDAAGK--------LRVFRVPFKAWFAVVTPMNPVPQGKTGVMRKVLPENVSFRDAVR
KHSE_PYRAE            LTS--LSP--------IDYVKFSPRLIFVVGVPEVPPMPNKTKVMREVLPKSVEFKTYVR
KHSE_SACS2            VVSVSPVK--------VVEIPINYSFDILLFTPLNVHIEEKTKKAREMVPKTVTLSDYIN
KHSE_SULTO            VLNSNPVK--------VEQVPLNLEFQIILIIPF-VRIEAKTKKAREMVPKQIDTSKYVT
KHSE_THEAC            VTHDDDLR--------ASRINISGDYRFLVAIPD-LFTENKTRAARQMLPRSIPLDSYSK
KHSE_THEVO            VS-PEGIS--------AKRIEVSDQFKFLLVIAD-LKIRDKTKYARSLVPSGVSMGDHKR
KHSE_METJA            VTNYEPLE--------VLHIPIDFKLDILIAIPN---ISINTKEAREILPKAVGLKDLVN
KHSE_ECOLI            MIEENDII--------SQQVPGFDEWLWVLAYPG---IKVSTAEARAILPAQYRRQDCIA
KHSE_ECO57            MIEENDII--------SQQVPGFDEWLWVLAYPG---IKVSTAEARAILPAQYRRQDCIA
KHSE_SALTY            MIEENGII--------SQQVPGFDEWLWVLAYPG---IKVSTAEARAILPAQYRRQDCIA
KHSE_SERMA            MLEEEGII--------SQEVPCFDDWLWVMAYPG---IKVSTAEARAILPAQYRRQDCIS
KHSE_YERPE            ILEQEGYI--------SQDVPGFSDWLWVMAYPG---IKVSTAEARAILPAQYRRQDCIT
KHSE_VIBCH            MLEELGII--------SQSVPSFDDWYWVMAYPG---IKVSTAEARAILPAQYRRQDIVA
KHSE_HAEIN            MVQSLGNI--------CQKLPFFDNWYWVLAYPG---IEVSTAEARAILPKSYTRQNVIA
KHSE_PASMU            MVQSLGNI--------CQQLPFFDEWYWVLAYPG---IEVSTAEARAILPKSYTRQDVIS
KHSE_BUCAI            ILEDSKII--------SQTIPNFKNWFWIVAWPG---TKVPTAEARDILPKKYKKETCIK
KHSE_BUCBP            IINKNDIV--------CQKISIFKNWLWVIAWPG---ISISTEQARTLLPLQYSKKVCIQ
G4QID9_GLANF          MTGEDSPI--------AAKLPCFENWYWLVCYSG---ISVSTAEARRLLPKQYTLSDTLD
E8LIK3_SUCHY          IIGEHGVI--------SQSLEPFKDWYWVSCFPG---IKVSTAAARSILPAQYRRQDVIT
KHSE_BLOFL            FLSKYKNT--------SQLIPSFDNWIWIIAYPG---IKVSTVKSRSVLPKQYSLQDCVD
A0A1F5B8U4_9BACT      VRSTRPLH---------VEKFLVPSIPVVVRVRK-----KDRTTTRGLIPAEFSLARMKE
B5YEX4_DICT6          CLKNENEL-------SFTRLPIKCDIYGVIYIPT---YTIATESARKILPLNYPKEDVIF
Q8F4A7_LEPIN          SYFNGNRL-------EFVKKKFPKKVRCFLIVPN---LETSTHQSRKTLPSSYSTEDVIF
E0SS97_IGNAA          LDLSKERV--------YRIIPRSEIYVAIVMPKNVLQIERKTAYARSILPKSIDLDIHVL
C7LXZ6_ACIFD          AVGGGGDE------LVLRRVALDARLRLVLVVPE---RRLATAEARAVVARTLSLEDAVF
J9ZCM9_LEPFM          SNSRLRES---------FRFGTFSGLFLVFLIPR---TLLKTSESRKAIPPDVPLDRAIG
                                                                   *  :           

KHSE_BACHD            GSSVSNVLVAALLKENWELVGEMMVRDVFHHPYRLGLVPHLQEVIRYVKEETE-------
KHSE_BACSU            ASAVSNILIAAIMSKDWPLVGKIMKKDMFHQPYRAMLVPELSKV-EHVAEMKG-------
KHSE_LACLA            ASSIANVLTASLLTKNLKVAGQMIESDHFHENYRASLVPELKIL-REIGHEFG-------
KHSE_LACLC            ASSIANVLTASLLTNNLEVAGQMMEADRFHESYRASLIPELQLL-REIGHEFG-------
KHSE_STRPN            ASSIANVAVAALLAGDMVTAGQAIEGDLFHERYRQDLVREFAMI-KQVTKENG-------
B4U351_STREM          ASSVANLAIAALLTGNLKKAGRAIENDQFHEIYRQRLVREFQPI-KRAAAANG-------
KHSE_LISIN            ASSIANVMIAAILRNDMTLAGEMMERDLWHEKYRSKLVPHLTQI-REVAKNNG-------
KHSE_LISMO            ASSIANVMIAAILRNDMTLAGEMMERDLWHEKYRSQLVPHLAQI-RDVAKNQG-------
C2PUV9_BACMY          ASAISNVLVAALCQKKWEVVGEMMERDHFHEPYRLELVPLLPSI-RKCAKEFG-------
