CLUSTAL format seed alignment for MF_00402

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RL19_MYCGE      ---------MKKINKQALIDAVEQKQLKEY-----VPEFGAGDEVNVAIKLRE------K
RL19_MYCPN      ---------MKKINKQALIDLVEQKQLKAY-----VPEFSAGDEVNVAIKLKE------K
RL19_MYCGA      ---------MNKLNKQNIINHVNNLQLKKS-----VPNFQVGDTVSVSIKIAD------E
RL19_UREPA      -------MALFKINKGEIMNFVNSTQLKTD-----IPNFDSGDTIIVHNRIVE------G
RL19_HELPY      -------------MKNRYIQQFEDAQLKDK----TMPAFKAGDTLRLGITIKE------G
RL19_HELPJ      -------------MKNRYIQQFEDAQLKDK----SMPTFKAGDTLRLGITIKE------G
RL19_CAMJE      -------------MKNKYIEQFEAKQIEGK----NVPDFRAGDTLKLAIRIKE------G
RL19_CAUVC      -------------MAINIIAQLEQEESARLLAARAIPDFRPGDTLRVNVKIKE------G
RL19_RHILO      ---------------MDIIRQLEAEQAAKIEAKRKLPEFQPGDTVRVQVRVTE------G
RL19_NEIMA      ---------------MNLIQQLEQEEIARL--NKDIPEFAPGDTVVVSVRVVE------G
RL19_NEIMB      ---------------MNLIQQLEQEEIARL--NKEIPEFAPGDTVVVSVRVVE------G
RL19_RICPR      ---------------MNIIDNFEQENIAKLTANKKIPDFEAGDTVKVTVKIID------K
RL19_PASMU      --------------MSNIIKQLEQEQLKQN-----LPSFRPGDTLEVKVWVVE------G
RL19_HAEIN      --------------MSNIIKQLEQEQLKQN-----VPSFRPGDTLEVKVWVVE------G
RL19_ECOLI      --------------MSNIIKQLEQEQMKQD-----VPSFRPGDTVEVKVWVVE------G
RL19_SERMA      --------------MSNIIKQLEQEQMKQD-----VPAFRPGDSVEVKVWVVE------G
RL19_SALTY      --------------MSNIIKQLEQEQMKQN-----VPSFRPGDTVEVKVWVVE------G
RL19_VIBCH      --------------MSNIIKALEQEQMKQD-----LPQFAPGDTVVVQVKVKE------G
RL19_PSEAE      -------------MTNKIIQQIEAEQMNKE-----IPAFAPGDTVIVQVKVKE------G
RL19_XYLFA      ----------MSKLNKSIIAEFESAQITRQ-----VPQFSQGDTIVVNVKVKE------G
RL19_BUCAI      --------------MFSIIQNIEKEQIKKN-----IPVFRSGDTIEVKVWVIE------G
RL19_GEOSE      --------------MHHLIQEITKEQLRTD-----LPDFRPGDTVRVHVKVVE------G
RL19_BACSU      --------------MQKLIEDITKEQLRTD-----LPAFRPGDTLRVHVKVVE------G
RL19_LISMO      --------------MNKLIDEITKSQLNPD-----VPNFRPGDTVRVHAKVVE------G
RL19_BACHD      --------------MNNIIREITNEQLRTD-----LPSFRPGDTLRVHVKVIE------G
RL19_STRP1      --------------MNPLIQSLTEGQLRSD-----IPNFRPGDTVRVHAKVVE------G
RL19_STRTR      --------------MNPLIQSLTEGQLRTD-----IPSFRPGDTVRVHAKVVE------G
RL19_LACLA      ---------------MNLIESINAAQLRTD-----IPDFRPGDTVRVHAKVVE------G
RL19_MYCLE      ---------------MNRLDFVDQASLRDD-----IPAFSPGDTINVHVKVIE------G
RL19_MYCTU      ---------------MNRLDFVDKPSLRDD-----IPAFNPGDTINVHVKVIE------G
RL19_STRCO      --------------MSHLLDSVDAASLRSD-----VPAFRPGDTVNVHVRVIE------G
RL19_DEIRA      -------MQTHIKINRGELLRGIEQDHTRQ-----LPDFRPGDTVRVDTKVRE------G
RL19_AQUAE      ------------MSSELLRKIEQKYLPKKE-----YPDFRVGYTVRVYYKIKE------G
RL19_THEMA      -------------MDHLVKIIEKKYE-KKE-----IPDFRPGDTVRVHVKVIE------G
RL19_BORBU      --------------MDLIRKIEAQNK-KNE-----AFVFNVGDTVRVVYKIIE------G
