CLUSTAL format seed alignment for MF_00386

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YIDD_AQUAE      --------------------------------MKSIVLIFLKFWQKFISPL-YPSSCRYY
YIDD_CAMJE      ----------------------------------MICLKILRFYQKFLSPL-KPAACRYY
YIDD_WOLSU      --------------------------------MRTLLIGMIWVYQKVISPL-KRPTCRYY
YIDD_TROWT      ---------------------------MLRIVPRNIFILFIIAYRKIISPM-YGPVCKYY
YIDD_BORBU      -----------------------MNIFKILFILNYALIFLIKIYQNTLSKI-FGLQCIYK
YIDD_TREDE      -------------------------MRKLLVSFLCACIIF---YQKAISPH-FPPSCRYE
YIDD_BORPE      -------------------------------MIRRLLIAPIRFYRYFLSPW-VGRQCRFT
YIDD_CHRVO      --------------------------------MSRILILLIRFYQLAISPW-LAPRCRFQ
YIDD_DESVH      ----------------------------MSVMLRRLVVLPVRFYQYCISPL-FPPACRYV
YIDD_PSESM      --------------------------------MRKLALVPIQFYRYAISPL-MASHCRFY
YIDD_PORGI      -------------------------MRLIKAFLVQLLLLPIFFYKRFISPL-TPPSCRFT
YIDD_SHEON      -------------------------MAQTQSPLQWLATTLIRGYQIFISPI-LGPRCRFN
YIDD_VIBCH      -------------------------MATPLSPFSWLAIGIVKLYQWFISPL-IGPRCRFT
HLYA_AERHY      -------------------------MASALSPGSRVLIALIRVYQRLISPL-LGPHCRFT
YIDD_CHLCV      ----------------------MSFKLFIKNLPTNLCCGLIHIYRWTISPL-LGSPCRFF
YIDD_CHLPN      ----------------------MSFKRFLQQIPVRICLLIIYLYQWLISPL-LGSCCRFF
YIDD_CHLTR      ---------------------------MQTSRISSFFRGLVHLYRWAISPF-LGAPCRFF
YIDD_COXBU      --------------------MYKQIVHAIGKAIQTLLLGLIKSYRYLISPV-LMSSCRFY
YIDD_MYCPA      --------------MTGPARS-GAAIRGAGRTVARGLIFLIQLYRHMVSPL-RPATCRFV
YIDD_MYCTU      --------------MSLSRQSCGRVVRVTGRASARGLIFVIQVYRHMLSPL-RPASCRFV
YIDD_SYNY3      -------------------------------MMKKLLLTLIKLYRILISPL-FPPSCRFQ
YIDD_NITEU      --------------------------------MKQLIIDLIKLYRYSIGLL-IPPSCRFY
YIDD_CAUVC      -----------------------------MTFYERTVDLGLRAYKLTLSPL-IGRQCRFT
YIDD_RALSO      --------------------------------MTRVLLFLLRVYKVAFSPF-VGAQCRFL
YIDD_RHILO      -MHDPHG-HAHTVRPPGR--GRNWPGPWRKTPGRLLGTSFVRLYQLTLSGF-VGNSCRHL
YIDD_RHIME      MCPQPHADHAITRGDTGAAGGRNWSGPFRKTPGRLVGMTLIRAYQLTLSSF-IGNSCRHL
YIDD_RHOPA      -MQLPSR-------------GTDWIAQVLRLP-RNAGRGLIWLYRHTLSPL-VGYNCRHY
YIDD_GLOVI      -----------------------------MELVRRAATGAIRFYQRFVSPL-TPPTCRYV
YIDD_DEIRA      -------------------------------MSAAPLVRAVRWYQRVLSPRKPAPTCRFS
YIDD_CORGL      --------------MCAPTSDDPFDIPEPKSIPAKTAASAVRFYQKYLSGLKMGSTCRFD
YIDD_THEEB      ----------------------------MGNGLSKALIVLIRIYQRWISPL-FLPTCRYT
YIDD_GEOSL      --------------------------------MLKGILYIIGIYQRYLSPL-KGPTCRFY
