CLUSTAL format seed alignment for MF_00397

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CITG_PHOPR       MINSAVNLLVNPQDYYIKSESREDLPQINLFKL--------V----GNLGY-----HAMM
CITG_VIBCH       ---MTI-----PAALDLLLELPSQASSS--SGSRTFSLPRLV----GHLAY-----HAMM
CITG_VIBCM       ---MTI-----PAALDLLLELPSQASSS--SGSRTFSLPRLV----GHLAY-----HAMM
CITG_ESCF3       ---MS------DVITTDQPASATSLLQA-----------KGI----ANLVE-----RALL
CITG_KLEPN       --MSDV-----LINPARVRRVKPLSAEE-------------V----VSAVE-----RALL
CITG1_SALTI      --MNVS-----VVTERRTPAYSSLAAGE-------------L----NGLVA-----RALL
CITG1_SALPA      --MNVS-----VVTERRTPAYSSLAAGE-------------L----NGLVA-----RALL
CITG1_SALCH      --MNVS-----VVTERRTPAYSSLAAGE-------------L----NGLVA-----RALL
CITG1_SALTY      --MNVS-----VVTERRTPAYSSLAAGE-------------L----NGLVA-----RALL
CITG_SALG2       --MNVS-----VVTERRTPAYSSLAAGE-------------L----NGLVA-----RALL
CITG_RHOFT       --MPTA-----TALRIDAGSGASDLGEA-------------I----GRLAE-----RSLV
CITG_PECAS       ---MPT---LRLPDGVLSAAVSRSVVSE---------YRERY----SLLDIDQRVAHALT
CITG_PECCP       ---MPT---LRQPDGVLSVALSHSVVSE-------------YRECDSLPDIDQRVAHALT
CITG_ECOUT       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOK1       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO45       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOL6       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO81       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO7I       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOSM       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_SHIFL       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_SHIF8       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO27       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOL5       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_SHISS       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO55       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOLC       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOBW       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOLI       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOSE       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO8A       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOHS       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO24       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_SHIB3       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECO57       ---MSM-----PATLTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_ECOLU       ---MSM-----PATSTKTTKLATSLIDE-------------Y----ALLGW-----RAML
CITG_CITK8       --MMPI-----PATSTDSAAIPQTLLDA-------------Y----ALLAW-----RAML
CITG_SALAR       --MMSI-----PVNPTNASIQPQSLYDA-------------W----ADLAW-----RAML
CITG2_SALPA      --MMPI-----PANPTNASIQPRSLYDA-------------W----ADLAW-----RAML
CITG2_SALTY      --MMPI-----PANPTNASIQPQSLYDV-------------W----ADLAW-----RAML
CITG2_SALCH      --MMPI-----PANPTNASIQPQSLYDA-------------W----ADLAW-----RAML
CITG2_SALTI      --MMPI-----PVNPTNASIQPQSLYDA-------------W----ADLAW-----RAML
CITG_HAEDU       MCAESA-----KICARSRRHSIDDLLSEIHTRAQQYYFSEQI----AELAY-----QALI
CITXG_HAEIN      -------------------------<EH-------------I----GEQVY-----LALI
CITG_STRMU       -------------------MQTKEKLAS-------------L----SYLAV-----KSLL
