CLUSTAL format seed alignment for MF_00388

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LPXC_BRUME        --------MNAYQKTIGRAVTLSGVGIHGGAPASARLLPADAD----TGILFQRSDIKDS
LPXC_BRUAB        --------MNAYQKTIGRAVTLSGVGVHGGAPASARLLPADAD----TGILFQRSDIKDS
Q7VAP0_PROMA      --MEWLPKNYEGAWTLGGAVRRRGVCLHSGQESEVTLLPYDD-----IGFHLSWVNRS--
A5GN69_SYNPW      --MVRWPVDYDGAWTLAGPVHRSGIGLHSGQPVSVTLKPSLE-----PGVWVQWASDD--
LPXC_SYNY3        -----------MGHTIKAPLTVQGVGLHSGVETTVTLCPVAAG----KGRYFQRVDLP--
LPXC_AQUAE        ---------MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEG----TGIRFFKNGV---
LPXC_LEPIC        ------MKEILYRRSIQDTVRIKGIGLHSGKEVNLTAHPAPSG----TGIVFEYRKGL--
LPXC_LEPIN        ------MKEILYRRSIQDTVRIKGIGLHSGKEVNLTAHPAPSG----TGIVFEYRKGL--
I4BB49_TURPD      -------MPKPFRTTVKQPGVYEGVGLHSGEITRLTFLPADCG----EGIVFFRHGGSRD
LPXC_CHLMU        -------MLGRAQRTLKRKVCYSGVGVHFGKPAMLTLEPAEEN----TGVVFSRHAAS-G
LPXC_CHLTR        -------MLGRAQRTLKRKVCYSGVGVHFGKAAMLTLEPAEEN----TGVVFSHHAAS-E
LPXC_CHLPN        -------MLERTQRTLKREVRYSGVGIHLGKSSTLHLQPAQTN----TGIVFQRQSAS-G
C9LRM9_SELS3      ---------MSFQTTIARRVDYDGVGLHSGVLVHLSLLPAPVD----AGIVFVRKDVA-G
D5EGD9_AMICL      ---------MSFLRTIKTPVFFQGTGLHSGEPCRAEIIPFYHK----RGIVFEIG----G
LPXC_HAEIN        ---------MIKQRTLKQSIKVTGVGLHSGEKVTLTLRPAMPN----TGVVYYRTDLNPA
LPXC_PASMU        ---------MIKQRTLKQSIKVTGVGLHSGNKVTLTLRPAMAN----TGVIYCRTDLNPP
LPXC_ECOLI        ---------MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPAN----TGVIYRRTDLNPP
LPXC_VIBCH        ---------MIRQRTLKEIVKTTGVGLHSGRKVTLTLRPAAAN----TGIIYRRTDVNPP
LPXC_SHEVD        ---------MIFQRTVKEMVKTIGVGLHSGNKVTLSIKPAPVN----SGIVLVRTDLEPA
LPXC_PSEAE        ---------MIKQRTLKNIIRATGVGLHSGEKVYLTLKPAPVD----TGIVFCRTDLDPV
LPXC_XYLFA        ---------MSQQRTLNNTIRATGVGLHSGNKIHITLRPAPVN----HGIVFRRVDLDPV
LPXC_RALSO        ---------MLKQRTIKSVVKTVGIGLHSGRKVTLTLRPAAPG----NGIIFTRVDLDPA
LPXC_NEIMA        ----------MLQRTLAKSISVTGVGLHSGERVALTLHPAPEN----SGISFRRTDLDGE
LPXC_NEIMB        ----------MLQRTLAKSISVTGVGLHSGERVALTLHPAPEN----SGISFRRTDLDGE
LPXC_HELPY        ----------MKQTTINHSVELVGIGLHKGVPVKLVLEPLGEN----QGIVFYRSDLGVN