YIDD_XYLFT      ----------------------------MHKVIMHPLILLLKIYKRLISPL-LGPHCRFE
YIDD_CHLTE      --------------------------------MNIVPILLIRFYQSFISPL-LGPSCKYH
YIDD_LEPIN      --------------------------------MNRFVIQLIQLYKRLLSPL-LPPACRFT
YIDD_STRAW      --------------------------------MKYPLLALIKLYQWTISPL-LGPVCKYY
YIDD_NOSS1      --------------------------------MKQIFIWLIKGYRMFISPL-YPPTCRFR
YIDD_CALS4      --------------------------------MKNFVIFLIRLYQKYISPM-KPRTCRFY
YIDD_STRR6      --------------------------------MKRILIALVRFYQRFISPV-FPPSCRFE
YIDD_STRP8      -------------------------------MMKKLLIVSVKAYQKYISPL-SPPSCRYK
YIDD_LACLA      --------------------------------MKKVLVKAVHGYQRWISPA-LPPACRYY
YIDD_LACJO      --------------------------------MNKLLIGLVNVYKKFISPI-LPPTCRYY
YIDD_LACPL      --------------------------------MRRLLMKGIRFYQRAFSAF-SPAHCRYY
YIDD_ENTFA      --------------------------------MKNPLIGGVRFYQRFISPG-LPARCRYY
YIDD_STAES      -------------------------------MLKKILLSLVVFYQRFISPL-TPPTCRFY
YIDD_BIFLO      ----------------------------MTASFKAVMIGGVRWYQQHISAN-TPPCCKYY
YIDD_BUCAP      -------------------------MVKLSTIVVFCLTFFVSIYQNYISFF-MPSNCRFY
YIDD_BUCBP      -------------------------MVLLLSMISRCLILIILCYQRYISVF-LSPRCRFY
YIDD_BLOFL      -------------------------MVSLPKLSAKIIIRLIYIYQIGISPI-LGHHCRFS
YIDD_HELPJ      ------------------------MRNNKTPFLSAIFTASIRGYQRFFSAF-TFSSCRFY
                                                           ::  ..       * . 

YIDD_AQUAE      PTCSTYAIMAVEKYGVLKGLIKAFFRVLRCNPFFKGGVDYP-------------------
YIDD_CAMJE      PSCSEYALWQFQKKNFFLAFFSTFFRILRCNPFFKGGFDYPRVSKNFYPINLCFKPIFLA
YIDD_WOLSU      PSCSEYALWLFSYSNFWYALLFSLRRILRCNSLFEGGIDYPIISKRITPIFGSPRLIKVW
YIDD_TROWT      PSCSEYCQNSIANNGVFLGAAYTFMRLVRCNPWSKGGVDMPRVSTK--------------
YIDD_BORBU      PTCSKYSIECLKKYNFLTALILMTLRIIRCNALFKGGNDFTPKYKPI-------------
YIDD_TREDE      PTCSQYAIESIKKYGPFKGAGMALLRILRCNPLCKGGYDPVP------------------
YIDD_BORPE      PTCSAYAIEAIERHGAWRGLWLAARRIGRCHPWSPGGYDPVPPGHGAGAQACCAHRHRTE
YIDD_CHRVO      PTCSGYAIEAVSKHGALKGGCLAARRICRCHPWGGSGYDPVP------------------
YIDD_DESVH      PTCSAYTAEAVMRHGVMRGLWLAARRILRCHPWCAGGHDPVPPVPPQRYPSAQEH-----
YIDD_PSESM      PSCSCYAYEAIDNHGLLRGGWLSIRRLGRCHPWNPGGYDPVPAVPTSRSSSMAE------
YIDD_PORGI      PSCSSYAIEALRKYGPGKGLLLSIKRILRCHPWGGSGYDPVP------------------
YIDD_SHEON      PTCSHYAIEAIKVHGTAKGCWFALKRILKCHPLHPGGSDPVPP-----------------
YIDD_VIBCH      PTCSTYAIEALRAHGFIKGCWLSTKRLLKCHPLNEGGFDPVPPV----------------
HLYA_AERHY      PTCSSYGIEALRRFGVIKGSWLTVKRVLKCHPLHPGGDDPVPPG----------------
YIDD_CHLCV      PTCSQYALQALKHHGCIKGLGLTIKRIGKCGPWHPGGVDLVPMT------TLEEALDISP
