CLUSTAL format seed alignment for MF_00385

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS16_PASMU        ----------------MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPLAT
RS16_HAEIN        ----------------MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPIAQ
RS16_VIBCH        ----------------MVTIRLARHGAKKRPFYQIVVADSRNSATGRFIEKVGFFNPTAT
RS16_ECOLI        ----------------MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIAS
RS16_SALTY        ----------------MVTIRLARHGAKKRPFYQVVVTDSRNARNGRFIERVGFFNPIAS
RS16_NEIMA        ----------------MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVAN
RS16_PSEAE        ----------------MVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVERIGFFNPVAT
RS16_BUCAI        ----------------MVKIRLARYGTKKRPFYKLVVADSRFSRNGRFIERLGYFNPIAK
RS16_XYLFA        ----------------MVKIRLTRGGAKKRPFYQIIVTDSRNKRDGRNIERVGHYNPVAQ
RS16_ACIFR        ----------------MVVIRMARGGAKKRPFYHIVVADSRSRRDGRFIERLGFYNPIGA
RS16_CAUVC        ----------------MLKIRLARGGAKKRPYYSIVVADSHSPRDGRFIEKVGTYNPLLK
RS16_RICPR        ---------------MAVKIRLARGGAKKRPFYRVVIANATAPRDGDFLEKVGTYNPMLA
RS16_MYCGE        ----------------MVKIRLMRMGRVHYPLYRIVAVDSRVKRNGKYIALIGHLNPALK
RS16_MYCPN        ----------------------MRMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALK
RS16_MYCGA        ----------------MVKIRLMRLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPING
RS16_UREPA        -------------MKILVKIRLTRVGTHKKPFFRIVVMDAKTKANGAYIENLGHYDPVLG
RS16_HELPY        ----------------MTVIRLTRIGRKKKPFYRVVVTDSRKRRDGGWIESIGYYNPLSE
RS16_HELPJ        ----------------MTVIRLTRIGRKKKPFYRVVVTDSRKRRDGGWIESIGYYNPLSE
RS16_CAMJE        ----------------MTVIRLTRMGRTKRPFYRIVVTDSRKRRDGGWIESIGYYNPMVE
RS16_THEMA        ----------------MVRIRLTRMGKRHQPFYRIVVVDSRKRRDGAYIESLGYYNPLKE
RS16_GEOSE        ---------------MAVKIRLKRMGAKKKPFYRIVVADSRSPRDGRFIETIGTYNPVAE
RS16_BACSU        ---------------MAVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAK
RS16_BACHD        ---------------MAVKIRLKRMGSKKAPFYRVVVADSRSPRDGRFIEEIGTYNPLTQ
RS16_LACLA        ---------------MSVKIRLTRMGSKKKPFYRINVADSRAPRDGKFIETVGTYNPLVT
RS16_STRP1        ---------------MAVKIRLTRMGSKKKPFYRINVADSRAPRDGRFIETVGTYNPLVA
RS16_BACTN        ---------------MATRIRLQRHGRKSYAFYSIVIADSRAPRDGKFIEKIGTYNPNTN
RS16_BORBU        ---------------MSVKIRLKRMGAKKRPYYRVVVMNSTSPRDGRAIEELGYYHPVE-
RS16_TREPA        ---------------MSLRIRLKKLGSKKRPYYRIVVQDAREPRDGRAIEELGIYQPIAP
RS16_MYCLE        ---------------MAVKIKLTRLGKIRNPQYRVIVADARTRRDGRSIEVIGRYHPKEE
RS16_MYCTU        ---------------MAVKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEE
RS16_STRCO        ---------------MAVKIKLKRLGKIRSPHYRIVVADSRTRRDGRAIEEIGKYHPTYN
RS16_STRLI        ---------------MAVKIKLKRLGKIRSPHYRIVVADSRTRRDGRAIEEIGKYHPTYN
W4TJ16_CUTAC      ---------------MATKIRLKRLGKIRTPHYRVVVMDSRAKRDGRAIEEIGQYHPRP-
RS16_DEIRA        ----------------MVKIRLSRFGSAHNPHYRIVVADVRRPRDGGYIESLGHYDPRKT
RS16_THET8        ----------------MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKT
RT16_DROME        MSLSPASGIGRFYAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPN
RS16_CHLMU        ---------------MALKIRLRQQGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSE
RS16_CHLTR        ---------------MALKIRLRQQGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSE
RS16_CHLPN        ---------------MALKIRLRQQGRRNHVVYRLVLADVESPRDGKYIELLGWYDPHSS