CITG_STRP6       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRPG       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRP8       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRPZ       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRPM       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRPD       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRP1       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRP3       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STRPF       --------------------MTKAVLTS-------------I----SQLAL-----KALL
CITG_STREM       --------------------MTKKVFDD-------------I----SRLAL-----KALL
CITG_STRE4       --------------------MTKKVFDD-------------I----SRLAL-----KALL
CITG_STRS7       --------------------MTKKVFDD-------------I----SRLAL-----KALL
CITG_LACPL       --------------------MDTKIIVN-------------H----AL--------RALL
CITXG_LEUMC      ----------------<KMIVPQMTQSQ-------------V----VNAAL-----TGML
CITXG_WEIPA      ----------------<ELIFEKESQET-------------V----VNNAL-----KGLL
                                                                          .: 

CITG_PHOPR       LEVHLTPKPGLVDLCTNGAHDDMDIHTFENSAQAINPFLIKFLYAGLNHSDTPIDSLLPK
CITG_VIBCH       LEVHLTPKPGLVDTANNGAHRDMDLNTFIASAEAIAPYLHSFVSAGWESAGNPAAQLLSA
CITG_VIBCM       LEVHLTPKPGLVDTANNGAHRDMDLNTFIASAEAIAPYLHSFVSAGWESAGNPAAQLLSA
CITG_ESCF3       TEVRLTPKPGLVDIRNSGAHKDMDLALFEKSTLAVAPWMENFYQLGYDTSALEAELVLPM
CITG_KLEPN       TEVRLTPKPGLVDIRNAGAHWDMDLASFEASTAVVAPWMEKFFIMGHDTAAVAPEQVLMM
CITG1_SALTI      TEARLTPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVM
CITG1_SALPA      TEARLTPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVM
CITG1_SALCH      TEARLTPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVM
CITG1_SALTY      TEARLTPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVM
CITG_SALG2       TEARLTPKPGLVDIRNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVM
CITG_RHOFT       LELELTPKPGLVDRANSGAHRDMDVGTFRASIAAISPWFSFFFERGVDGSAVPVEDFLRY
CITG_PECAS       MEVMLTPKPGLVDRANNGSHRDMDVALFQTSIQAISPWFRHFTDAGYQHASVPLAQLLSQ
CITG_PECCP       MEVMLTPKPGLVDRANNGAHRDMDVALFQTSIQAISPWFRHFTDAGYQHANIPLAQLLSQ
CITG_ECOUT       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEEVLHG
CITG_ECOK1       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEEVLHG
CITG_ECO45       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEEVLHG
CITG_ECOL6       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLNG
CITG_ECO81       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLNG
CITG_ECO7I       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLNG
CITG_ECOSM       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLNG
CITG_SHIFL       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_SHIF8       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECO27       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLNG
CITG_ECOL5       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLNG
CITG_SHISS       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEIAPEAVLHG
CITG_ECO55       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECOLC       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECOBW       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECOLI       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECOSE       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECO8A       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECOHS       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECO24       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_SHIB3       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECO57       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_ECOLU       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHG
