CLUSTAL format seed alignment for MF_00394

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GPDA_RICTY       --------------MNKFKNIAVYGGGSFGTSLASVVARNCNN---VTLFLRNETILKEI
GPDA_RICPR       --------------MNKFKNIAVYGGGSFGTSLASLVARNCNN---VTLFLRDEIILKEI
GPDA_RICCN       --------------MNKFKNIAVYGGGSFGTSLASLAAQNCNN---VTLFLRDEAIAKEI
GPDA_RICFE       --------------MNKFKNIAVYGGGSFGTSLASLAAQNCNN---VTLFLRDEEIAKEI
GPDA2_MYCTU      -----------MAANKREPKVVVLGGGSWGTTVASICARRG-P---TLQWVRSAVTAQDI
GPDA_PSEAE       -------------MTEQQP-IAVLGGGSFGTAIANLLAENGQA---VRQWMRDPEQAEAI
GPDA_HELPY       ------------------MEIAVFGGGAWGRALAFAFGEKNEV---KIISRRDLNEPLKK
GPDA_HELPJ       ------------------MEIAVFGGGAWGRALAFAFGEKNEV---KIISRRDLNEPLKK
GPDA_CAMJE       ------------------MRIAVIGAGKWGSALHLALKENHNC---FISSLH-----QRD
GPDA_AQUAE       -----------------MHEIFYTGCGKVGNTLATHLDRKGHE---VLLYDINEEVVKKI
GPDA_SYNY3       ---------MSFANADTPPQVVVLGAGAWGSSLAYVLNNND------IPTQVWSRRSPQS
GPDA_NEIMA       ------------------MKITVIGAGSWGTALALHFSQHGNR---VSLWTRNADQVRQM
GPDA_NEIMB       ------------------MKITVIGAGSWGTALALHFSQHGNR---VSLWTRNADQVRQM
GPDA_PAULE       ------------------MRISILGAGAWGTALAIALAERHD----VVLWGRSEDAMAQR
GPDA_ECOLI       -----MNQ--------RNASMTVIGAGSYGTALAITLARNGHE---VVLWGHDPEHIATL
GPDA_VIBCH       -----MSETQNHNSYGKPVEMTVIGAGSYGTSLAISLARNGAN---IVLWGHDAEHMARL
GPDA_HAEIN       -------------MITSQTPITVLGAGSYGTALAITFSRNGSP---THLWGHNPAHIAQM
GPDA_PASMU       -----------MNTTVATSPITVLGAGSYGTALAIAFSRNGFP---TYLWGHDPVHMQRL
GPDA_XYLFA       -------------MIDSKQKIAVLGAGSWGTALAALVARHAYP---TILWGRDVGVIQSI
GPDA_CAUVC       MTFEKVG---------------VIGAGAWGTALAQVAARAGLA---VTLQAREPEIVAAI
GPDA_RHILO       MTGEAVSGQDVSNPGKSSWRVTVLGGGAWGTALALAMLRAGHK---VRLFARDPQTVAAI
GPDA_MYCLE       MAGIVVR---------SESAVAVMGAGAWGTALAKVLIDAGGPEAGVVLWARRPDVAERI
GPDA_MYCTU       MAGIA-------------STVAVMGAGAWGTALAKVLADAGGE---VTLWARRAEVADQI
GPDA_STRCO       MSKPV--------------KAAVFGTGSWGTAFGTVLADAGCE---VTLWGRRAALADAV
GPDA_DEIRA       MTQGS--------------ALPVLGAGGWGTALAVAAARAGQP---ARLWARRPDFAARL
GPDA_BACHD       -----------------MKNVAVIGAGSWGTALSLVLADNGHH---VTLVARREEIAREI
GPDA_BACSU       -----------------MKKVTMLGAGSWGTALALVLTDNGNE---VCVWAHRADLIHQI
GPDA_LACLA       ---------------MNPQKIAVLGPGSWGTALSQVLNDNGHE---VRIWGNNPEQMAEI
GPDA_STRP1       ---------------MTKQKVAILGPGSWGTALSQVLNDNGHD---VRLWGNIPDQIEEI
GPDA_CHLMU       ----------------MKETIAYLGMGMWGFSLANLLANNGHR---VVGWARNPSLIEQL
GPDA_CHLTR       ----------------MKETIAYLGMGMWGFSLANLLANNGHR---VVGWARNPALIEQL
GPDA_CHLPN       ----------------MKQHIGYLGMGIWGFCLASLLANKGYP---VVAWSRNPDLIKQL
GPDA_TREPA       -----------------MASIAILGGGAWGTALAASLTVNGHT---VMLWARRRQTCDAI
GPDA_METTH       ------------------MMVTVIGAGSFGTAIAQVLSWNAEM---VRLMARRSEVVENI
GPDA_ARCFU       ------------------MIVSILGAGAMGSALSVPLVDNGNE---VRIWGTEFDTEILK
                                         * *  *  .                           