RS16_AQUAE        ---------------MAVRIRLAKFGRKHHPIYRIVVMDAKSPREGKYIDILGTYDPKRK
RR16_SOLTU        ----------------MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLQKVGFYDPIKN
RR16_TOBAC        ----------------MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLRKVGFYDPIKN
RR16_LOTJA        ----------------MVKLRLKRCGKKQRAVYRIVAIDVRSRREGRDLRKVGFYDPIKN
RR16_HORVU        ----------------MVKLRLKRCGRKQQAVYRIVAIDVRSRREGRDLRKVGFYDPIKN
RR16_MAIZE        ----------------MVKLRLKRCGRKQQAIYRIVAIDVRSRREGRDLRKVGFYDPIKN
RR16_ORYSA        ----------------MLKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPIKN
RR16_ARATH        ----------------MVKLRLKRCGRKQRAVYRILAIDVRYRREGRDLSKVGFYDPITN
RR16_SINAL        ----------------MVKLRLKRCGRKQRAVYRIVAIDVRSRREGRDLRKVGFYDPITN
RR16_ADICA        ----------------MVKLRPKQCGRKQR-TYRIVAIESQSRQEGKVIKEVEFYNPRRE
RR16_MESVI        ----------------MVKLRLKRYGRKKRPFYRVIAIDSRCRRDGKALKELGFYDPIAG
I6ZJ02_MYCWM      -----------------MRLRLKRKGKKHNPFFRIIAIDSRRARDSAELKTLGFYEPKKG
RR16_CYAPA        ----------------MVKLRLKRYGRKGQVTYRIVAMNNLSRRDGKAIEELGFYNPRTN
RR16_PORPU        ----------------MVKLRLKRYGRKQQPSYRIVAMDSRSKRDGKAIEELGFYNPITN
RR16_GUITH        ----------------MLKLRLKKYGRKGQASYRLVVMPSTSKRDGRAIEELGFYNPCTN
RS16_SYNY3        ----------------MIKLRLKRFGKKREVSYRIVAMHSTTRRDGRPLEELGFYNPRTD
RR16_GALSU        ----------------MLKIRLKRCGRKKQTSFKIVVMNNLDKRDGQAIEELGFMNPRTK
RR16_TRICV        ----------------MLKLRLKRSGRKKQPSYRLVVMENTTRRDGRPVEQVGYYNTITK
RR16_CYACA        ----------------MIKIRLKRYGKKNRPTYRIVLIESQKPRDSKTIEELGHYDPLLK
                                         : *      : :             :  :   ..   

RS16_PASMU        -GNAERLRLDLDRVNAWVEKGASLSDRVSALVKEA-------------------------
RS16_HAEIN        -GNAERLRINLERVNHWVAQGASLSDRVASLVKEA-------------------------
RS16_VIBCH        -GQEEGLRLDLDRVNHWVSQGASLSDRVAQLVKTA-------------------------
RS16_ECOLI        -EKEEGTRLDLDRIAHWVGQGATISDRVAALIKEV-------------------------
RS16_SALTY        -EKEEGTRLDLDRIAHWVGQGATISDRVAALIKEV-------------------------
RS16_NEIMA        -EKQERVRLNADRLNHWIAQGAQVSDSVAKLIKE--------------------------
RS16_PSEAE        -GGEVRLSVDQERATYWLGQGAQPSERVAQLLKDA-------------------------
RS16_BUCAI        -GKSEILKLNLERIEHWTNQGAQMSERTKKLIKQK-------------------------
RS16_XYLFA        -GAESRVVLNMARVEHWVKNGAQLTDKVRSLLKEV-------------------------
RS16_ACIFR        -VAE--LRIDKERAAYWLSQGAQPSDTVAGFLKKE-------------------------
RS16_CAUVC        KDDANRVTLKVESIQEWLKKGAQPTDRVARFLAAQGLVAWTHGNNPEKGK---------P
RS16_RICPR        SDNSERVILKKDRIEYWLGTGAKPTERVAKFI----------------------------
RS16_MYCGE        --ENK-CKLDETVALDWLNKGAIPTDTVRSLFSESGLW----------------------
RS16_MYCPN        --ENK-CKIDEAVALEWLNKGAKPTDTVRSLFSQTGLW----------------------
RS16_MYCGA        --TN---KLNGALAIEWLKKGAQPTDTVKSILSKEGIW----------------------
RS16_UREPA        --QV---VLKKEAILAQLQNGAQPSETVKNILSQEGIW----------------------
RS16_HELPY        --PKD-IKIDKERLNYWKGVGAKMSERVEKLSQKA-------------------------
RS16_HELPJ        --PKD-VRIDKERLNYWKGVGAKMSERVEKLSQKA-------------------------
RS16_CAMJE        --PEV-IKVDAERLAYWKSVGAKLSDKVASITSK--------------------------
RS16_THEMA        --GE--IKIDVERAVEWILKGAQPSDTVRDIFRKFGVM----------------------
RS16_GEOSE        --PAE-IKIDEELALKWLQNGAKPSDT-RSLLSKQGLL----------------------
RS16_BACSU        --PAE-VKIDEELALKWLQTGAKPSDTVRNLFSSQGIM----------------------
RS16_BACHD        --PAK-VELKEDRALDWMLKGAKPSDTVRNLFSKAGLM----------------------