CITG_CITK8       TEVNLSPKPGLVDRINCGAHKDMALEDFHRSALAIQGWLPRFIEYGASCAQLPSDDVLKG
CITG_SALAR       TEVNLSPKPGLVDRLNCGAHKDMALEDFHRSAEAIRDWLPRFMEYGASCTRLPPESVLAG
CITG2_SALPA      TEVNLSPKPGLVDRLNCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAG
CITG2_SALTY      TEVNLSPKPGLVDRLNCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAG
CITG2_SALCH      TEVNLSPKPGLVDRLNCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAG
CITG2_SALTI      TEVNLSPKPGLVDRLNCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAG
CITG_HAEDU       KEARLTPKPGLVDSTNNGSHQDMSLSTFEQSAIALRPFFTQFVLMGIETTNLPDSHILSK
CITXG_HAEIN      QEARLSPKPGLVDAINNGSHKDMNLHTFEQSAISLKPFFTQFVLKGMMTAHLSENQILSE
CITG_STRMU       YELNLTPKPGLVDCHNNGAHNDMDFYTFLDSILSLSPFFKKYIEVGWLYHNESPQYLFNQ
CITG_STRP6       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STRPG       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEQLLLFNR
CITG_STRP8       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STRPZ       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STRPM       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STRPD       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STRP1       YEVSLSPKPGLVDRFDNGAHDDMSFITFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STRP3       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STRPF       YEVSLSPKPGLVDRFDNGAHDDMSFMTFIDSMIALSPFFQAYIETGFAYAKEEPLLLFNR
CITG_STREM       YEVSLSPKPGLVDQLDNGAHDDMSFLTFVDSALALAPFFKTYLDIGFYHAKEDPGLIFER
CITG_STRE4       YEVSLSPKPGLVDQLDNGAHDDMSFLTFVDSALALAPFFKIYLDIGFYHAKEDPGLIFER
CITG_STRS7       YEVSLSPKPGLVDQLDNGAHDDMSFLTFVDSALALAPFFNTYLDIGFYHAKEDPGLIFER
CITG_LACPL       YEVTVNPKPGLVDPLSAGPHPDMNAFMFIDSALSLAPYFNACAAAGVAYTAVDLTGLFKQ
CITXG_LEUMC      YEVSLAPKPGLVDPSSNGAHKDMTVFTFIDSSLALQPYLNEAYRIGNQFKGTDLPRMFSL
CITXG_WEIPA      YEVSLNPKPGLVDPVSMGSHTDMNMFMFIDSSLSLKSYLDKAFKLGRNFEGSDLKLLFNA
                  *  : *******    *.* **    *  *   :  ::      *          .:  

CITG_PHOPR       LRPVGLNAEEAMFQATSGINTHKGMIFSLGIVCGVIGWLRGNNLSF----------DAMH
CITG_VIBCH       LRPIGIEAEQAMFAATQGVNTHKGMIFILGLICGSVGWLKANQLKI----------DAQH
CITG_VIBCM       LRPIGIEAEQAMFAATQGVNTHKGMIFILGLICGSVGWLKANQLKI----------DAQH
CITG_ESCF3       LRPIGMACEADMLQATGGVNTHRGAVFSFGLISAVTGRMVALEEEL----------EQNR
CITG_KLEPN       LRPVGMACENDMLEATGGVNTHRGAIFAFGLLSAAAGRLVSKGEPI----------EQHR
CITG1_SALTI      LRPLGMACENDMLQATNGVNTHRGAIFAFGLLSAAIGRLLARGEPL----------EQNR
CITG1_SALPA      LRPLGMACENDMLQATNGVNTHRRAIFAFGLLSAAIGRLLARGEPL----------EQNR
CITG1_SALCH      LRPLGMACENDMLQATNGVNTHRGAIFAFGLLSAAIGRLLARGEPL----------EQNR
CITG1_SALTY      LRPLGMACENDMLQATNGVNTHRGAIFAFGLLSAAIGRLLARGEPL----------EQNR
CITG_SALG2       LRPLGMACENDMLQATNGVNTHRGAIFAFGLLSAAIGRLIARGEPL----------EQNR
CITG_RHOFT       IRADGMACERAMFAATLGVNTHKGSVFSFGLLCAAAGRLHGRGRPL----------SRAS
CITG_PECAS       VRPIGIACEQAMLSATKGVNTHKGGIFAFGLLCTAAGWLTARGERV----------TQRS
CITG_PECCP       VRPIGIACEQAMLSATKGVNTHKGGIFAFGLLCTAAGWLAGRGERV----------TQRS
CITG_ECOUT       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQSV----------TPIT
CITG_ECOK1       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQSV----------TPIT
CITG_ECO45       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQSV----------TPIT