C3GHQ0_BACTU          ASAISNVLVAALCQKKWEVVGEMMERDHFHEPYRLELVPLLPSI-RKCAKEFG-------
KHSE_STAAM            SSAISNTMICALAQHNYELAGKLMQQDGFHEPYRQHLIAEFDEV-KTIASQHN-------
KHSE_AQUAE            NVQRSALFVSALLTKDYKLLREAVR-DKLHQPYREKLVPGLSEAILVSYKEG--------
KHSE_THEMA            NIKNSCQFLAKIAAGKIKEALKYVG-DRLHQNYRINGNKKMKEFVEAILSKN--------
KHSE_HELPY            NLSHASLMTMAIVQGKWDLLRCCSK-DRMHQYKRMQTYPVLFAIQKIALENN--------
KHSE_HELPJ            NLSHASLMTMAIVQGKWDLLRCCSK-DRMHQYKRMQTYPVLFAIQKLALENN--------
KHSE_CAMJE            NLSHASFLTACFLEKKYEFLKFASQ-DKLHEINRMKNLPELFEVQKFALENK--------
KHSE_CLOAB            NISRCSMLVSALNNGENEKLRYLFE-DKIHQPYRKKLINNIDSIFLKAKEYG--------
KHSE_MICDP            NTAHLGLLLRGLATGKGEWLKTALQ-DKLHQPYRKALIPGYDAVNQAAVAAG--------
KHSE_SYNY3            NASHLALLVQAFSQGRGDWLALALQ-DQIHQPYRQSLIPAYDQLHQAALAAG--------
KHSE_DEIRA            ALSHAALLAAALAQGRLDLLRHAMQ-DYVHQVWRAPLVPGLSDILEHAHEYG--------
B1ZVY5_OPITP          SLNSASFFAAAFVAGDYEKLRQAVG-DFVHEPYRLPKIPGAGAAIDAGIEAG--------
D5ELM1_CORAD          SANSLAFLVGVFVSGDYERLKGAVN-DYMHQPYREKLNPFGRESIEAGCHAG--------
KHSE_MYCLE            NVSRAALLVVALTERP-DLLMAATE-DVLHQPHRASAMSASAEYLRLLRRHN--------
KHSE_MYCTU            NVSRAALLVVALTERP-DLLMAATE-DLLHQPQRAAAMTASAEYLRLLRRHN--------
KHSE_CORGL            NVSRVAVMIVALQQRP-DLLWEGTR-DRLHQPYRAEVLPITSEWVNRLRNRG--------
KHSE_STRCO            NAGRAALLVEALTRRP-ELLLPATE-DRLHQEYRAPAMPESTALVERLRGDGIPAVI---
B5GL70_STRCL          NAGRAALLVEALTRRP-ELLLPATE-DRLHQEYRAPAMPQSADLVTDCARTASPRSSPVR
F8AVP8_9ACTN          SAGRAALLAMAMSGGP-RPRSGGAG-TAAVASPGTPG-PENNDRAAAGPGNGRRRGDGQN
KHSE_XANCP            QSTNLALVLAGCHAGDA-DLVRAGLRDVLVEPRRAPLIA-GFAQAKQAALAHA-------
Q5H0M4_XANOR          QSANLALVLAGCHAGDE-SLVRAGLRDVLIEPRRAGLIL-GFGAAKAAALAAG-------
KHSE_XYLFA            QSANLALVLAGCYHGDA-ELVRAGLRDVLIEPRRAPLIA-GFTAAQQAALQAD-------
Q2S4Q3_SALRD          QTAHLGAFVAGCYRDDL-ALIGRALRDFIVEPHRAALVP-GFPDVQDAARAHD-------
KHSE_PYRAB            NLAMASSLVLALKEGDI-ETVGRLLDDNLALPYRKKLMP-WFDEVRKAGLEAG-------
KHSE_PYRHO            NIAMASSLILALKEGDL-ETIGRLLDDNLALPYRKKLMP-WFDEIRRVALETG-------
KHSE_HALSA            TVESAATLTLGMCENDP-QRVGRGVEDALVTPARARLMD-GYEAASAAARDAG-------
KHSE_AERPE            NFSRAAGIVAAAVNGDLKSMGALMMSDEIVEPRRRSYVP-CYTQVRKAALQAG-------
KHSE_PYRAE            QTARVASLIAGLALSDPR-LVARGMEDEVVEAARAPYVP-GYARVRKYAFEAG-------
KHSE_SACS2            NSRYISSLLLGFIKGER-ELIRLGLNDKIVEKARLPLFP-YYPKIKEVAIKYD-------
KHSE_SULTO            NARYLSSLLLGFIKGDR-ELVRLGLNDEIIEKAREPLFP-HYPKIKEISLLYD-------
KHSE_THEAC            ALGRTASLIAGLMSGNR-NLIRVGMNDDIVEPSRISLFP-YYYDMKRMALANE-------
KHSE_THEVO            NTSRVASLIAGLMSGDR-ELVSTGMNDDIVEAAREPIFP-YYRRVKDTAIESG-------
KHSE_METJA            NVGKACGMVYALYNKDKSLFGRYMMSDKVIEPVRGKLIP-NYFKIKE-EVKDK-------
KHSE_ECOLI            HGRHLAGFIHACYSRQP-ELAAKLMKDVIAEPYRERLLP-GFRQARQAVAEIG-------
KHSE_ECO57            HGRHLAGFIHACYSRQP-ELAAKLMKDVIAEPYRERLLP-GFRQARQAVAEIG-------