LPXC_HELPJ        ----------MKQTTINHSVELVGIGLHKGVPVKLVLEPLEEN----QGIVFYRSDLGVK
LPXC_CAMJE        ----------MKQLTLAKTVKGVGIGLHKGEPIEITLEPLEAN----SGIVFFRSDLNAS
LPXC_RICPR        ----------MHQSTLLKPVSCYGIGVHTGKRTQLTIEPAKEN----TGIIFIRTDISSE
F2LAL4_BURGS      -MTAAPDGWQASEGTLAAELALDGHGLHTGRRVRVRILPAQGDRPATRGIRFRRLEGG-R
C5ABP8_BURGB      MTSTAPAGWQATQGTLASELVLDGHGLHTGRRVRVRILPAAGRQPATRGIRFRRLDGG-R
B2UAC9_RALPJ      ---MTAPGWASNQGTLARELRLYGRGLHTGKRVNVRVHPER----VGHGIVFRRMRGG-Q
LPXC_CYACA        ----------MYNYTIYHPVKISGRGLYTGINSTITIYPELPH----VGIYFLRTDLTDY
                                ::       *  :: *        *         *           

LPXC_BRUME        AP--VCAHVSQIGATDLCTSLGAR---EARIDTVEHLMAAISALGIDNLVVEIEG-PEVP
LPXC_BRUAB        AP--VCAHVSQIGATDLCTSLGAR---EARIDTVEHLMAAISALGIDNLVVEIEG-PEVP
Q7VAP0_PROMA      EKPVRLNS-NQVVHSELCTTLDL---AFERLATVEHLLAALVGCGLTHVHIVVSG-NEVP
A5GN69_SYNPW      AAPVRLAP-SQVRDSQLCTTLDL---GSRRLATVEHLLAALAGCGLTHALLEVDG-EEIP
LPXC_SYNY3        KKPIIPADLTWVREAMLSTELGE---PGATIRTVEHLLATLVALDIGDLRIEVNG-PEVP
LPXC_AQUAE        ---YIPARHEFVVHTNHSTDLGF---KGQRIKTVEHILSVLHLLEITNVTIEVIG-NEIP
LPXC_LEPIC        EKASISAELSNVVDTSNATTLGD---GIHKIQTVEHLLAAVYALGLTDLILEIDA-VEVP
LPXC_LEPIN        EKASISAELSNVVDTSNATTLGD---GIHKIQTVEHLLAAVYALGLTDLILEIDA-VEVP
I4BB49_TURPD      DRSAVRASLENVIDTSLAVTLGGDTPGQMQLQTVEHLLYALFVLGITDVAIEVEGGTEIP
LPXC_CHLMU        QY--IPARLANVCGTGRSTTLS---SQGGVVSTVEHLLAALYSCGVDNVRIHCSE-DEIP
LPXC_CHLTR        QY--IPARLANVCGTGRSTTLS---LDGSVISTVEHLLASLYSFGVDNVRIYCSE-DEIP
LPXC_CHLPN        NYENVPALLDHVYTTGRSTTLS---RGSAVIATVEHLMAALRSNNIDNLIIQCSG-EEIP
C9LRM9_SELS3      EP-RIRATAPHVTSTVRATTLS---EGGVRVFTVEHLMSALAAFGIDNCLVELDA-EEPP
D5EGD9_AMICL      RR--YPLRDAVFEGSGRGTEIIF--PDNTVVRTVEHLMAALYVLGIGQALIRISG-PEMP
LPXC_HAEIN        V--AFPADPNSVRDTMLCTALINEQ--GVRISTVEHLNAALAGLGIDNIIIEVDA-PEIP
LPXC_PASMU        V--TFPANANAVRDTMLCTCLVNEE--GVRISTVEHLNAALAGLGIDNVIIEVDA-PEIP
LPXC_ECOLI        V--DFPADAKSVRDTMLCTCLVNEH--DVRISTVEHLNAALAGLGIDNIVIEVNA-PEIP
LPXC_VIBCH        V--DFPADPASVRDTMLCTALVNDQ--GVRISTVEHLNAALAGMGIDNAIIEVDA-PEIP
LPXC_SHEVD        V--SIPAKAELVRETTMCTALVNDD--GIRISTIEHLFAALAGLGIDNAIIEVDA-PEIP