CITG_ECOL6       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQSV----------TPIT
CITG_ECO81       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQSV----------TPIT
CITG_ECO7I       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECOSM       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_SHIFL       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_SHIF8       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECO27       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECOL5       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_SHISS       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECO55       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECOLC       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECOBW       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECOLI       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECOSE       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECO8A       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECOHS       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_ECO24       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPV----------TPTT
CITG_SHIB3       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQSL----------TPTT
CITG_ECO57       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQLL----------TPTT
CITG_ECOLU       LRPIGMACEGDMFRATAGVNTHKGSIFSLGLLCAAIGRLLQLNQSL----------TPTT
CITG_CITK8       LRPLGMACEADMFRATAGVNTHKGSIFSLGLLCAAIGRLHQQHSPI----------TPAN
CITG_SALAR       LRPLGMACEAAMFRATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPI----------TAQT
CITG2_SALPA      LRPLGMACEAAMFRATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPI----------AAET
CITG2_SALTY      LRPLGMACEAAMFRATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPI----------AAET
CITG2_SALCH      LRPLGMACEAAMFRATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPI----------TAET
CITG2_SALTI      LRPLGMACEAAMFRATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPI----------AAET
CITG_HAEDU       IRPLGLQAEQAMFVATNQVNTHKGAIFAFGLVCTALGRHFSRWQNKMMSSPSFEISQDTT
CITXG_HAEIN      IRPLGLLAEKAMFKVTDGVNTHKGAIFSFGLVCTAIGRLLAQKSLVQSAVDF----DVKL
CITG_STRMU       LRKLGIEAEAAMFSATERVNTHKGINFSFALLLGATGSYLAKHIELIQEKRRFMPQDSLT
CITG_STRP6       LRQLGQKAEEIMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGCFSKEDTLA
CITG_STRPG       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGCFSKEDTLA
CITG_STRP8       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGCFSKEDTLA
CITG_STRPZ       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGCFSKEDTLA
CITG_STRPM       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGCFSKEDTLA
CITG_STRPD       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGTTGAYLARTPHLMTDLGRFSKEDTLA
CITG_STRP1       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGRFSKEDTLA
CITG_STRP3       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGRFSKEDTLA
CITG_STRPF       LRQLGQKAEETMFCATQGINTHKGLNFSMALLLGATGAYLARTPHLMTDLGRFSKEDTLA
CITG_STREM       LRVSGIEAEQAMFSATKGVNTHKGVNFSLALLLGATGMYLASQPQLLAHVTAFTEEDSLA
CITG_STRE4       LRASGIEAEQAMFSATKGVNTHKGVNFSLALLLGATGMYLADQPQLLDHVTAFTEEDSLA
CITG_STRS7       LRVSGIEAEQAMFSATKGVNTHKGVNFSLALLLGATGMYLASQPQLLAHVTAFTEEDSLA
CITG_LACPL       IRGIGVQAEQTMFAATKGVNTHKGAVFSLGVLVTAA-AYQLQHPDV----------DLAT
CITXG_LEUMC      LRNAGIRAEKDMFAATNGVNTHKGAVFSLGIMVTAVAYATQKGIT-----------NLLT