YIDD_CHLPN      PSCSHYAEQALKSHGFLMGCWLSIKRIGKCGPWHPGGIDMVPKT------ALQEVLEPYQ
YIDD_CHLTR      PTCSEYALVALKKHPLRKSLFLIAKRLLKCGPWCIGGIDLVPRT------SVEEYLSSPT
YIDD_COXBU      PSCSCYAETALKRFGVIKGSGLTVWRLLRCHPFHPGGVDFVPEK------SNEMV-----
YIDD_MYCPA      PTCSQYAVDALDEYGLIRGSWLAAARLAKCGPWHQGGWDPIPER----PGCRVNCQDASD
YIDD_MYCTU      PTCSQYAVDALTEYGLLRGSWLTMIRLAKCGPWHRGGWDPIPEGLTTGRSCQTDVDGAND
YIDD_SYNY3      PTCSQYALDAVEIHGVWRGSCLALKRILRCHPLHPGGYDPVPNP----------------
YIDD_NITEU      PTCSNYMHEALVKHGLIKGLWLGMKRILRCHPWNQGGYDPVP------------------
YIDD_CAUVC      PSCSEYTAAALKDHGPLKGSWLGLRRICRCNPFGGSGYDPPPPRHQPRKWKCEE------
YIDD_RALSO      PTCSDYARDAVLTHGPAIGSYLAAKRLCRCHPFAQGGYDPVPPAAGDAALRSTDSASTET
YIDD_RHILO      PTCSEYAHEAIARHGLWAGGWMGFFRVLRCGPFGTHGIDLVPEVLADRYVWFMPWRYWRI
YIDD_RHIME      PTCSEYGFEAIARYGLWAGGWLTLFRVVRCGPGGTHGFDPVPDSLAPRQRWYTPWRYWQP
YIDD_RHOPA      PTCSMYGDEAIRKFGLWAGGWMTLARLLRCQPWGTSGIDLVPQTAPSRARWYLPWRYARW
YIDD_GLOVI      PTCSEYTRQAIERFGVAAGIWLGTKRLCRCHPLHPGGYDPVPERRSVR------------
YIDD_DEIRA      PTCSEYAAQALDRHGALKGGWLALWRVLRCNPLVPGGFDPVPEHFPARHPRPQGSPPTDH
YIDD_CORGL      PVCSTYALKAVSVHGAFKGTILSAARLSKCGPWHPGGFDPVPNH---------GFWSTET
YIDD_THEEB      PSCSAYAVEAIARYGAVKGTYLAIRRILRCHPFAVGGYDPVPTTCPDPCNESSPPNPPC-
YIDD_GEOSL      PSCSRYAHESLTRYGLVKGLWLTTIRILKCHPFHPGGVDPVK------------------
YIDD_XYLFT      PSCSEYAMVAIARFGTLRGIWLAARRLARCHPLQLGGHDPVPDNTSTQVNPRSHRCTGHH
YIDD_CHLTE      PTCSNYAIEAFRQHNFFYASWLTVWRVLRCNPFSKGGYDPVPPKSV--------KSAGNS
YIDD_LEPIN      PTCSEYAAQAFQEYGFFRALQLSIWRILRCNPLSRGFDDPLPP---------------NT
YIDD_STRAW      PSCSHYGYQAIDRHGAIKGTALTAWRILRCNPWSLGGVDHVPPRKRPRWHEMLRNAWRAR
YIDD_NOSS1      PTCSMYAIEAIERFGVFRGGWMAIRRILRCHPFHPGGYDPVPELGEHCCHHDSGNKG---
YIDD_CALS4      PTCSQYSIEAISKYGLLKGGLMSIWRILRCNPFNPGGYDPVK------------------
YIDD_STRR6      LTCSNYMIQAIEKHG-FKGVLMGLARILRCHPWSKTGKDPVPDHFSLKRNQ---EGE---
YIDD_STRP8      PTCSAYMLTAIEKHG-TKGILMGIARILRCHPFVAGGVDPVPEDFSLMRNKNTSKNEKF-
YIDD_LACLA      PTCSNYMVQAIEKHGPAKGLAMGTARILRCHPFCQPGYDLVPDHFSLRRNWAEPEKEEDS
YIDD_LACJO      PTCSSYMIDALKKHGAILGLIMGLARILRCNPFIKGGVDPVPDYFTLRRNPHPERYEDEI
YIDD_LACPL      PTCSNYTLEAINRFGAVKGVLMGVARILRCQPLVKGGFDPVPAHFSLRRNPQ---YKEED
YIDD_ENTFA      PTCSQYMIDAIHTHGSVKGTTMGVARILRCHPFVKGGIDYVPLKFRLTKNPDETYHGPYT
YIDD_STAES      PTCSQYTREAIEYHGALKGLYLGVRRILKCHPLHKGGFDPVPLK--KDKNSKTTHHH---
YIDD_BIFLO      PTCSNYAIEALERYGAFKGGVLAVLRLLRCRPWSRGGIDDVPQRYSVFYRFSWSKAHEEP
YIDD_BUCAP      PTCSTYMILSLRKFGVIKGIILTILRLFKCHPLHQGGEDLVPLKI------KDKSEY---
YIDD_BUCBP      PTCSHYAVDALYTFGLLKGLLLIAKRILKCHPFHSGGLNSISIKT------KSKREY---