GPDA_RICTY       LYKKTNVQYLGDIKLPTNLQATTNLSVIKDFDL-----IIIAVPSYAFVDAIKLLKTYG-
GPDA_RICPR       LYKKTNAQYLGDIELPTNLQATTNLSVIKDFEL-----IIIAVPSYAFDDSIKLLKTYG-
GPDA_RICCN       LHNKTNVKYLGDIKLPAHLQATTNLDIIKDFEL-----IIIALPSYAFDDSIKLLKTHS-
GPDA_RICFE       LHNKTNVKYLGDIKLPTHLQVTTNLSVIKDFEL-----IIIAVPSYAFDDSIKLLKTHG-
GPDA2_MYCTU      NDNHRNSRYLGNDVVLSDTLRATTDFTEAANCA---DVVVMGVPSHGFRGVLVELSKE--
GPDA_PSEAE       RTRRENPRYL-KGVKVHPGVDPVTDLERTLADC---QLIFVALPSSALRKVLQPHQAA--
GPDA_HELPY       LNDALI-------SKGSAPIEQ----VDLQRGL---KATLYVIAISVQHLREWFQNAS--
GPDA_HELPJ       LNDALI-------SKGSAPIEQ----VDLERGL---KAALYVIAISVQHLREWFQNAS--
GPDA_CAMJE       LEDF----------------------VSIKEAL---ECEYLVFALSSQGMRAWLKENF--
GPDA_AQUAE       NEGIHP-------YVEGIRFKNVKATTDLNQIN---EFKNLICALPVQVIPKVITKVN--
GPDA_SYNY3       LESM------------------------VAGAD---VIVSAVSIKGVPSVAARLEAMD--
GPDA_NEIMA       QEARENKRGLPGFSFPETLEVCADLADALKD----SGLVLIVTSVAGLRSSAELLKQY--
GPDA_NEIMB       QEARENKRGLPGFSFPETLEVCADLADALKD----SGLVLIVTSVAGLRSSAELLKQY--
GPDA_PAULE       ARSXENTAYLPGHPLPAALKATADFSLALDHVAQGDGLLIAATSVAGLRPLAQQLQGK--
GPDA_ECOLI       ERDRCNAAFLPDVPFPDTLHLESDLATALAA----SRNILVVVPSHVFGEVLRQIKPL--
GPDA_VIBCH       DADRANHEFLPGIAFPDTLIVETDLQKAVQA----SRDLLVVVPSHVFGIVLKSLQPH--
GPDA_HAEIN       QTERQNYRFLPDVIFPEDLHLESNLAQAMEY----SQDILIVVPSHAFGEILIKIKPH--
GPDA_PASMU       SEERQNNAFLPNIAFPDALHIEFDLASALSQ----SRDLLIVVPSHVFGEVIDKIKPY--
GPDA_XYLFA       DIQRQNFRYLPSIMLPQTLRATTDLAAAVSG----ADWVLVAVPSYAFTETLRRLAPL--
GPDA_CAUVC       NDTHENAVFLPGIALEPGIKAVADLAD-LADCD----LILAVAPAQHLRAALTAFAPH--
GPDA_RHILO       GQG-QNPRYLPGIAIAPGIEATSDIAAALSGAD----CVLAVTPAQSLRATLAVAKDN--
GPDA_MYCLE       NTTRCNRAYLPGTLLPPGIRATADPADALRGAS----TVLLGVPAQRMRANLERWGGL--
GPDA_MYCTU       NTTRYNPDYLPGALLPPSIHATADAEEALGGAS----TVLLGVPAQTMRANLERWAPL--
GPDA_STRCO       NSTRTNPDYLPGVELPENLRATTDAAEAARDAD----FTVLAVPSQTLRAGLADWTPL--
GPDA_DEIRA       AEVRENREYLPGVLLPPEVAVTSDLPGAVAGAD----FALLVVPSVGVPELLAG------
GPDA_BACHD       NERHTNETYLPSIEIPSSIVATCSMEEII-DVEII----VLVVPTKAIRQAVRSLNDV--
GPDA_BACSU       NELHENKDYLPNVKLSTSIKGTTDMKEAVSDADVI----IVAVPTKAIREVLRQAVPF--