CITXG_WEIPA      LRAEGVLAEQTMFNATNNANTHKGAIFSLGIWVTAIAYSTKDGSA-----------TMTE
                 :*  *  .*  *: .*   ***.   * :.:                             

CITG_PHOPR       ----ISKAVKCCCHDLVFKELRQ---N---HDKPKTYGEFLYKEHGLTGARGEAASGLAT
CITG_VIBCH       ----IGETIRQACQFLVIDELKA--KR---DCEPETAGERIYRQYGLTGARGEAASGLAM
CITG_VIBCM       ----IGETIRQACQFLVIDELKA--KR---DCEPETAGERIYRQYGLTGARGEAASGLAM
CITG_ESCF3       ----ICYWVARMCRDLVAKELSS--EA---TNAATSKSVEHFLHYGLSGARGEAESGFQT
CITG_KLEPN       ----LCDQVARFCRGMVMQELSS--AG---GE-RLSKGEAHFLRYGLSGARGEAESGFLT
CITG1_SALTI      ----ICDQVARLSRNIVAHELSA---R---KAGKLTKSETHFQCYGLSGARGEAESGFRT
CITG1_SALPA      ----ICDQVARLSRNIVAHELSA---K---KAGKLTKSETHFQCYGLSGARGEAESGFRT
CITG1_SALCH      ----ICDQVARLSRNIVAHELSA---K---KAGKLTKSETHFQCYGLSGARGEAESGFRT
CITG1_SALTY      ----ICDQVARLSRNIVAHELSA---K---KAGKLTKSETHFQCYGLSGARGEAESGFRT
CITG_SALG2       ----ICDQVARLSRNIVAHELSA--KK---AGK-LTKSETHFQCYGLSGARGEAESGFRT
CITG_RHOFT       ----VCAEVSHICAGLVKRELLL--PA---A--ARTAGELLYWQHGLTGARGEAQSGFAT
CITG_PECAS       ----LCDSVAAMCHDLVRNELET--CS---G--AATAGEHLYLRHGLTGARGEAASGFNT
CITG_PECCP       ----LCDSVAAMCHDLVRNELET--CS---G--AATAGEHLYQRHGLTGARGEAASGFNT
CITG_ECOUT       ----ICATAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOK1       ----ICATAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECO45       ----ICATAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOL6       ----ICATAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECO81       ----ICATAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECO7I       ----VCSTAASFCRGLTDRELRT--NN---S--QRTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOSM       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_SHIFL       ----VCSTAASFCRGLTDRELRT--NN---S--RLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_SHIF8       ----VCSTAASFCRGLTDRELRT--NN---S--RLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECO27       ----VCSTAASFCRGLTDRELRT--NN---S--RLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOL5       ----VCSTAASFCRGLTDRELRT--NN---A--RLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_SHISS       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECO55       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOLC       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOBW       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOLI       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOSE       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECO8A       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOHS       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECO24       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_SHIB3       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLALTGARGEAEAGYPL
CITG_ECO57       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_ECOLU       ----VCSTAASFCRGLTDRELRT--NN---S--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_CITK8       ----ICSTAATFCRGLTERELRQ--NN---Q--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_SALAR       ----LCATSAAFCRGLTARELRQ--NN---L--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG2_SALPA      ----LCATAADFCRGLTTRELRQ--NN---L--LLTAGQRLYQQQGLTGARGEAEAGYPL
CITG2_SALTY      ----LCATAADFCRGLTTRELRQ--NN---L--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG2_SALCH      ----LCATAADFCRGLTTRELRQ--NN---L--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG2_SALTI      ----LCATAADFCRGLTTRELRQ--NN---L--QLTAGQRLYQQLGLTGARGEAEAGYPL