KHSE_SALTY            HGRHLAGFIHACYSRQP-QLAAALMKDVIAEPYRARLLP-GFSQARQAVSEIG-------
KHSE_SERMA            HGRYLAGFIHACHTRQP-QLAAKLMQDVIAEPYRTRLLP-GFAEARKAAQEIG-------
KHSE_YERPE            HGRNLAGFIHACHTQQP-DLAAKMMKDVIAEPYRTQLLP-GFAAARQAAQDIG-------
KHSE_VIBCH            HGRYLAGFIHACHTQQP-ELAAKMIKDVIAEPYREKLLP-GFAKARNYAASAG-------
KHSE_HAEIN            HGRHLGGFVHACHTHQE-NLAAIMMKDVIAEPYRESLLP-NFAEVKQATRDLG-------
KHSE_PASMU            QARHLGSFVHACHTRQA-QLAALMMKDVIAEPYREALLP-NFADVKQATRDLG-------
KHSE_BUCAI            NSRYLAGFIHASYSQQP-HLAARLMQDFIAEPYRIKLLP-NYLYVKEKIKKIG-------
KHSE_BUCBP            HSQNLAGFIHATYTHQS-KLASMFMHDIIAEPYRIKLLP-YFLKTKQIIIDMG-------
G4QID9_GLANF          FGRQLSVFVHSLYAKNE-VLAAKMMTDVIAEQHRKVLLP-RFDDAREACMRSN-------
E8LIK3_SUCHY          YGRRLATFVHACHTRNE-KLAAACLIDVIAEPYRAQLIP-GFDLARSYGAALG-------
KHSE_BLOFL            YGQYLSGFIHACHTRQE-LLAIQCIEDIIAEPYRAKLLPVDLSFLRSCVKEKG-------
A0A1F5B8U4_9BACT      QMAGCAAVILAVLQGDIEDIGASINRDHISEPVRSRSIPGYDDLKRKVLETGA-------
B5YEX4_DICT6          NLQKLSFLITGLVKGDE-DLIDMGMEDKIHQPYRFNLIKEYTLISELLNGKFK-------
Q8F4A7_LEPIN          NMSRVVTWMEFLDSGKI-SLLKLALDDRIHTPYRMHSEFELNPFLMQIHKNLI-------
E0SS97_IGNAA          QSSVIAKMIYALAIDNIDLFGEAVSTDYIIEPIRSKLIPFYSEMKRIALENGA-------
C7LXZ6_ACIFD          NLQRVAALVASL--GDVEALAPLLFEDRLHQPWRERLFPEAVVVRDALIEAGC-------
J9ZCM9_LEPFM          ALANSAGLLTAVHLGNP-DLFCRMLQDPLIQPYRKNLIPFFDDLENISREAGA-------
                                                                                  

KHSE_BACHD            ------------------------------------------------------------
KHSE_BACSU            ------------------------------------------------------------
KHSE_LACLA            ------------------------------------------------------------
KHSE_LACLC            ------------------------------------------------------------
KHSE_STRPN            ------------------------------------------------------------
B4U351_STREM          ------------------------------------------------------------
KHSE_LISIN            ------------------------------------------------------------
KHSE_LISMO            ------------------------------------------------------------
C2PUV9_BACMY          ------------------------------------------------------------
C3GHQ0_BACTU          ------------------------------------------------------------
KHSE_STAAM            ------------------------------------------------------------
KHSE_AQUAE            ------------------------------------------------------------
KHSE_THEMA            ------------------------------------------------------------
KHSE_HELPY            ------------------------------------------------------------
KHSE_HELPJ            ------------------------------------------------------------
KHSE_CAMJE            ------------------------------------------------------------
KHSE_CLOAB            ------------------------------------------------------------
KHSE_MICDP            ------------------------------------------------------------