RS16_LACLA        --EEQ-VTLKEERVLEWLSKGAQPSDTVRNLLSKAGVM----------------------
RS16_STRP1        --ENQ-ITIKEDRVLEWLSKGAQPSDTVRNILSKAGVM----------------------
RS16_BACTN        --PAT-VDLNFDAALAWVLKGAQPSDTVRNILSREGVYMKKHLLGGVAKGAFGE---AEA
RS16_BORBU        --KQNQIKIKEDRMKDWISKGAILSDTVKMLLNKNN------------------------
RS16_TREPA        --KGTEVSFRLDRARFWLERGAQPSDTVRRLLQSRRG-----------------------
RS16_MYCLE        --PSL-IDINSERTQYWLSVGAKPTEPVLKLLKITGDWQKFKGLPGAEGRLKVAPPKPSK
RS16_MYCTU        --PSL-IEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAQGRLKVAAPKPSK
RS16_STRCO        --PSV-MEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKFKGEPAPAPLLQPA--EKAA
RS16_STRLI        --PSV-MEVDAERVAYWLGVGAQPTEPVLAILKKTGDWQKFKGEPAPAPLLQPA--EKAA
W4TJ16_CUTAC      ------IRRSSRSTLSACSTGSASVPSRLKLLLLC-------------------------
RS16_DEIRA        --SENFLKIDVERANHWIAQGAQPTDTARRLLRSQG------------------------
RS16_THET8        --TPDWLKVDVERARYWLSVGAQPTDTARRLLRQAG------------------------
RT16_DROME        DYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPIHP------------------
RS16_CHLMU        ----QNYQLKSERIFYWLNQGAELTEKAGALVKQGAPGVYAELMA---------------
RS16_CHLTR        ----QNYQLKSERIFYWLNQGAELTEKAGALVKQGAPGVYAELMA---------------
RS16_CHLPN        ----INYQLKSERIFYWLERGAQLSSKAEALVKQGAPGVYSALLS---------------
RS16_AQUAE        ----VLINVYPEKVKEWVLKGVELSHRAKAILWN--HGILKEVVP---------------
RR16_SOLTU        -----QTYLNVPAILYFLEKGAQPTETVQDILKKAEVFKELRLNQPKFN-----------
RR16_TOBAC        -----QTYLNVPAILYFLEKGAQPTGTVQDILKKAEVFKELRPNQS--------------
RR16_LOTJA        -----QTYLNIPVILNFLEQGAQPTGTVQDISKKAGFFMDL-------------------
RR16_HORVU        -----QTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKEKERTLS--------------
RR16_MAIZE        -----QTCLNVPAILYFLEKGAQPTRTVYDILRKAEFFKDKERTLS--------------
RR16_ORYSA        -----QTCLNVPAILYFLEKGAQPTRTVSDILRKAEFFKEKERTLS--------------
RR16_ARATH        -----QTFLNLSAILDFLKKGAQPTRTAHDISKKAGIFTE--------------------
RR16_SINAL        -----QTYLNLPAILDFLKKGAQPTRTVHDISKKAGIFTELNLNKTKLN-----------
RR16_ADICA        -----ETQLDILAITTLCGSGVKLTETVCNIFRRATFKIT--------------------
RR16_MESVI        -----KTQLDVPNIIFYLKAGAQTSETVGNLLQKAKVFNQLSLLN---------------
I6ZJ02_MYCWM      -----NFQLDMNLYQEFLSKGAQPTK---NLLDLIKAQSRLSRL----------------
RR16_CYAPA        -----ESSLNIANIKRRIEQGAQPTNTVRYILAKANIL----------------------
RR16_PORPU        -----ETRIDIAKILKRLKQGAQTTRTVKNILNEAQIIAKENS-----------------
RR16_GUITH        -----ETHINVERVKVRLSQGVKPTSTVKNLLDKVIF-----------------------
RS16_SYNY3        -----ETRLDVPAIVKRLKEGAQPTDTVRSILTKAQVFEQLKA-----------------
RR16_GALSU        -----EKYLNINKINHYLRLGAKPTKTVFDLLNKAKII----------------------
RR16_TRICV        -----ESYFDVIKIKKWLNYGAKPTQTVLNLLKKAKIIDQ--------------------
RR16_CYACA        -----QANFKFDEIMKRVGQGARLTSRVRYILKQFS------------------------
                                      *         :                             

RS16_PASMU        -QKAA-------------------------------------------------------
RS16_HAEIN        -QKAA-------------------------------------------------------
RS16_VIBCH        -QKAA-------------------------------------------------------
RS16_ECOLI        -NKAA-------------------------------------------------------
RS16_SALTY        -KKAA-------------------------------------------------------
RS16_NEIMA        -QKAA-------------------------------------------------------