LPXC_PSEAE        V--EIPARAENVGETTMSTTLVKG---DVKVDTVEHLLSAMAGLGIDNAYVELSA-SEVP
LPXC_XYLFA        V--EIPASGDLVTEVILCTGLTRN---GAKVQTVEHLMSAFAGLGIDNAIVDLSS-AELP
LPXC_RALSO        V--EIPATASAIGDTRLASVLQKD---GARVSTVEHLMSACAGLGIDNLYVDVDA-EEIP
LPXC_NEIMA        MGEQIKLTPYLINDTRLSSTIVTDK--GVRVGTIEHIMSALSAYGIDNALIELNA-PEIP
LPXC_NEIMB        MGEQIKLTPYLINDTRLSSTIVTDK--GVRVGTIEHIMSALSAYGIDNALIELNA-PEIP
LPXC_HELPY        L----PLKPENIVDTKMATVLGKD---NARISTIEHLLSAVHAYGIDNLKISVDN-EEIP
LPXC_HELPJ        L----PLKPENIVDTKMATVLGKD---NARISTIEHLLSAVHAYGIDNLKISVDN-EEIP
LPXC_CAMJE        Y----KASPENVINTQMATVLGDD---RGFISTIEHLMSAINAYGIDNVRIVLNA-NEAP
LPXC_RICPR        N-NYIEASYCNVSDTLLSTTISNNH--KIQISTIEHLMAALWGCSIDNAIIKIDG-PEVP
F2LAL4_BURGS      ELASFGVDPALRRAQPLCTMLLHPD--GVGVRTVEHLLAALLASEIDHALVELDA-EEVP
C5ABP8_BURGB      ELASFAVDPALRRAQPLCTMLRGPD--GVGVRTVEHLLAALLACEIDHATVELDA-EEVP
B2UAC9_RALPJ      QLALLPASAALRLGQPLCTALQNAD--GWRVRTVEHLLAALLACQIDHATVEIDA-EEVP
LPXC_CYACA        PIVPIIPSTLLVLNSKLSTVLGFHD--DYSIMLIEHLMSAISLSQLTDLKIILEG-PEIP
                                      :         :  :**:        : .  :      * *

LPXC_BRUME        ILDGTSARFIEAVDSVGVVTQDAKRRFIRILKTVRVEA--GNSWGEFRP-YDGTRFEVEI
LPXC_BRUAB        ILDGTSARFIEAVDSVGVVTQDAKRRFIRILKTVRVEA--GNSWGEFRP-YDGTRFEVEI
Q7VAP0_PROMA      LLDGSAMGWVEAISEVGMIPLKDSSSLWP-VLKNALVIHKGTSVITATP-SDRVTLIGII
A5GN69_SYNPW      LLDGSALGWVEAIAEADLLEVPGWHPQRP-ELEHPLALHRGSSVITATP-AEQFSVVGVI
LPXC_SYNY3        LLDGSALSWLTAIAKVGTRPRSKKSQDQPIVITDPLTCQLEDAFVAAFP-CATTRFSYGV
LPXC_AQUAE        ILDGSGWEFYEAIRKNILNQ---NREIDYFVVEEPIIVEDEGRLIKAEP-SDTLEVTYEG
LPXC_LEPIC        IMDGSSLPFLQALESAGIIEYPEIVEPIYIQSPLWVVD--GDKYLVLLP-SDELKVTYTI
LPXC_LEPIN        IMDGSSLPFLQALESAGIIEYPEIVEPIYIQSPLWVVD--GDKYLVLLP-SDELKVTYTI
I4BB49_TURPD      IADGSAGPFIRCLQALELHHYAEKVQPLVVTRPVSVTD--GERYLVAMP-APAFQVSYYI
LPXC_CHLMU        IGDGSSQVFVDLIDQAGVEEQGQTVPIARLTHPVYYQH--QDTILAAFP-SEEFKISYTL
LPXC_CHLTR        IGDGSAQVFMDLIDQAGIQEQEQTVQIARLAHPVYYQY--QDTILAAFP-SDEFKISYTL
LPXC_CHLPN        IGDGSSNVFVELIDQAGICEQEDKVSIARLTRPVYYQH--QDIFLAAFP-SDELKISYTL
C9LRM9_SELS3      VADGSSLVFFSLLKEAGKVQQEKERQEIVIDRVYRIDD--GERFLVAVPYGGGLRVSFTS