KHSE_SYNY3            ------------------------------------------------------------
KHSE_DEIRA            ------------------------------------------------------------
B1ZVY5_OPITP          ------------------------------------------------------------
D5ELM1_CORAD          ------------------------------------------------------------
KHSE_MYCLE            ------------------------------------------------------------
KHSE_MYCTU            ------------------------------------------------------------
KHSE_CORGL            ------------------------------------------------------------
KHSE_STRCO            --------------------------SGAGPTVMALADADTA------DKVE--------
B5GL70_STRCL          ARRCSHWPRTARPRRSRDWRGRGGPPTGSPSTPRARASCRSL------PRVPRPPVARRP
F8AVP8_9ACTN          GYAGLADDRLAGFSAGRPAGSQTGKQVGNQHVRPGAVSWRDALLAAVDDRLHQPYRLPSM
KHSE_XANCP            ------------------------------------------------------------
Q5H0M4_XANOR          ------------------------------------------------------------
KHSE_XYLFA            ------------------------------------------------------------
Q2S4Q3_SALRD          ------------------------------------------------------------
KHSE_PYRAB            ------------------------------------------------------------
KHSE_PYRHO            ------------------------------------------------------------
KHSE_HALSA            ------------------------------------------------------------
KHSE_AERPE            ------------------------------------------------------------
KHSE_PYRAE            ------------------------------------------------------------
KHSE_SACS2            ------------------------------------------------------------
KHSE_SULTO            ------------------------------------------------------------
KHSE_THEAC            ------------------------------------------------------------
KHSE_THEVO            ------------------------------------------------------------
KHSE_METJA            ------------------------------------------------------------
KHSE_ECOLI            ------------------------------------------------------------
KHSE_ECO57            ------------------------------------------------------------
KHSE_SALTY            ------------------------------------------------------------
KHSE_SERMA            ------------------------------------------------------------
KHSE_YERPE            ------------------------------------------------------------
KHSE_VIBCH            ------------------------------------------------------------
KHSE_HAEIN            ------------------------------------------------------------
KHSE_PASMU            ------------------------------------------------------------
KHSE_BUCAI            ------------------------------------------------------------
KHSE_BUCBP            ------------------------------------------------------------
G4QID9_GLANF          ------------------------------------------------------------