GPDA_LACLA       NEKHTNTRYFKDVVLDEKIKAFDRLDLALEDVDAI----LFVVPTKVTRLVAKQVAEV--
GPDA_STRP1       NTKHTNRHYFKDIVLDKNITATLDLGQALSDVDAV----LFVVPTKVTRLVARQVAAI--
GPDA_CHLMU       STQR-QHPAAPHVTIPSNLSFTSSMEEALDGATMI----VEGVTSAGMRPVLNQLKSI--
GPDA_CHLTR       SVQR-RHPAAPHISIPQNLSFTSHMEEALDGATMI----VEGVTSAGMRPVLTQLKAL--
GPDA_CHLPN       QEER-RHPLAPNVVISPNLSFTTDMKEAIHNAFMI----VEGVTSAGIRPVAEQLKQI--
GPDA_TREPA       NARNENVQYLPGITLPAALCASPDMAYVCAGAD----LIVLAVPSCYLAEVAALMNTTPR
GPDA_METTH       NRTRENSAYHPGVKLRDNIEATLMDGSVLEESE----YVFMAVPSGNLRSIVRSMNSS--
GPDA_ARCFU       SISAGREHPRLGVKLNGVEIFWPEQLEKCLENA---EVVLLGVSTDGVLPVMSRILPY--
                                                                             

GPDA_RICTY       ---------ISKDNTLLVATKGFA---HNPTELLSDRLNTLLPDNP---IGFLSGPNLAK
GPDA_RICPR       ---------ISKEHTILVATKGLA---DNPTELFSDRLNTLLPDNP---IGFLSGPNLAK
GPDA_RICCN       ---------ISKDNTLLIATKGFA---RNPTALLSDRLKTLLPYNP---TAFFVGPNLAK
GPDA_RICFE       ---------ISADNTLLIATKGFA---RNPTELFSDRLKTLLPHST---TAFFAGSNLAK
GPDA2_MYCTU      ---------LRPWVPVVSLVKGLE---QGTNMRMSQIIEEVLPGHP---AGILAGPNIAR
GPDA_PSEAE       ---------LTDKL-LVSLTKGIE---AHTFKLMSEILEEIAPQAR---IGVISGPNLAR
GPDA_HELPY       ---------LPKNAKVLIASKGIE---VLNKAFVSEIAKDFIDPNS---LCFLAGPSFAA
GPDA_HELPJ       ---------LPKNAKVLIASKGIE---VLNKAFVSEIAKDFIDPNA---LCFLAGPSFAA
GPDA_CAMJE       ---------INKGQKILIASKGIE---DQSCQFLDEIFLDFVPKEN---FCVLSGPSFAA
GPDA_AQUAE       ---------LK-GKNFISASKGII---HENLKRISQLVKEIEPKLK---FFVLSGPSFAE
GPDA_SYNY3       ---------LQRRTILVTATKGLD---PETMTTPSQIWQAALPSQP---IAVLSGPNLSK
GPDA_NEIMA       ---------GAGHLPVLAACKGFE---QDTGLLTFQVLKEVLPDNKK--IGVLSGPSFAQ
GPDA_NEIMB       ---------GAGHLPVLAACKGFE---QDTGLLTFQVLKEVLPDNKK--IGVLSGPSFAQ
GPDA_PAULE       ---------AIPNLVWL--CKGLE---EGSGLLPHQVVREVLGTQLP--AGVLSGPSFAQ
GPDA_ECOLI       ---------MRPDARLVWATKGLE---AETGRLLQDVAREALGDQIP--LAVISGPTFAK
GPDA_VIBCH       ---------LRADSRICWATKGLE---PETGRLLQDVAHDVLGDSYP--LAVLSGPTFAK
GPDA_HAEIN       ---------LKAHHRLIWATKGLE---RNTGRLLQTVVEEQLGTQYP--LAVLSGPTFAK
GPDA_PASMU       ---------LRPDHRIAWATKGLE---RNTGRLLQEVIEEKLGTQHP--LAVLSGPTFAK