D5EGD9_AMICL      ILDGGSLTFAQKLSEVELVETEHHEDPLCLFVPVVERDETQKKIICALP-GEGLSITYVI
LPXC_HAEIN        IMDGSASPFIYLLLDAGIEEQNAAKKFIRIKQYVRVED--GDKWAEFKP-YNGFRLDFTI
LPXC_PASMU        IMDGSASPFIYLLLDAGIEEQNAAKKFIRIKQKVRVED--GDKWAEFTP-YNGFRLDFTI
LPXC_ECOLI        IMDGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVED--GDKWAEFKP-YNGFSLDFTI
LPXC_VIBCH        IMDGSASPFVYLLQQAGIQTLNAPKRFIRIKKPVRIED--GDKWAEFVP-FNGFRMDFEI
LPXC_SHEVD        IMDGSASPFVFLLQSVGIQEQAAPKKYLRIKKNIRVED--GDKWVELKP-YKGFKIDFTI
LPXC_PSEAE        IMDGSAGPFVFLIQSAGLQEQEAAKKFIRIKREVSVEE--GDKRAVFVP-FDGFKVSFEI
LPXC_XYLFA        IMDGSSAPFVFLLQSAGILEQNAAKRFIRIKRSVEVRQ--GDKVAKFSP-YDGYKLGFTI
LPXC_RALSO        IMDGSAASFVFLLQSAGIEEQGAAKRFIRVIKPVEVRD--GDKLARLEP-YFGFKLSFTI
LPXC_NEIMA        IMDGSSLPFIYLLQDAGVVDQKAQKRFLKILKPVEIKE--AGKWVRFTP-YDGFKVTLTI
LPXC_NEIMB        IMDGSSLPFIYLLQDAGVVDQKAQKRFLKILKPVEIKE--AGKWVRFTP-YDGFKVTLTI
LPXC_HELPY        IMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEIRE--SDKFVKIEP-DSQLSLNFTI
LPXC_HELPJ        IMDGSALTYCMLLDEAGIKELDAPKKVMEIKQAVEVRE--GDKFVKIEP-DSQLSLNFTI
LPXC_CAMJE        VMDGSSISFCMMLDEAGVKELDAPKKIMVIKKPIEVRD--GNKFVRLTP-TKEPRINYTI
LPXC_RICPR        IMDGSSKPFVFMIECAGKKLQNAPKKYLKILKEVKVVN--KDCELYCTP-SEHMAVDLTI
F2LAL4_BURGS      ILDGSASPWLAAIRACGRRALAAPKRFIRVLRPLTVADGEGGARREMRIEPAPR---YEL
C5ABP8_BURGB      ILDGSAAPWIAALRATGRHALAAPKRFIRVTRALAVTDGAGGARREMRLEPAPR---YEM
B2UAC9_RALPJ      ILDGSAQPWLQAIEACGRLPLDAPKRFLRILKTVAVEDG--GMHRTI-IEPADH---YAM
LPXC_CYACA        ILDGSSIIWLKLLQQAKIYITSLSNCIIFKSSCTFFIQT-KDTFIISFP-YTSLAINTGI
                  : ** .  :   :                                               

LPXC_BRUME        DFECPLIGR--QKFAHDVDEETF-RKELSTARTFGFMKDVERLWAAGLALGA---SLDNS
LPXC_BRUAB        DFECPLIGR--QKFAHDVDEETF-RKELSTARTFGFMKDVERLWAAGLALGA---SLDNS
Q7VAP0_PROMA      DFPYPAIGK-QM-FSLDLTPQSF-LQDIAPARTFGFKDQIDHLREKGMIKGG---GLDNS
A5GN69_SYNPW      DFPQPAIGR-QQ-FTLELTPQRF-VEEIAPARTFGFRDQVEHLRAAGLIQGG---ALDNA
LPXC_SYNY3        DYPYLPIGK-QW-YTWEPDQENF-ATAIAPARTFGFADQIEKLRQAGLIKGG---SLENA
LPXC_AQUAE        EFKNF-LGR-QK-FTFVEGNE----EEIVLARTFCFDWEIEHIKKVGLGKGG---SLKNT
LPXC_LEPIC        DFNH-PLLK-GQSITVSLDREKI-KQEILPARTFGFLKDVEALQARGLAMGG---SLDNA