RL19_TREPA      ------------MSCHLIQQIENQQR-KEP-----AETFRVGDTVRVHFKIVE------G
RL19_CHLMU      -------------MGNLIKELQ-DEQCRTD-----LVDFCVGDTIRVATNISE------G
RL19_CHLTR      -------------MGNLIKELQ-DEQCRTD-----LADFCVGDTIRVATNISE------G
RL19_CHLPN      -------------MVNLLKELE-QEQCRND-----LPEFHVGDTIRLATKISE------G
RL19_SYNY3      ---------MTMNAQAIINSIE-AEFLKED-----LPTIHVGDTIKVGVKIVE------G
RK19_THAWE      --------MLNLDNQKAIDNLH-KNFIKPN-----LPKIQIGDTVKLGVKIIE------G
RK19_TRICV      --------MLSLNTQKTIDNLH-NVFTKKN-----IPPIRIGDNVKVGVRIIE------G
RK19_MESVI      -----------MNRNQILQNIE-ANQIKAN-----LPNIYVGDYVKVGLLIQE------G
RK19_CYAPA      -----------MHTQQLISQIE-SQYLKDN-----LPEICVGDTVKVGVLIQEEDNKNSG
RK19_GUITH      ----------MKSNKNLIQLVE-SNHSNKT-----LPQLQVGDTVRLGVSITE------G
RK19_PROWI      ----------MTNFKDIIKKIE-YKFSKHQ-----LPDIKVGDLIRLGISIQE------S
RK19_CHLVU      ----------MAKLQQLVQAIQ-SGTIKTE-----LPDVRVGDLVRIGVSIQE------G
RK19_NEPOL      -------------MTKEDKEKK-EKIEYRP-----LPAIAVGDLVKVGLLILE------G
RK19_PORPU      ------MKDNNIKLSLLMKSVE-QPLMKTE-----LPEIKVGDTIRLGLLVKE------G
RK19_CYACA      -------MVNYLSLKNNISSNLFSGHNNIN-----QEPICVGDYIRFGLLITE------G
                                                      .  *  : .   : :       

RL19_MYCGE      EKV---------RVQNFTGTVLRRRG-RGISETFMVRK-TTDGIPIEKNFQIHNPNID-I
RL19_MYCPN      EKV---------RIQNFTGTVLRRRG-KGISETFIVRK-TTDGIPIEKNFQIHNPNIS-I
RL19_MYCGA      KRT---------RIQKFDGLVLRRKG-SGLSETFIVRK-ESSGVGVEKNFHVHNPNIE-I
RL19_UREPA      KKS---------RIQKFEGVVLRRRG-SGSSETVIVRK-ESSGIGVEQSFNIHSPLVEKI
RL19_HELPY      EKT---------RTQYFEGVCIAIRG-NGVDKTFCVRKIGANNIGVEKIFPFYSESLASV
RL19_HELPJ      EKT---------RTQYFEGVCIAIRG-NGVDKTFCVRKIGANNIGVEKIFPFYSESLASV
RL19_CAMJE      DKT---------RIQNFEGICIARRG-NGVSETFIVRKIGANNVGVERIFPIYSESLESI
RL19_CAUVC      ERE---------RVQAYEGVCIARAG-TGVHESFTVRKIS-FGEGVERLFPLLSPSIESI
RL19_RHILO      TRT---------RVQAYEGVVIARAG-SGFQENFTVRKIS-YGEGVERVFPVFSPMVEGV
RL19_NEIMA      TRS---------RLQAYEGVVIARRN-RGLNSNFIVRKIS-SGEGVERTFQLYSPTVEKI
RL19_NEIMB      TRS---------RLQAYEGVVIARRN-RGLNSNFIVRKIS-SGEGVERTFQLYSPTVEKI
RL19_RICPR      AIEKDGKEKLTERFQAYEGVVIAKRN-RGITSSFLVRKIS-HGEGVERRFMTYSPIVHSI
RL19_PASMU      SKR---------RLQAFEGVVIAIRN-RGLHSAFTLRKVS-NGVGVERVFQTHSPIVDSI
RL19_HAEIN      SKR---------RLQAFEGVVIAIRN-RGLHSAFTLRKVS-NGVGVERVFQTHSPAVDSI
RL19_ECOLI      SKK---------RLQAFEGVVIAIRN-RGLHSAFTVRKIS-NGEGVERVFQTHSPVVDSI
RL19_SERMA      SKK---------RLQAFERVVIAIRN-RGLHSAFTVRKIS-NGEGVERVFQTHSPVIDSI
RL19_SALTY      TKK---------RLQAFEGVVIAIRN-RGLHSAFTVRKIS-NGEGVERVFQTHSPVVDSI
RL19_VIBCH      DRE---------RLQAFEGIVIAIRN-RGLHSAFTVRKIS-NGEGVERTFQTHSPVVDSI
RL19_PSEAE      DRQ---------RLQAFEGVVIAKRN-RGLNSAFTVRKIS-NGVGVERTFQTYSPIVDSL
RL19_XYLFA      NRE---------RLQAYEGVVIATKN-AGLNSAFTVRKIS-HGYGVERVFQTHSPIIESI
RL19_BUCAI      SKK---------RLQSFEGIVIAIKN-RCLNSSFTVRKIS-NGEGVERVFQTHSHGIEEI