GPDA_XYLFA       ---------LSTGVGVAWATKGFE---PGSGRFLHEVAREILGGDAP--LAVVTGPSFAK
GPDA_CAUVC       ---------RKAGAPVVLCSKGVE---QGSLKLMTDVAAEALPGAP---IAVLSGPSFAG
GPDA_RHILO       ---------MPDGIPLVLCAKGIE---RDTGALLSAIVEEILPRNP---VAALSGPSFAT
GPDA_MYCLE       ---------VADGATLVSLAKGIE---LGTLMRMSQVIVSVTGVDPAQ-VAVLSGPNLAS
GPDA_MYCTU       ---------LPEGATLVSLAKGIE---LGTLMRMSQVIISVTGAEPPQ-VAVISGPNLAS
GPDA_STRCO       ---------LAPGTVLVSLMKGVE---LGSAMRMSEVIGDVAKVGAER-IAVVTGPNLAR
GPDA_DEIRA       ---------LPRELGVVLCAKGLA---PDG----SRLSEYAAGLGFDR-VAVLSGPNHAE
GPDA_BACHD       ---------LKWPVTIVHASKGIE---PGSHLRISEMIEEELEPTLLKEVVVLSGPSHAE
GPDA_BACSU       ---------ITKKAVFVHVSKGIE---PDSLLRISEIMEIELPSDVRKDIVVLSGPSHAE
GPDA_LACLA       ---------LKHKVHILHASKGLE---QGTHERISTILEEEIPAQLRGEIVVVSGPSHAE
GPDA_STRP1       ---------LDHKVVVMHASKGLE---PETHERLSTILEEEIPAHFRSEVVVVSGPSHAE
GPDA_CHLMU       ---------TDLQIPLVITSKGIE---QNTGLLLSEIALEIFGKPAAKYLGYLSGPSIAS
GPDA_CHLTR       ---------TELRVPLVITSKGIE---QNTGLLLSEIALEIFGRPAAQHLGYLSGPSIAS
GPDA_CHLPN       ---------TDLSVPFVITSKGIE---QNTGLLLSEIMLEVLGDSVTPYLGYLSGPSIAK
GPDA_TREPA       FQRLRTAAVGQEYPLIGILTKGFIPDQEGMPHLITDALGALLPSGAHGQLVYISGPSHAQ
GPDA_METTH       ----------LEDKKIVSCIKGIE---HPGLKTMSSVIREETGSRT---VFSISGPNFAD
GPDA_ARCFU       ----------LKDQYIVLISKGLI--DFDNSVLTVPEAVWRLKHDLRERTVAITGPAIAR
                                     **.                             . *.  : 

GPDA_RICTY       ELAKNLHTSASIASLDIDIANKIAHNLS-SKTFTTNTTIDIVTLQVAGALKNIFAIKSGI
GPDA_RICPR       ELAKNLPASASIASLDIDIANKIAYNFS-SKTFSTNTTIDIVTLQIAGALKNIFAIKSGI
GPDA_RICCN       ELAKNLPASASIASLDIDIANKIAYNLS-SKIFTTNVSSDIVTLQVAGALKNIFAIKSGI
GPDA_RICFE       ELAKNLPASASIASLDIDIANKIANNLS-SKTFTTNTTSDIVTLQVAGALKNIFAIKSGI
GPDA2_MYCTU      EVAEGYAAAAVLAMPDQHLATRLSAMFR-TRRFRVYTTDDVVGVETAGALKNVFAIAVGM
GPDA_PSEAE       EIAEHELTATVVASEDDELCARVQAALH-GRTFRVYASRDRFGVELGGALKNVYAIMAGL
GPDA_HELPY       EIIQGLPCALVIHSNNQALALEFANKT--PSFIRAYAQQDIIGGEIAGAYKNVIAIAGGV
GPDA_HELPJ       EIIQGLPCALVIHSNNQALALEFANKT--PSFIRAYAQQDIIGGEIAGAYKNVIAIAGGV
GPDA_CAMJE       EVMQKLPTALMISGINQELCKKFASFF--PDFIKTYIDNDVRGAEICGAYKNVLAIASGI