LPXC_LEPIN        DFNH-PLLK-GQSITVSLDREKI-KQEILPARTFGFLKDVEALQARGLAMGG---SLDNA
I4BB49_TURPD      DYPH-PLLK-NQAVQLAYDDVTF-VETIGFARTFGFMKDVEYLRSRGLAQGG---SADNA
LPXC_CHLMU        HYSHNSAIG-TQYRSQVISEESF-RKEIAPCRTFALYNELCFLMERGLIGGG---CLGNA
LPXC_CHLTR        HYSHNSTIG-TQYRSLVISEESF-RKEIAPCRTFALYSELCFLMEKGLIGGG---CVGNA
LPXC_CHLPN        HYPQSSTIG-TQYKSLVINEESF-RQEIAPCRTFALYNELCFLMEKGLIGGG---CLDNA
C9LRM9_SELS3      LNEH-ALVG-TQYRDFLVSEDAY-EKEIAPARTIAYEGEVEALKKAGLGLGG---TLENV
D5EGD9_AMICL      EYEN-PVIG-TEIYDFRVTAEGF-LKEIAPCRTFALEEEMDTLKKRGLAKGG---SLDNA
LPXC_HAEIN        DFDHPAIGKDVRNYEMNFSAQAF-VHQISRARTFGFMKDIEYLQSQGLVLGG---SLDNA
LPXC_PASMU        DFEHPAIGKDVRNYVMDFSAQAF-VQQISRARTFGFMKDIEYLQSQGLALGG---SLDNA
LPXC_ECOLI        DFNHPAIDSSNQRYAMNFSADAF-MRQISRARTFGFMRDIEYLQSRGLCLGG---SFDCA
LPXC_VIBCH        EFNHPAIDGDDQRLVFDFSSQGF-VKEISRARTFGFMRDIEYLQSQNLCLGG---SFDCA
LPXC_SHEVD        DFEHPVIARSEQHMKMEFSSSAF-IRDISRARTFGFMRDIEYLRANNLALGG---SMENA
LPXC_PSEAE        DFDHPVFRGRTQQASVDFSSTSF-VKEVSRARTFGFMRDIEYLRSQNLALGG---SVENA
LPXC_XYLFA        EFDHPMIPHKQSHYEMEFSTAAY-IKEISLARTFGFMHDLEDMRERNLGLGG---SMDNA
LPXC_RALSO        EFRHPAVDKTGQTFEIDFADTSY-TREIARARTFGFAHEVEMLREIGLARGG---SLDNA
LPXC_NEIMA        EFDHPVFNRSSPTFEIDFAGKSY-IDEIARARTFGFMHEVEMMRAHNLGLGG---NLNNA
LPXC_NEIMB        EFDHPVFNRSSPTFEIDFAGKSY-IDEIARARTFGFMHEVEMMRAHNLGLGG---NLNNA
LPXC_HELPY        DFNHPVIAK--QAHHFVFSKTAY-KEQVAKARTFGFLQEVNYLRSIGLAKGG---SLNNC
LPXC_HELPJ        DFNHPVIAK--QAHHFVFSKTAY-KEQVAKARTFGFLQEVNYLRSIGLAKGG---SLNNC
LPXC_CAMJE        KFDNAVIGE--QSYNFEFSKKNY-IENIARARTFGFLKDVQALRSMNLALGG---SLENT
LPXC_RICPR        DFSSKAIGRQNLSFGMQES---F-TKNIADARTFGFIRDVEYLKSKGLAQGA---SFENA
F2LAL4_BURGS      SVRNDLKGFGEMHWSGAITPAAF-AAEIAPSRSYGRVKWAVPAILAGYLRGVPILRGARP
C5ABP8_BURGB      SVRNDLKGFGEMHWAGEMTPAAF-AAEIAPSRSYGRVKWAVPAIVAGYLRGVPILRGARP
B2UAC9_RALPJ      SVTNDLKGFGEMNWQGIIDPVSF-ASDIAPSRSYGRLRWAVPAILFGYLRGQPILRGARP
LPXC_CYACA        DFKNCLAIKSQWITILDLLINRFELVGIASSRTFGDFNQINILINEGFFQGA---NLYNA
                                             :  .*:             .   *         

LPXC_BRUME        LVIGDDNSIVNADGLRFKDEFVRHKTLDAVGDLALAGLPFIGCFSSYRGGHRLNSEAVKA