E8LIK3_SUCHY          ------------------------------------------------------------
KHSE_BLOFL            ------------------------------------------------------------
A0A1F5B8U4_9BACT      ------------------------------------------------------------
B5YEX4_DICT6          ------------------------------------------------------------
Q8F4A7_LEPIN          ------------------------------------------------------------
E0SS97_IGNAA          ------------------------------------------------------------
C7LXZ6_ACIFD          ------------------------------------------------------------
J9ZCM9_LEPFM          ------------------------------------------------------------
                                                                                  

KHSE_BACHD            ----AYGAALSGAGPTMLCLSPKG---RG-----EWVQKQLQKQYPQFEVDVLKPDDQGI
KHSE_BACSU            ----AYGTALSGAGPTILVMTEKG---KG-----EELKEQLALHFPHCEVDALTVPKEGS
KHSE_LACLA            ----AYGTYLSGAGPTVMLLLPDD---KL-----NLLTEKINEQNLSGQLYSLEVDSNGL
KHSE_LACLC            ----AYGTYLSGAGPTVMLLVPDD---KL-----TLLTEKIMEKNLTGHLYPLKIDNKGL
KHSE_STRPN            ----AYATYLSGAGPTVMVLASHD---KM-----PTIKAELEKQPFKGKLHDLRVDTQGV
B4U351_STREM          ----AYATYLSGAGPAIMVMCPNE---RK-----MAIYDAIDQLGLTGQLVSLELDRQGL
KHSE_LISIN            ----AYAACLSGAGPTVLVFAPRD---VA-----DTLQTSLQTLEIDADVLLLDVEGSGA
KHSE_LISMO            ----AYAACLSGAGPTVLVFAPRN---LA-----NKLQTSLQTLEIDADVLLLDVEGSGA
C2PUV9_BACMY          ----AYGTALSGAGPSIFILTPYE---KR-----QEIADQLARVFAAMKVCELEIDHKGI
C3GHQ0_BACTU          ----AYGTALSGAGPSIFILTPYE---KR-----QEIAEQLARVFTSMKVCELEIDHRGI
KHSE_STAAM            ----AYATVISGAGPTILIFSRKE---NS-----GELVRSLNSQVVSCHSELVDINISGV
KHSE_AQUAE            ----ALATFLSGAGPTICSLTTEN---EEKIG-EAIREVITKFSGYDAQVMVLKARNEGV
KHSE_THEMA            ----PEYWFVSGSGPSVCSNINDF---EG--------------IPYLKDVLKLRVNNRGM
KHSE_HELPY            ----ALMSTLSGSGSSFFNMCYEE---DA-----PKLKQVLSKKFPKFRVAVLDFDNDGV
KHSE_HELPJ            ----ALMSTLSGSGSSFFNMCYEE---DA-----PKLKQVLSKKFPKFRVAVLDFDNDGV
KHSE_CAMJE            ----ALMSTLSGSGSSFFSLAFKD---DA-----LALAKKIQTKFKDFRVQYLEFDDNGF
KHSE_CLOAB            ----SLGEFISGSGSTLIAVLEEA---DENF--ILKMKTYLDSLKDGWRIFEVENDNNGA
KHSE_MICDP            ----AYGMVISGAGPTLLALADAQ----NSQAVAAAMQTAWQTVGITADVRSLSLDNQGA
KHSE_SYNY3            ----AYNLVISGAGPTLLAIADEV----RAPQIASTLVETWHDAGIEAESHCLPIDTKGA
KHSE_DEIRA            ----ALGAALSGAGPTVLCFHDQR---GSTATLHHYLHDVMTKNGLSGRVMDFPIDAAGT
B1ZVY5_OPITP          ----ALTGWLSGSGSSVLCVCYRA----NAEPIAASMCAAFWRESMPCEARVLSADNDGA
D5ELM1_CORAD          ----AYAGWLSGSGSTVMCIADDE----HAAEVGSAMQTAYEANGVKARVFRLHADNEGL
KHSE_MYCLE            -----VAATLSGAGPSLIALSTQS---ELPREAAEYGAANGFIIIKMTAGDEVCWRPEVT
KHSE_MYCTU            -----VAAALSGAGPSLIALSTDS---ELPTDAVEFGAAKGFAVTELTVGEAVRWSPTVR
KHSE_CORGL            -----YAAYLSGAGPTAMVLSTEP----IPDKVLEDARESGIKVLELEVAGPV--KVEVN
KHSE_STRCO            ----ALAGTDWAA----NRLGLDQ---Q----------------------GATVLPLATA