GPDA_AQUAE       EVSKGLPTAIVLAYEDKEEAMKLQDALD-SENFNVYLNDDITGVELGGALKNVIAIAVGL
GPDA_SYNY3       EIDQGLPAATVVASSDQAAAEEIQTIFA-ADNFRVYTNNDPLGTELGGTLKNVMAIAVGV
GPDA_NEIMA       ELAKQLPCAVVLASENQEWVEELVPQLN-TSVMRLYGSTDVIGVAVGGAVKNVMAIATGL
GPDA_NEIMB       ELAKQLPCAVVLASENQEWIEELVPQLN-TTVMRLYGSTDVIGVAVGGAVKNVMAIATGL
GPDA_PAULE       EVAQGLPCALVIAAEDAALRELVVAAVH-GPAIRVYSSDDVVGVEVGGAVKNILAIATGI
GPDA_ECOLI       ELAAGLPTAISLASTDQTFADDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGM
GPDA_VIBCH       ELAMGMPTAISVASPDAQFVRDLQEKIHCSKTFRVYANSDFIGMQLGGAVKNVIAIGAGM
GPDA_HAEIN       ELAQGLPSAITLAANNEQFAREFQSRIHCSKGFRVYINSDMTGVQLGGAIKNVIAIGAGI
GPDA_PASMU       ELAAGLPTAIALASNNEQFALEFQARIHCSKHFRVYINQDMIGVQLGGAIKNVIAISAGM
GPDA_XYLFA       EVTLGLPTAVTVHGEYARFTQMVANAMH-GPMFRAYTGNDVIGAELGGAMKNVLAVAIGV
GPDA_CAUVC       EVARNLPAAVTLACEDEALGRAIAEAIA-IPTFRPYTANDLIGAEAGGAVKNVLAIACGI
GPDA_RHILO       DVARGLPTAVVVAARDEALAADLAARFS-AQNLRCYSSDDLIGVEIGGALKNVFAIAAGA
GPDA_MYCLE       EIAQCQPAATVIACSDLGRAVALQRMLS-SGYFRPYTNSDVVGTEIGGVCKNVIALACGM
GPDA_MYCTU       EIAECQPAATVVACSDSGRAVALQRALN-SGYFRPYTNADVVGTEIGGACKNIIALACGM
GPDA_STRCO       EIAARMPAAAVVACPDETVAQRLQAACH-TPYFRPYTNTDVVGCELGGAVKNVIGLAVGI
GPDA_DEIRA       EIGRGLPAATVVASRDPALAAAVQTALM-SPSLRVYTSRDVPGVELGGVLKNVIAVAAGM
GPDA_BACHD       EVSLRQPTTVTVSSKSLSTTKQIQDLFM-NQQFRVYTNEDLIGVEIGGALKNIIALACGL
GPDA_BACSU       EVGLRHPTTVTASSKSMRAAEEVQDLFI-NHNFRVYTNPDIIGVEIGGALKNIIALAAGI
GPDA_LACLA       ETIVRDITLISAASKDHDEAKYAQAIFS-NDYFRLYTNTDVIGVETAGALKNIIAVGAGA
GPDA_STRP1       ETIVRDITLITAASKDIEAAKYVQSLFS-NHYFRLYTNTDVIGVETAGALKNIIAVGAGA
GPDA_CHLMU       EVLRGCPCSVVISAYDPATLKQIHQAFL-TPTFRVYPNSDLKGVALGGALKNVIAIACGI
GPDA_CHLTR       EVLRGCPCSVVISAYNPDTLKQIHRAFL-TPTFRVYPNSDLKGVALGGALKNVIAIACGI
GPDA_CHLPN       EVLNGSPCSVVVSAYDSQTLKQIHEAFS-LPTFRVYPNTDIKGAALGGALKNVIAIACGI
GPDA_TREPA       EVAQGKVTGLIAASQNPMAAIRVRELLR-SKRVQVYSSLDVVGVQVCAAVKNVIAIAFGL
GPDA_METTH       ELIRGMTSGITVGA-STRYAREIAGLLK-SPRIILDHSENVEGVEFCGILKNVYAVAMGI
GPDA_ARCFU       EVAKRMPTTVVFSSPSESSANKMKEIFE-TEYFGVEVTTDIIGTEITSALKNVYSIAIAW
                 :                               .      :       .  **: .:  . 