LPXC_BRUAB        LVIGDDNSIVNADGLRFKDEFVRHKTLDAVGDLALAGLPFIGCFSSYRGGHRLNSEAVKA
Q7VAP0_PROMA      LVCDGK-SWINPP-LRFKDEPVRHKLLDLIGDLALVG-LPKAQVLVYKGSHALHVELAKS
A5GN69_SYNPW      LVCDGE-HWLNPP-LRFPDEPVRHKLLDLIGDLALVG-FPRAQVLVYRGSHGLHADLAAA
LPXC_SYNY3        LVCDKE-KWLNPP-LRFPDEPVRHKLLDLLGDLSLLGKIPQAHFVAYKASHKLHTQLAQK
LPXC_AQUAE        LVLGKD-KVYNPEGLRYENEPVRHKVFDLIGDLYLLGSPVKGKFYSFRGGHSLNVKLVKE
LPXC_LEPIC        IVLTQD-GYLNQQ-LRFENECVRHKILDLFGDISIAGRPIIGHYLASKAGHALDISMAKL
LPXC_LEPIN        IVLTQD-GYLNQQ-LRFENECVRHKILDLFGDISIAGRPIIGHYLASKAGHALDISMAKL
I4BB49_TURPD      VIYMPD-GTTMNE-FRFARESVYHKILDLIGDLALIGRPIQGHVLGARGGHALDVAFGKK
LPXC_CHLMU        VLFKDD-SVISLGKLRFPDEPVRHKMLDLIGDLSLIGKPFLAHIIAVGSGHSSNIALGNK
LPXC_CHLTR        VLFKDD-GVISLGKLRFPDEPVRHKILDLIGDLSLVGTPFLAHVIAVGSGHSSNIALGNR
LPXC_CHLPN        VVFKDD-GIISRGQLRFADEPVRHKILDLIGDLSLVGRPFVAHVLAVGSGHSSNIAFGKK
C9LRM9_SELS3      IVYNDE---RWLNELRFPDELVRHKILDLIGDLRLAGF-VRGHILAVKSGHALNAQLAKA
D5EGD9_AMICL      VLVTSQ-KALNKRGLYFSDEFVRHKILDLIGDIALLGRPLHAHIVAIRTGHDMHLRLLRR
LPXC_HAEIN        IVLDDY-RILNEDGLRFKDELVRHKMLDAIGDLYMAGYNIIGDFKAYKSGHGLNNKLLRA
LPXC_PASMU        IVLDDY-RILNEDGLRFKDELVRHKMLDAIGDLYMAGYNIIGDFKAYKSGHGLNNKLLRA
LPXC_ECOLI        IVVDDY-RVLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQA
LPXC_VIBCH        IVLDDY-RILNEEGLRFDNEFVTHKVLDAIGDLYMAGHAIVGEFRAYKSGHGLNNQLLRA
LPXC_SHEVD        VVLDEY-KVLNPDGLRYEDEFVKHKILDAFGDLYVAGYAIVGEFCAYKTGHALNNRLVRA
LPXC_PSEAE        IVVDEN-RVLNEDGLRYEDEFVKHKILDAIGDLYLLGNSLIGEFRGFKSGHALNNQLLRT
LPXC_XYLFA        ILLDDF-RVLNEDGLRYGNEFVRHKILDAIGDLYLIGGPILGAYEAFKSGHALNNKLVRA
LPXC_RALSO        IVLDEH-RMLNNDELRYGDEFVRHKILDAIGDLYVVGYPLIAAYTAHKSGHGLNNALLRA
LPXC_NEIMA        IVIDDT-DVLNPEGLRYPDEFVRHKILDAIGDLYIVGHPIIGAFEGYKSGHAINNALLRA
LPXC_NEIMB        IVIDDT-DVLNPEGLRYPDEFVRHKILDAIGDLYIVGHPIVGAFEGYKSGHAINNALLRA
LPXC_HELPY        IVLDEN-SILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKA
LPXC_HELPJ        IVLDEN-SILNKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKA
LPXC_CAMJE        IVVDEN-RILNPEGLRFKDEFVRHKILDAIGDLTLLGYRVFGDYTSYAGSHHLNHLLTKE
LPXC_RICPR        IGIDEHDKVLNPSGLRYADEFVRHKLLDLFGDLYTSGISVVSAIKGYKTSHAFNNELLHK