CITG_HAEDU       GISLISETVARFTQGITD-ELKN--YS---KNQPLTAGITLYQQYGFTGARGEAEKGFPL
CITXG_HAEIN      ----ICSLVAQFTQGLTD-ELKN--YP---EHLPSTAGVRLFQKYGLTGVRGEAENGFNL
CITG_STRMU       ----ICHLAGEMSMHLIQNDLSH--VE---TKRNLTYGEKLFLQYGLKGLRGEASQGYPS
CITG_STRP6       ----ICRLVKPMTAHLIQADLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRPG       ----ICRLVKPMTAHLIQADLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRP8       ----ICRLVKPMTAHLIQADLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRPZ       ----ICRLVKSMTAHLIQTDLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRPM       ----ICRLVKPMTAHLIQTDLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRPD       ----ICRLVKPMTAHLIQTDLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRP1       ----ICRLVKPMTAHLIQTDLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRP3       ----ICRLVKPMTAHLIQTDLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STRPF       ----ICRLVKPMTAHLIQTDLGH--LN---TKKEFTYGEQLFVTYGIKGPRGEASEGFTT
CITG_STREM       ----ICQLVKPLTAHLLETDFGS--LD---LKKELTYGEKLFLDYGIKGPRGEASEGYPT
CITG_STRE4       ----ICQLVKPLTAHLLETDFGS--LD---LKKELTYGEKLFLDYGIKGPRGEASEGYPT
CITG_STRS7       ----ICQLVKPLTAHLLETDFGS--LD---LKKELTYGEKLFLDYGIKGPRGEASEGYPT
CITG_LACPL       ----I---VRTMLAGLTANDFNDLNTK---DPTTLTAGERQYLTYGIKGIRGEAEAGYPT
CITXG_LEUMC      ----IQKVISDMTQDLVKNDLGK--NNLRHSQNQQTAGERQFIKYKIPGVRGEAEKGFPI
CITXG_WEIPA      ----VRRVIQRMVEGLIEKDLAS--NR---V--ATTAGEQQFQTYQLTGIRGEAVNGFPG
                     :          :   ::              : .   :    : * ****  *   

CITG_PHOPR       VMDHGLPAFEKTVKEGFSTEQALWQSLLVLMANNLDTNLVSRGGMEG-LLYAQQAAQGLL
CITG_VIBCH       VMQHALPAYQACLTKGASTEQALWHTLLVLMANNNDSNLVSRGGLAG-LHFVQEQAQQLL
CITG_VIBCM       VMQHALPAYQACLTKGASTEQALWHTLLVLMANNNDSNLVSRGGLAG-LHFVQEQAQQLL
CITG_ESCF3       VRTVALPIFERIRAQNEDMNLALLQTLLHLMAWNNDTNLVSRGALKG-LYYVQQQAQKML
CITG_KLEPN       VRTQAMPVFTRMMEETGDSNLALLQTLLHLMAWNDDTNLVSRGGLAG-LNFVQQEAQRLL
CITG1_SALTI      VRTQALPVFNRVVQEHDDTHLALLQTLLHLMAWNDDTNLVSRGGLEG-LYYVQQQAQKLL
CITG1_SALPA      VRTQALPVFNRVVQEHDDTHLALLQTLLHLMAWNDDTNLVSRGGLEG-LYYVQQQAQKLL
CITG1_SALCH      VRTQALPVFNRVVQEHDDTHLALLQTLLHLMAWNDDTNLVSRGGLEG-LYYVQQQAQKLL
CITG1_SALTY      VRTQALPVFNRVVQEHDDTHLALLQTLLHLMAWNDDTNLVSRGGLEG-LYYVQQQAQKLL
CITG_SALG2       VRTQALPVFNRVVQEHDDTHLALLQTLLHLMAWNDDTNLVSRGGLEG-LYYVQQQAQKLL
CITG_RHOFT       ACAHGVVPYLLARAKGMDEERSLFEALLQLMAHNRDTNIVSRGGMEG-LCLVQAEARRLL
CITG_PECAS       VCQHALPALQQAIAAGMDDETALLQTLLVLMAHNPDTNVVSRGGMDG-LAFVQDYAQRLL
CITG_PECCP       VCQYALPALQQAIAAGADNETALLRTLLVLMAHNPDTNVVSRGGMDG-LAFVQAYAQKLL
CITG_ECOUT       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOK1       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO45       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOL6       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO81       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO7I       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOSM       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_SHIFL       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_SHIF8       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO27       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOL5       VINHALPHYLTLLDQGLDPELALLDTLLLLMATNGDTNVASRGGEGG-LRWLQREAQTLL