B5GL70_STRCL          RTSPARARKRWAAEPCASARGPDQ---QVRDVSGERG-SVGRHRDMPVNRRDTRLPVMER
F8AVP8_9ACTN          PETSDLLARLRAAGLAAVLSGSGP---TVLALAVDQDQAALARTCAGSDFSVFDLPVDRD
KHSE_XANCP            ----ALGASISGAGPSVFAWFETR---AAAAAAAPAVQAAFAGVGLDSQAWVTPINSPAA
Q5H0M4_XANOR          ----AMGAGISGAGPSVFAWFATR---AAAEAAAAAVRATFTDVGFGSQSWVSALNCPGA
KHSE_XYLFA            ----AMGASISGAGPSVFAWFQTR---SAAEAAAPAVRAAFTAAGFDSQAWVTPLISPGA
Q2S4Q3_SALRD          ----ALGCSLSGAGPTLFAWCEGP---DQSERVRDAMVEAFAQHDVSTEAWISPIPSEGA
KHSE_PYRAB            ----AYGVTVSGSGPSLFAIGE------NLKDIGKAMKEKFEELGIRAEFWITKTGRGAK
KHSE_PYRHO            ----AYGITVSGSGPALFAIGE------NLKDIGKTIVEKFEELGIKAEYWVTKTGRGAK
KHSE_HALSA            ----ATGVTISGSGPGVVAVCRRR----DRKRVAAALVDGFDSAGVAASAYQTRIGDGAT
KHSE_AERPE            ----ALGFSLSGAGPSMIALAPS----SEAAREIAAAMEESCICCDNPMTVAAEPAPGAS
KHSE_PYRAE            ----ALGVSLSGAGPSVIALVNE----KEAEAVRDAVLRAYAEEGLRAEVKIASITEGAL
KHSE_SACS2            ----AIGACVSGAGPSILVLTDKM---TDENKIVEEGTKTCNEFNVECKVIKAKIAGGVG
KHSE_SULTO            ----AIGACVSGAGPTIAIFVDSK---SDKNKILGESLNVCKAYGYECTYKIAKVSGGAW
KHSE_THEAC            ----AVAAAVSGAGPSILMVCDEM---SDMDSIRAGISEIFSRYNITGRVIEARMSGGAF
KHSE_THEVO            ----AVGAVVSGAGPSILVVYDNK---TETKQMIRKISRIYEGMGISVNFATPNVADGVR
KHSE_METJA            ----VYGITISGSGPSIIAFP--------KEEFIDEVENILRDYYENTIRTEVGKGVEVV
KHSE_ECOLI            ----AVASGISGSGPTLFALCDKP---ETAQRVADWLGKNYLQNQEGFVHICRLDTAGAR
KHSE_ECO57            ----AVASGISGSGPTLFALCDKP---DTAQRVADWLGKNYLQNQEGFVHICRLDTAGAR
KHSE_SALTY            ----ALASGISGSGPTLFALCDKP---ETAQRVADWLSKHYLQNQEGFVHICRLDTAGAR
KHSE_SERMA            ----ALACGISGSGPTLFAVCNDG---ATAQRMAAWLQQHYLQNDEGFVHICRLDTAGAR
KHSE_YERPE            ----ALACGISGSGPTLFAVCNDQ---ATAQRMAGWLQNHYLQNDEGFVHICRLDTAGAR
KHSE_VIBCH            ----ALATGISGSGPTLFSVCKEQ---AVAERVARWLEQNYVQNEEGFVHICRLDKQGSK
KHSE_HAEIN            ----ALATGISGSGPTIFSIAPDL---QTAIKLSSYLESHYLQNNEGFVHVCKVDNEGTR
KHSE_PASMU            ----ALATGISGSGPTIFAIAPDL---GTAMKLSTYLENHYLQNNEGFVHICKVDNQGAR
KHSE_BUCAI            ----AISSGISGSGPTIFSISDNI---NTAQKISAWLTENYLQNTTGFVHICFLDSKGVR
KHSE_BUCBP            ----AIACGISGSGPAIFAVSDNL---LTAKKIATWLTNYYLTNDRGFVHICKIDTIGAR
G4QID9_GLANF          ----ALAFGISGSGPTVFAVAREL---EDAKNMQAWLEKEYIQNDDGFSHICKLDIEGAI
E8LIK3_SUCHY          ----ALATGISGSGSSIFSIFTDK---DDAFEMKEWLERNFIANEDGFAHVCFIDEKGST
KHSE_BLOFL            ----AVSCGISGSGPTIFVLCNVK---NVVDDISNWLSRFYLQNSSGFVKVCSLNKLGSD
A0A1F5B8U4_9BACT      -----FGCNVSGGGSSVFAVCAEE---KLETVAAAMRAFGDPGGAEPEVFVTRSSNEGVK
B5YEX4_DICT6          -----KKVVLSGAGPSLLTITLSY---QKALEILKNLENNLRNEIEGTFRILKLNNKGIE
Q8F4A7_LEPIN          ------GYSLSGSGPSVLLFSERKKAVRVEKILKEKISEFVQENHFHCQILSLKVEEDGI
E0SS97_IGNAA          -----LGFNISGAGPSVFSIHRSR---DNAENVGKKLIEFLNSRGIETSFFVTQLSDKGA
C7LXZ6_ACIFD          -----RGAAWSGAGPSLVGFVEEE----RAPQAAEAVRASLVRVAIGASVHVVAPDLRGL
J9ZCM9_LEPFM          -----RSFIISGAGSTMMALTDNP---KDARTIQETLEKYVQEKQLPVLVRSSTIDSEGA
                                 ..                                               