GPDA_RICTY       DLARE-----QGANSRAMLIVAALKEITTLSKVLGGMQK----NSDILLEAGVVGDLVLT
GPDA_RICPR       DLARE-----QGANSRATLIVGALKEITTLSKVLGGMQK----NSDILLEAGVLGDLVLT
GPDA_RICCN       DLARK-----QGENARATLIVAALKEIAILSKALGGMQK----NSDILLE-GVVGDLVLT
GPDA_RICFE       DLAKK-----QGKNARATLIVTVLKEIAILSKALGGTASSRSLDTNLLLEAGVVGDLVLT
GPDA2_MYCTU      GYSLG-----IGENTRALVIARALREMTKLGVAMGGKSE-------TFPGLAGLGDLIVT
GPDA_PSEAE       AAAMD-----MGENTRSMLITRALAEMTRFAVKLGANPM-------TFLGLAGVGDLIVT
GPDA_HELPY       CDGLK-----LGNSAKASLLSRGLVEMQRFGAFFGGKTE-------TFLGLSGAGDLFLT
GPDA_HELPJ       CDGLK-----LGNSAKASLLSRGLVEMQRFGAFFGGKTE-------TFLGLSGAGDLFLT
GPDA_CAMJE       SDGLK-----LGNNARAALISRGLIEMHRFGKFFGTKEE-------TFLGLSGAGDLFLT
GPDA_AQUAE       SDGMG-----YGYNARSAIITRGLHEMANVGEKFGARRE-------TFFGLSGAGDLILT
GPDA_SYNY3       CEGLG-----LGTNAKSALITRALPEITRVGLHFGAQPD-------TFWGLAGLGDLLAT
GPDA_NEIMA       SDGLE-----YGLNARAALVTRGLAEITRLASAMGAQPK-------TMMGLAGIGDLILT
GPDA_NEIMB       SDGLE-----YGLNARAALVTRGLAEITRLASAMGAQPK-------TMMGLAGIGDLILT
GPDA_PAULE       LDGMS-----LGLNARAALITRGLAEITRLGIALGARAE-------TFMGLAGVGDLILT
GPDA_ECOLI       SDGIG-----FGANARTALITRGLAEMSRLGAALGADPA-------TFMGMAGLGDLVLT
GPDA_VIBCH       SDGIG-----FGANARTALITRGLAEMSRLGAALGAQPE-------TFMGMAGLGDLVLT
GPDA_HAEIN       SDGMG-----FGANARTALITRGIAEITRLGISLGANTN-------TFMGMSGLGDLVLT
GPDA_PASMU       SDGMG-----FGANARTALITRGIAEISRLGASLGANPN-------TFMGMSGLGDLVLT
GPDA_XYLFA       ADGMQ-----LGMNARAGLITRGLNEMLRLSAVIGARPE-------TLMGLAGLGDLVLT
GPDA_CAUVC       VEGKG-----LGRNAHATVITRGFAELTRLAVALGARPE-------TVAGLCGLGDLVLT
GPDA_RHILO       VTGAG-----LGASAQAAMVTRGFVELRRIGAAFGARPE-------TLMGLSGLGDLLLT
GPDA_MYCLE       AAGVG-----FGENTAATIITRGLAEIIRLGMALGAQVT-------TLAGLAGVGDLVAT
GPDA_MYCTU       AVGIG-----LGENTAAAIITRGLAEIIRLGTALGANGA-------TLAGLAGVGDLVAT
GPDA_STRCO       ADGMG-----LGDNAKGSLITRGLAETTRLGVALGADPL-------TFSGLAGLGDLVAT
GPDA_DEIRA       GDGLH-----LGDNAKATLLTRGLREMNRYLRSLGAEEE-------TVYGLSGLGDLIAT
GPDA_BACHD       TNGLG-----YGDNTKAAIMTRGLAEIGRLGVKLGASPL-------TFAGLSGLGDLIVT
GPDA_BACSU       TDGLG-----YGDNAKAALITRGLAEIARLGTKMGGNPL-------TFSGLTGVGDLIVT
GPDA_LACLA       LHGLG-----FGDNAKAAIITRGLAEITRLGVAMGAEPL-------TYSGLSGVGDLIVT
GPDA_STRP1       LHGLG-----YGDNAKAAVITRGLAEITRLGVKLGADPL-------TYSGLSGVGDLIVT
GPDA_CHLMU       SDGFR-----FGDNAKSGLVTRGLHEIRKFATIMGCRPD-------TLNGLAGLGDLCTT
GPDA_CHLTR       SDGFR-----FGDNAKSGLVTRGLHEIRKFATIMGCRPD-------TLNGLAGLGDLCTT
GPDA_CHLPN       AEGLS-----FGNNAKAGLVTRGLHEMRKLAAIMDCKPE-------TLNGLAGLGDLCVT
GPDA_TREPA       LDAMAEHSEAFGDNTESMLLAAGLNEIQTIGKQLGSTHP------ETFTSLAGIGDLDVT
GPDA_METTH       LDGQI-----TGENHRHSLLTLCFREMNLILNEMGYGEL--------HDRFCGFGDFLLT
GPDA_ARCFU       IRGYESRKNVEMSNAKGVIATRAINEMAELIEILGGDRE-------TAFGLSGFGDLIAT
                   .          .    :    : *       :.                   **:  *