CITG_SHISS       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO55       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOLC       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOBW       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOLI       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOSE       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO8A       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOHS       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO24       VLNHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_SHIB3       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECO57       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_ECOLU       VINHALPHYLTLLDQGLDPELALLDTLLLLMAINGDTNVASRGGEGG-LRWLQREAQTLL
CITG_CITK8       VIRHALPHYRALLAQGRDPELALLDTLLLLISMNGDTNVASRGGAEG-LCWIQQQATTLL
CITG_SALAR       VIRHALPHYRALLAQGRDPELALLDTLLLLMSLNGDTNVASRGGSDG-LRWLQQHASFLL
CITG2_SALPA      VIRHALPHYRALLAQGRDPDLALLDTLLLLMSLNGDTNVASRGGADG-LRWLQQHAAFLL
CITG2_SALTY      VIRHALPHYRALLAQGRDPELALLDTLLLLMSLNGDTNVASRGGADG-LRWLQQQAAVLL
CITG2_SALCH      VIRHALPHYRALLAQGRDPELALLDTLLLLMSLNGDTNVASRGGADG-LRWLQQQAAVLL
CITG2_SALTI      VIRHALPHYRALLAQGRDPELALLDTLLLLMSLNGDTNVASRGGADG-LRWLQQQAAVLL
CITG_HAEDU       VQQAVV----FILSQA-ESEMRWYWALLYLMANNNDTNIVHRGGING-LQFIQDEAHKRL
CITXG_HAEIN      I-QTLLPQFDEY--HQLEWEHRLLILLLNLMAINSDTNVVHRGGLAG-LYFIQQTAQDLL
CITG_STRMU       LTQKALPFFRNELLKKQDIQISQLKLLLYLMTFIEDSNIIHRGGIK---SWKKVQQEAQT
CITG_STRP6       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRPG       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRP8       LTNHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRPZ       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRPM       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRPD       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRP1       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRP3       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STRPF       LTDHALPYFRQMISQN-DPETSQLRLLVYLMSIVEDGNLIHRGGIE---AWKGVKADMRL
CITG_STREM       IAHKALPFLRKSLRST-DQETAQLQLLVYLMSIVEDGNLIHRGGIK---AWQRVKQDMRL
CITG_STRE4       IAHKALPFLRKSLRST-DQETAQLQLLVYLMSIVEDGNLIHRGGIK---AWRQVKQDMLL
CITG_STRS7       IAHKALPFLRKSLRST-DQETAQLQLLVYLMSIVEDGNLIHRGGIK---AWRQVKQDMLL
CITG_LACPL       VMQVALPALRR--SRG-TINQRLLDTLMAIVQATVDTNLVKRAHDPHVIDWVHDQAHRYF
CITXG_LEUMC      VMNLALPF---LCEQQGNLNQRLLNTLMKIAGNIDDTNLIKRAGNATISKDMQHWSVTFF
CITXG_WEIPA      VSEVAVPFLQATFG---TMTQRLLDTLMKIAATLEDSTLIKRAKTPDVLAEMKEWTSIYF
                      :                    *: :     * .:  *.                 

CITG_PHOPR       VKGGCRYTNL--ESE-LTELDEIFTEKKLSPGGSADLLAITWLLAQMNELSPKYV-
CITG_VIBCH       AKGGFLYQEI--EQA-LTALDSVLIEKHLSPGGSADLLAATWLIYELVQLFKVRH-
CITG_VIBCM       AKGGFLYQEI--EQA-LTALDSVLIEKHLSPGGSADLLAATWLIYELVQLFKVRH-
CITG_ESCF3       WEGGVLMRGG--LEA-LQAFDDELIARNLSPGGSADLLAVTWFLSHFPKGETFAD-
CITG_KLEPN       WQGGVLADGG--LEA-LRQFDDELIARHLSPGGSADLLAVTWFLSAFPAGALFPL-
CITG1_SALTI      WQGGVLVEGG--IEA-MQFLDDELILRNLSPGGSADLLAVTWFLSHFPAGSLYPE-
CITG1_SALPA      WQGGVLVEGG--IEA-MQSLDDELILRNLSPGGSADLLAVTWFLSHFPAGSLYPE-
CITG1_SALCH      WQGGVLVEGG--IEA-MQSLDDELILRNLSPGGSADLLAVTWFLSHFPAGSLYPE-
CITG1_SALTY      WQGGVLVEGG--IEA-MQSLDDELILRNLSPGGSADLLAVTWFLSHFPAGSLYPE-
CITG_SALG2       WQGGVLVEGG--IEA-MQSLDDELILRNLSPGGSADLLAVTWFLSHFPAGSLYPE-
CITG_RHOFT       ---DCPTPSRSARTAQLAAFDQLLIERNLSPGGSADLLAVSWFLANLDELVCKCVA
CITG_PECAS       A--G---PLD--RQA-LIKMDEALIARNLSPGGSADLLALTWLLYHYPTE------