RS16_PSEAE        -AKANA------------------------------------------------------
RS16_BUCAI        -R----------------------------------------------------------
RS16_XYLFA        -SKTQATAA---------------------------------------------------
RS16_ACIFR        -GVSKTGVASV-------------------------------------------------
RS16_CAUVC        GKKAQERLAERAQREEERKQAEADAKAAAEAEKAAAAEAAAAAAAAPAVEEAPAEEAPAA
RS16_RICPR        -EKAGVTLPKKVKKEMEVKAKNRKVRPSKKQSKES-------------------------
RS16_MYCGE        -KKFIE----SKNKKETSPKK---------------------------------------
RS16_MYCPN        -KKFVE----SKKKPVAKSK----------------------------------------
RS16_MYCGA        -KQYAA----SKKA----------------------------------------------
RS16_UREPA        -KEFIALKDANKKRKAALSKAK--------------------------------------
RS16_HELPY        ------------------------------------------------------------
RS16_HELPJ        ------------------------------------------------------------
RS16_CAMJE        ------------------------------------------------------------
RS16_THEMA        -KRVHEIKY-GKKEEATAE-----------------------------------------
RS16_GEOSE        -EKFHNLKY-GK------------------------------------------------
RS16_BACSU        -EKFHNAKQ-GK------------------------------------------------
RS16_BACHD        -EKLHNAKN-EK------------------------------------------------
RS16_LACLA        -KKFHESKL-SK------------------------------------------------
RS16_STRP1        -AKFHDQKF-SK------------------------------------------------
RS16_BACTN        EAKFEAWKN-NKQSGLAALKAKQDEEKKAEAKARLEAEKKINEVKAKALAEKKAAEAAEK
RS16_BORBU        ---LNAKSQEV-------------------------------------------------
RS16_TREPA        -SVLNAVASDERRVASSQQAADLAHVESVSCAAPIPSSPGGQGV----------------
RS16_MYCLE        LELFNAALAVADGGPTTEATRPKKKVSAKKAAKAVESDAEGAKATKAYALAEGDEQSE--
RS16_MYCTU        LEVFNAALAAADGGPTTEATKPKKKSPAKKAAKAAEPAPQPEQPDTPALGGEQAELTAES
RS16_STRCO        RPSFEAIGGEDEG--KGEAITQKKKADKKDEAAAESSASEA-------------------
RS16_STRLI        RPSFEAIGGEDEG--KGEAITQKKKADKRDEAAAESSASEA-------------------
W4TJ16_CUTAC      ------------------------------------------------------------
RS16_DEIRA        --VKISKK----------------------------------------------------
RS16_THET8        --VFRQEAREGA------------------------------------------------
RT16_DROME        -RTYMTAWRNRRTAAEAEASPEKAESTA--------------------------------
RS16_CHLMU        -KKNARRAVVRQKRRAYRQRLAARRAEAAAK-----------------------------
RS16_CHLTR        -KKVARRAVVRQKRRAYRQRLAARKAEAAAK-----------------------------
RS16_CHLPN        -KQEARKLVVRKKRRAYRQRRSTQREEAAKDATK--------------------------
RS16_AQUAE        -EGYEMKRVGDYYVFEKRESKKSKGGEAA-------------------------------
RR16_SOLTU        ------------------------------------------------------------
RR16_TOBAC        ------------------------------------------------------------
RR16_LOTJA        ------------------------------------------------------------
RR16_HORVU        ------------------------------------------------------------
RR16_MAIZE        ------------------------------------------------------------
RR16_ORYSA        ------------------------------------------------------------
RR16_ARATH        ------------------------------------------------------------
RR16_SINAL        ------------------------------------------------------------
RR16_ADICA        ------------------------------------------------------------