GPDA_RICTY       CYSLGSRNTKFGYEFEISMDKKKFLREY-----------KELVEGREALKLVLDLIKKYN
GPDA_RICPR       CYSLGSRNTKFGYEFEISRDKKKFLCEY-----------KELVEGREALKLVLDLIKKYN
GPDA_RICCN       CYSLGSRNTKFGYELGISSDKKKFLQEY-----------KELAEGREALKLVLDLIKKYN
GPDA_RICFE       CYSLGSRNTKFGYELGISSDKKIFLREY-----------KELVEGQEALKLVLDLIKKYD
GPDA2_MYCTU      CTSQRSRNRHVGEQLGAGKPIDEIIASM-----------SQVAEGVKAAGVVMEFANEFG
GPDA_PSEAE       CSSPKSRNYQVGHALGEGLSLEEAVSRM-----------GETAEGVNTLKVLKEKSDEMQ
GPDA_HELPY       ANSILSRNYRVGLGLAQNKPLEVVLEEL-----------GEVAEGVKTTNAIVEIARKYG
GPDA_HELPJ       ANSILSRNYRVGLGLAQNKPLEVVLEEL-----------GEVAEGVKTTNAIVEIARKYG
GPDA_CAMJE       ATSVLSRNYRVGLKLAQNQKLDSILAEL-----------NEVAEGVKTAYAIEKLAKMKG
GPDA_AQUAE       STSDLSRNRTFGKLLGQGYSVEEALKKI-----------NQTVEGVKTAEALYEIIKREN
GPDA_SYNY3       CSSMLSRNYRVGYGLSKGQSLEEILANL-----------GGTAEGVNTTDVLIKIANREK
GPDA_NEIMA       CTGALSRNRRVGLGLAEGKELHQVLVEI-----------GHVSEGVSTIEEVFNTACKYQ
GPDA_NEIMB       CTGALSRNRRVGLGLAEGKELHQVLVEI-----------GHVSEGVSTIEEVFNTACKYQ
GPDA_PAULE       CTGDLSRNRKVGLGLAQGKPLETIVTEL-----------GHVAEGVRCAAAVRNLAQQLQ
GPDA_ECOLI       CTDNQSRNRRFGMMLGQGMDVQSAQEKI-----------GQVVEGYRNTKEVRELAHRFG
GPDA_VIBCH       CTDNQSRNRRFGLALGQGKDVDTAQTDI-----------GQVVEGYRNTKEVWMLAKRMG
GPDA_HAEIN       CTDNQSRNRRFGLMLGKGLDAQMAMENI-----------GQVVEGFYNTKEAYLLAQRQG
GPDA_PASMU       CTDDQSRNRRFGIMLGQGFSAQTAMDNI-----------GQVVEGFYNAKEAYLLAQRQG
GPDA_XYLFA       CTGDLSRNRRLGFALGRGQSLSDAIREI-----------GQVVESVQTSDEVMRQAEQHG
GPDA_CAUVC       CSSPQSRNMSVGLALGQGLTLEQALAGK-----------VSVAEGVASAPAVRALARKVG
GPDA_RHILO       CSSAQSRNFAYGLTLGQG----KALAG------------LPLAEGVPTAAIAARIAVERG
GPDA_MYCLE       CTSPHSRNRSLGERLGRG----EIMQSILHGMDGSDGGDGYVVEGVTSCASVLALASSYD
GPDA_MYCTU       CTSPRSRNRSFGERLGRG----ETLQS--------AGKACHVVEGVTSCESVLALASSYD
GPDA_STRCO       CSSPLSRNHTFGTNLGKG----MTLEE-------TNAVTKQTAEGVKSCESVLDLARRHG
GPDA_DEIRA       ATSPHSRNRAAGEAIARG----ESPQQ-----------GGKVVEGLRTAGLLDAWAAAHG
GPDA_BACHD       CTSIHSRNWRAGQMLGKGKSPAEVEESM-----------GMVVEGIRTTQAAHELAQKLQ
GPDA_BACSU       CTSVHSRNWRAGNLLGKGYKLEDVLEEM-----------GMVVEGVRTTKAAYQLSKKYD
GPDA_LACLA       GTSIHSRNWRAGDALGRGEKLADIEKNM-----------GMVIEGVSTTKAAFELAQQLG
GPDA_STRP1       GTSVHSRNWRAGAALGRGEKLEDIERNM-----------GMVIEGIATTKVAYEIAQDLG
GPDA_CHLMU       CFSAFSRNTLFGKMLAEGLTPEQAKTKI-----------GMVVEGVYTALSAHQIATHHK
GPDA_CHLTR       SFSAFSRNTLFGKLLAEGLTPEQAKTKI-----------GMVVEGVYTALSAHQIATHHR
GPDA_CHLPN       CFSESSRNLRFGHLLAQGLTFEQAKAKI-----------GMVVEGAYTALSAYQVAKHHK
GPDA_TREPA       CRSAYGRNRRFGRDIVHKGILDSFSGIQDLVS--RLPEVGYLAEGVVACMHVQRLAERDR
GPDA_METTH       STTDKSRNRTLGLMLGKKMRLSEDSTIT--------------IESLRSIRAIRELTE--G
GPDA_ARCFU       FRG--GRNGMLGELLGKGLSIDEAMEELERRG-------VGVVEGYKTAEKAYRLSSKIN
                      .**   *  :                            *.               