CITG_PECCP       V--G---PLD--RQA-LIKMDDALIARNLSPGGSADLLALTWLLYHYPAE------
CITG_ECOUT       NNGGIRTPAD--LDY-LRQFDRECIERNISPGGSADLLILTWFLAQI---------
CITG_ECOK1       NNGGIRTPAD--LDY-LRQFDRECIERNISPGGSADLLILTWFLAQI---------
CITG_ECO45       NNGGIRTPAD--LDY-LRQFDRECIERNISPGGSADLLILTWFLAQI---------
CITG_ECOL6       NNGGIRTPAD--LDY-LRQFDRECIERNISPGGSADLLILTWFLAQI---------
CITG_ECO81       NNGGIRTPAD--LDY-LRQFDRECIERNISPGGSADLLILTWFLAQI---------
CITG_ECO7I       NNGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOSM       NNGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLIITWFLAQI---------
CITG_SHIFL       QKGGIRTPTD--LDY-LRQFDRECIERNLSPGGSADLLILTCFLAQI---------
CITG_SHIF8       QKGGIRTPTD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECO27       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOL5       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_SHISS       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECO55       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOLC       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOBW       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOLI       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOSE       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECO8A       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOHS       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECO24       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_SHIB3       QKGGIRTLAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECO57       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_ECOLU       QKGGIRTPAD--LDY-LRQFDRECIERNLSPGGSADLLILTWFLAQI---------
CITG_CITK8       RQGGIRSPAD--LEH-LHRFDQQCIARNLSPGGSADLLIVTWFLAQISQVNHLHNY
CITG_SALAR       RQGGIRTPDD--LVY-LHQFNQQCIERNLSPGGSADLLIVTWFLAQISQVNH----
CITG2_SALPA      HQGGIRTPDD--LVY-LHRFDQQCIERNLSPGGSADLLIVTWFLAQISQVNH----
CITG2_SALTY      QQGGIRTPDD--LVY-LHRFDQQCIERNLSPGGSADLLIVTWFLAQISQVNH----
CITG2_SALCH      HQGGIRTPDD--LVY-LHRFDQQCIERNLSPGGSADLLIVTWFLAQISQVNH----
CITG2_SALTI      HQGGIRTPDD--LVY-LHRFDQQCIERNLSPGGSADLLIVTWFLAQISQVNH----
CITG_HAEDU       GNAKNLQNANALMAS-LREFDDDCIARNLSPGGSADLLALTIFFLSLLYC------
CITXG_HAEIN      TDQHLVTDKTA-LTQALMKFDTACIERNLSSGGSADLLALTIFFLSFRGN------
CITG_STRMU       LLEKDLPPYQ--LKEQLNSYNQILTDRHLSPGGAADLLSLTLYFSFLEQLI-----
CITG_STRP6       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRPG       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRP8       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRPZ       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRPM       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRPD       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRP1       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRP3       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STRPF       LLQQDLSTTD--LRLALSSYNQCLINQHLSPGGAADLLALTFYFAFLEKLL-----
CITG_STREM       LHNSALSATD--LKAALSAYNDKLIQQHLSPGGTADLLVLSLYFAFLENQL-----
CITG_STRE4       LHNSSLSTAD--LKAALSAYNDKLIQKNLSPGGTADLLVLSLYFAFLENQL-----
CITG_STRS7       LHNSSLSTAD--LKAALSAYNDKLIQKHLSPGGTADLLVLSLYFAFLENQL-----
CITG_LACPL       DLGGSRSEAG--MAF-LRELNQIFVDHNYSLGGSADLLILTIFIGLQTDILA----
CITXG_LEUMC      QIGGSYTPEG--LKF-LNDLDQMFIKRNLSMGGAADNLILTIFLARLVGSL-----
CITXG_WEIPA      KLGGSHTEQG--MKY-LYDLDRLFIERNLSIGGSADTLILTIFIGQLTGLL-----
                                 :   :     .: * **:** *  :  :