RR16_MESVI        ------------------------------------------------------------
I6ZJ02_MYCWM      ------------------------------------------------------------
RR16_CYAPA        ------------------------------------------------------------
RR16_PORPU        ------------------------------------------------------------
RR16_GUITH        ------------------------------------------------------------
RS16_SYNY3        ------------------------------------------------------------
RR16_GALSU        ------------------------------------------------------------
RR16_TRICV        ------------------------------------------------------------
RR16_CYACA        ------------------------------------------------------------
                                                                              

RS16_PASMU        --------------------------
RS16_HAEIN        --------------------------
RS16_VIBCH        --------------------------
RS16_ECOLI        --------------------------
RS16_SALTY        --------------------------
RS16_NEIMA        --------------------------
RS16_PSEAE        --------------------------
RS16_BUCAI        --------------------------
RS16_XYLFA        --------------------------
RS16_ACIFR        --------------------------
RS16_CAUVC        EAPAEEAAEG----------------
RS16_RICPR        --------------------------
RS16_MYCGE        --------------------------
RS16_MYCPN        --------------------------
RS16_MYCGA        --------------------------
RS16_UREPA        --------------------------
RS16_HELPY        --------------------------
RS16_HELPJ        --------------------------
RS16_CAMJE        --------------------------
RS16_THEMA        --------------------------
RS16_GEOSE        --------------------------
RS16_BACSU        --------------------------
RS16_BACHD        --------------------------
RS16_LACLA        --------------------------
RS16_STRP1        --------------------------
RS16_BACTN        AAAEAPAEEATEAPAEEAAATEAAAE
RS16_BORBU        --------------------------
RS16_TREPA        --------------------------
RS16_MYCLE        --------------------------
RS16_MYCTU        --------------------------
RS16_STRCO        --------------------------
RS16_STRLI        --------------------------
W4TJ16_CUTAC      --------------------------
RS16_DEIRA        --------------------------
RS16_THET8        --------------------------
RT16_DROME        --------------------------
RS16_CHLMU        --------------------------
RS16_CHLTR        --------------------------
RS16_CHLPN        --------------------------
RS16_AQUAE        --------------------------
RR16_SOLTU        --------------------------
RR16_TOBAC        --------------------------
RR16_LOTJA        --------------------------
RR16_HORVU        --------------------------
RR16_MAIZE        --------------------------
RR16_ORYSA        --------------------------
RR16_ARATH        --------------------------
RR16_SINAL        --------------------------
RR16_ADICA        --------------------------
RR16_MESVI        --------------------------
I6ZJ02_MYCWM      --------------------------
RR16_CYAPA        --------------------------
RR16_PORPU        --------------------------
RR16_GUITH        --------------------------
RS16_SYNY3        --------------------------
RR16_GALSU        --------------------------
RR16_TRICV        --------------------------
RR16_CYACA        --------------------------