YIDD_BLOFL      ITCSQYGINSIRNFGILKGCWKTCIRILKCHPFNK----------------NDNTQ----
YIDD_HELPJ      PTCSNYALWLLCFESPLVAMGKIAIRILSCNPFCSGGIAYPTTRLKRPSLLQSHKDFNRN
                  ** *    .       .      *:  * .                            

YIDD_AQUAE      ------------------------------
YIDD_CAMJE      EKQLCFLYIPYKNKSFYLIKIIFKRTNQ--
YIDD_WOLSU      LVPLCPQKDWSAKGKFYLIKSMKVVQC---
YIDD_TROWT      ----------YRVNKFGFASRKNV------
YIDD_BORBU      ------------LESLKEFKKRLIK-----
YIDD_TREDE      ------------------------------
YIDD_BORPE      PD----------------------------
YIDD_CHRVO      ------------------------------
YIDD_DESVH      ------------------------------
YIDD_PSESM      ------------------------------
YIDD_PORGI      ------------------------------
YIDD_SHEON      ------KNDRCNK-----------------
YIDD_VIBCH      -----QKQDR-DK-----------------
HLYA_AERHY      -----PFDTREH------------------
YIDD_CHLCV      AVD---DDESCDLHA---------------
YIDD_CHLPN      EID---GGDSSHFSE---------------
YIDD_CHLTR      PLAESPDDRTVPHTQETS------------
YIDD_COXBU      ------------------------------
YIDD_MYCPA      AWAVRATRGESGSLV---------------
YIDD_MYCTU      DWNPASKRGERESFV---------------
YIDD_SYNY3      ------EQGKISS-----------------
YIDD_NITEU      ------------------------------
YIDD_CAUVC      ------------------------------
YIDD_RALSO      TAADAPAARPSIHLPRP-------------
YIDD_RHILO      GRKRAETRA---------------------
YIDD_RHIME      RRKDA-------------------------
YIDD_RHOPA      RGVNAPPPDVAEPCGCGSHSQLTPH-----
YIDD_GLOVI      ------------------------------
YIDD_DEIRA      PPTDQPS-----------------------
YIDD_CORGL      VT----------------------------
YIDD_THEEB      ------------------------------
YIDD_GEOSL      ------------------------------
YIDD_XYLFT      Q-----------------------------
YIDD_CHLTE      KDSK--------------------------
YIDD_LEPIN      KG----------------------------
YIDD_STRAW      KGGPSAAEPAIEGHIPSSPAAETPSHVQGA
YIDD_NOSS1      ------------------------------
YIDD_CALS4      ------------------------------
YIDD_STRR6      ------------------------------
YIDD_STRP8      ------------------------------
YIDD_LACLA      N-----------------------------
YIDD_LACJO      IAQAFHSNKK--------------------
YIDD_LACPL      HRGKKR------------------------
YIDD_ENTFA      YRRNKKTEVEKDG-----------------
YIDD_STAES      ------------------------------
YIDD_BIFLO      RLTPLATTQREAQR----------------
YIDD_BUCAP      ------------------------------
YIDD_BUCBP      ------------------------------
YIDD_BLOFL      ------------------------------
YIDD_HELPJ      FKTITFWLVPTTKSRATYYIIKV-------