GPDA_RICTY       LHMPIVSEVASLIHCGIYI-----------------------------
GPDA_RICPR       LHMPIVAEVASLILI---------------------------------
GPDA_RICCN       LHMPIISEVASCVIPYVIPAKAGMT-----------------------
GPDA_RICFE       LQMPIISEVANYVIPE--------------------------------
GPDA2_MYCTU      LNMPIAREVDAVINHGSTVEQAYRGLIAEVPGHEVH---GSGF-----
GPDA_PSEAE       VYMPLVAGLHAILFEGRTLAQVIQLLMRGEPKTDVDFIPTTGF-----
GPDA_HELPY       IYTPIASELALLLKGK-SVLESMNDLIRRA------------------
GPDA_HELPJ       IYTPIASELALLLKGK-SVLESMNDLIRRA------------------
GPDA_CAMJE       IYTPIVNEVVAIFKGK-SVQEATQNLLKQND-----------------
GPDA_AQUAE       IFAPICEGVYRIIKGE-DPKKVYPHFLSNHLREEFQR-----------
GPDA_SYNY3       IAVPITRQVYRLLHGKITPPQAVEALMERELKAEFEDFDL--------
GPDA_NEIMA       IDMPITQTLLQLIRKEMTPQQVVERLMERSARFE--------------
GPDA_NEIMB       IDMPITQTLLQLIRKEMTPQQVVERLMERSARFE--------------
GPDA_PAULE       IEMPITNAVAGILFDGHSPRATVEQLLARHPRDESISAS---------
GPDA_ECOLI       VEMPITEEIYQVLYCGKNAREAALTLLGRARKDERSSH----------
GPDA_VIBCH       VEMPIVEQIYQVLYQGKDARLAAQDLLARDKKMER-------------
GPDA_HAEIN       VEMPITEQIYQMLFCGKSAQDVAISLLGRACKGE--------------
GPDA_PASMU       IEMPITEQVYQVLFCGKNAQDVAASLLGRERKGE--------------
GPDA_XYLFA       VELPISEAVRAVLREEITPYAGMKALLAREQKPEYLDILFKANSSL--
GPDA_CAUVC       VEAPICEAVAAILAGEVAVDAAIAGLLSRPLKPEA-------------
GPDA_RHILO       IDAPIIAAVAAILDGAITISQAVTALMTRPLKTETND-----------
GPDA_MYCLE       VEMPLTDAVHRVCHKGLSVEKAMALLLGRSTKSE--------------
GPDA_MYCTU       VEMPLTDAVHRVCHKGLSVDEAITLLLGRRTKPE--------------
GPDA_STRCO       VDMPITETVVAIVHEGKSPVVAVKELMSRSAKPERR------------
GPDA_DEIRA       HDLPIVRAVAQVTRGEWSPAEGVRHLMGREAKGETEAGEP--------
GPDA_BACHD       IEMPITSALYSVLFEGKKPEHAADELMGRVKKHEMENLHDVVSDQKND
GPDA_BACSU       VKMPITEALHQVLFNGQKVETAVESLMARGKTHEMEDLVNTFENQVK-
GPDA_LACLA       IDMPITETIYKVLYENLDAKTGILDIMRRETRAENEFINNK-------
GPDA_STRP1       VYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH----------
GPDA_CHLMU       IDMPITTGVYRVLYENLDIQKGIAQLLQRNTKEEYL------------
GPDA_CHLTR       IDMPITTSVYRVLYENLDIQEGIAQLLQRDTKEEYL------------
GPDA_CHLPN       IDMPITTGIYRVLYENLDLKEGIALLLQRNTKEEFL------------
GPDA_TREPA       LKVPICAGLYAILNREKGADTFMQEILGW-------------------
GPDA_METTH       LELPVLEMVYQTMQEPENVNLYIREFQERISRPEF-------------
GPDA_ARCFU       ADTKLLDSIYRVLYEGLKVEEVLFELATFK------------------
                     :   :