KHSE_BACHD            QVHRVLSNQQQLPIG----------
KHSE_BACSU            IIERNPLYQVKSV------------
KHSE_LACLA            QVKESVL------------------
KHSE_LACLC            QVEESVF------------------
KHSE_STRPN            RVEAK--------------------
B4U351_STREM          CLV----------------------
KHSE_LISIN            EVFR---------------------
KHSE_LISMO            EVFR---------------------
C2PUV9_BACMY          TVNKEEHIGL---------------
C3GHQ0_BACTU          TVNKKEHIGL---------------
KHSE_STAAM            KERIVYQ------------------
KHSE_AQUAE            KVYS---------------------
KHSE_THEMA            IVSE---------------------
KHSE_HELPY            LIEKD--------------------
KHSE_HELPJ            LIEKD--------------------
KHSE_CAMJE            EIC----------------------
KHSE_CLOAB            VII----------------------
KHSE_MICDP            SSLNEG-------------------
KHSE_SYNY3            TITKLR-------------------
KHSE_DEIRA            VVEHAK-------------------
B1ZVY5_OPITP          RVERA--------------------
D5ELM1_CORAD          KIV----------------------
KHSE_MYCLE            VPG----------------------
KHSE_MYCTU            VPG----------------------
KHSE_CORGL            QP-----------------------
KHSE_STRCO            SDT----------------------
B5GL70_STRCL          GNVCWSR------------------
F8AVP8_9ACTN          GARVELVVG----------------
KHSE_XANCP            RLLA---------------------
Q5H0M4_XANOR          RLL----------------------
KHSE_XYLFA            RLL----------------------
Q2S4Q3_SALRD          RVAARPPADSQAS------------
KHSE_PYRAB            WY-----------------------
KHSE_PYRHO            T------------------------
KHSE_HALSA            RLAADGDDRAP--------------
KHSE_AERPE            VVG----------------------
KHSE_PYRAE            ASL----------------------
KHSE_SACS2            IEGRD--------------------
KHSE_SULTO            VERRD--------------------
KHSE_THEAC            VEGSPVSD-----------------
KHSE_THEVO            EVANPLAD-----------------
KHSE_METJA            -------------------------
KHSE_ECOLI            VLEN---------------------
KHSE_ECO57            VLEN---------------------
KHSE_SALTY            VVG----------------------
KHSE_SERMA            LLG----------------------
KHSE_YERPE            LLG----------------------
KHSE_VIBCH            VTGSEL-------------------
KHSE_HAEIN            EIK----------------------
KHSE_PASMU            ALD----------------------
KHSE_BUCAI            KIG----------------------
KHSE_BUCBP            KIGL---------------------
G4QID9_GLANF          LIS----------------------
E8LIK3_SUCHY          VEEVEI-------------------
KHSE_BLOFL            IVLG---------------------
A0A1F5B8U4_9BACT      EIHGL--------------------
B5YEX4_DICT6          IESL---------------------
Q8F4A7_LEPIN          LESSKEIKI----------------
E0SS97_IGNAA          EVMKQW-------------------
C7LXZ6_ACIFD          VVGSEPPPPALAEGPAVPFEASGLG
J9ZCM9_LEPFM          RHVATPNL-----------------