F2LAL4_BURGS      SCTASIVGSRVLGGLRVPDEFVRHRVLDLVGDLAMAGAPLLARVTALRPSHEMNFRLVDA
C5ABP8_BURGB      SCTASIVGRRVLGGMRLPDEFVRHRVLDLVGDLAMAGAPLLARVSALRPSHEMNFRLVDA
B2UAC9_RALPJ      SCTATIVGSGVIGGMRLPMEFVRHRVLDLIGDLALLGAPLLGKVTALRPSHEMNYRLCAA
LPXC_CYACA        LAFQLG--NWCNGPLRFICEPAKHKVLDLIGDLRLLGVYNMFFLIGYKTNHFVNSQLVQF
                                :    * . *: :* .**:   *            .*  .      

LPXC_BRUME        LLSDETAFEIIEA---------------------
LPXC_BRUAB        LLSDETAFEIIEA---------------------
Q7VAP0_PROMA      ISRECSLTKSCFD---------------------
A5GN69_SYNPW      LADRSPVQP-------------------------
LPXC_SYNY3        IADTYR----------------------------
LPXC_AQUAE        LAKKQKLTRDLPHLPSVQAL--------------
LPXC_LEPIC        VMSNVTGDEISKYKSRRIPLFKRKAVVV------
LPXC_LEPIN        VMSNVTGDEISKYKSRRIPLFKRKAVVV------
I4BB49_TURPD      LVQAFG----------------------------
LPXC_CHLMU        ILEALQYEQELVK---------------------
LPXC_CHLTR        ILEALQHEQELVK---------------------
LPXC_CHLPN        ILEALEL---------------------------
C9LRM9_SELS3      ICTSLA----------------------------
D5EGD9_AMICL      LKQLESRQQ-------------------------
LPXC_HAEIN        VLANQEAWEFVTFEDKAQ--VPQGYVAPVQVLI-
LPXC_PASMU        VLANQEAWEFVTFDDKQA--VPHGYEAPTQVLI-
LPXC_ECOLI        VLAKQEAWEYVTFQDDAE--LPLAFKAPSAVLA-
LPXC_VIBCH        VLADQEAWEWATFEEEVG--SPVAFAEPNMVLA-
LPXC_SHEVD        LLAQQDAWELVSFETERE--APVSFSVPSGAVFA
LPXC_PSEAE        LIADKDAWEVVTFEDART--APISYMRPAAAV--
LPXC_XYLFA        VLADETSWEWISFPSSAAEQPPVVYTHPACI---
LPXC_RALSO        LLADEAAYEIVTFDKVEE--APRAFLPQLQPAFS
LPXC_NEIMA        VLADETAYDRVEFADSDD--LPDAFHELNIRTCG
LPXC_NEIMB        VLADETAYDRVEFADSDD--LPDAFHELNIRTCG
LPXC_HELPY        ILADAKNYEVLIAADPAK---EFALQKAFA----
LPXC_HELPJ        ILADAKNYEVLIASDPAK---EFALQKAFA----
LPXC_CAMJE        VLKDKDAYEI-VSLEKTT---QKAYEKVFA----
LPXC_RICPR        IFSDTTSYKFVTSNEL------------------
F2LAL4_BURGS      LLSTPDAWEWVELRA-------------------
C5ABP8_BURGB      LLSSPDAWEWAEFAA-------------------
B2UAC9_RALPJ      LLARPDAWEWAYPTH-------------------
LPXC_CYACA        FKKLDK----------------------------
                  .