RL19_GEOSE      NRE---------RIQVFEGVVIKRRG-AGISETFTVRK-VSYGVGVERTFPVHTPKIAKL
RL19_BACSU      NRE---------RIQIFEGVVIKRRG-GGISETFTVRK-ISYGVGVERTFPVHTPKIAKI
RL19_LISMO      TRE---------RIQLFEGVVIKRRG-AGISETFTVRK-ISNSVGVERTFPVHTPRIAKL
RL19_BACHD      SRE---------RIQVFEGVVIKRRG-TGVSETFTVRK-ISYGVGVERTFPLHSPKIDKI
RL19_STRP1      TRE---------RIQIFEGVVISRKG-QGISEMYTVRK-ISGGIGVERTFPIHTPRVDKI
RL19_STRTR      TRE---------RIQIFEGVVISRKG-QGISEMYTVRK-ISSGIGVERTFPIHTPRVDKI
RL19_LACLA      TRE---------RIQMFEGVVIARKN-SGINETYTVRK-ISNGVGVERIFPVHTPRVEQI
RL19_MYCLE      VKE---------RIQVFKGVVIRRQG-GGIRETFTVRK-ESYGVGVERTFPVHSPNIDHI
RL19_MYCTU      AKE---------RLQVFKGVVIRRQG-GGIRETFTVRK-ESYGVGVERTFPVHSPNIDHI
RL19_STRCO      NRS---------RVQQFKGVVIRRQG-AGVRETFTVRK-VSFSVGVERTFPVHTPIVEKI
RL19_DEIRA      NRT---------RSQAFEGVVIAING-SGSRKSFTVRK-ISFGEGVERVFPFASPLVNQV
RL19_AQUAE      DKE---------RIQPFEGVVIRIRG-SGAGKTFTVRR-ESFGVGIERTFPYYSPNIEKI
RL19_THEMA      DRE---------RTQVFEGIVIAKRG-SGINKTFTVRRIGSHGVGVERIFPVHSPVVEKI
RL19_BORBU      SNE---------RLQSFEGIVISFQN-KGIGKTFLIRK-ISSGIGVEKIFPVYSPIIEKV
RL19_TREPA      KTE---------RIQAYEGLVLCFKN-SGVRRTFTVRK-NSYGVGVERIFPLHSPRIERV
RL19_CHLMU      GKE---------RVQVFQGTVMARKG-GGAGETVSLHR-VAYGEGMEKSFLLNSPKVVSI
RL19_CHLTR      GKE---------RVQVFQGTVMARKG-GGAGETVSLHR-VAYGEGMEKSFLLNSPKIVSI
RL19_CHLPN      GKE---------RVQVFQGTVMARRG-GGSGETVSLHR-VAYGEGMEKSFLLNSPRIVSI
RL19_SYNY3      GKE---------RIQPYEGTVIAKRN-GGISETITVRK-IFQGVGVERVFLLHSPRVASI
RK19_THAWE      NKE---------RVQFYEGTVIAKKN-SSINTTITVRK-VLQGIGIERIFLIHSPKIASI
RK19_TRICV      NKE---------RVQFYEGTVIAKKN-SSINTTLTVRK-VLQGIGVERIFLIHSPKVDSI
RK19_MESVI      NKE---------RVQPYEGVVIAKHN-SASNSTITVRK-MFQGIGVERIFLIHSPRITSI
RK19_CYAPA      EKE---------RIQFYEGVVISLSKLKNINGTIRVRR-ILQGIGIERTFLVHSPLIKSI
RK19_GUITH      NKE---------RIQATEGVIISKSN-CGINLTITIRR-VLQGIGIERVYLLHSPKLKSI
RK19_PROWI      GKQ---------RVQPFEGTVIALHK-AGLNTTITVRK-ILQGIGVERVFPIHASCLTSI
RK19_CHLVU      NKQ---------RIQPFEGTVISKHQ-AGANSTVTVRK-SLQGIGVERVFPLYAPCVANL
RK19_NEPOL      DKE---------RVQTYEGTVIS-KHRAGLNSTITVRK-TFQGVGIERVFCLYSPRMVFV
RK19_PORPU      SKT---------REQLCEGVVLSRKKRKSLNTSLTLRC-SFQGVGVERVFFLNSPRVTFV
RK19_CYACA      TKE---------RTQNCEGLVIAKRF-SNTCCNLTVRT-VFQGIGVERTISLFSPKISKI
                            * *      :             ::     .  :*:        :  :

RL19_MYCGE      EVKRRGKVRRAYISYMRERSGKSAKIKEKKS-----------------------------
RL19_MYCPN      ELKRRGKVRRAYISYMRERSGKAAKIKERKQ-----------------------------
RL19_MYCGA      ELKRKGKVRRAYISYMRERSGKSARIKEKVVNTK--------------------------
RL19_UREPA      EVIKYGKVRRAYISYMRNRSGKSARIKELNKQ----------------------------
RL19_HELPY      EVLRVGRVRRAKLYYLRDRRGKAARIKEVRH-----------------------------
RL19_HELPJ      EVLRVGRVRRAKLYYLRDRRGKAARIKEVRH-----------------------------
RL19_CAMJE      TVLRRGRVRRARLFYLRDRRGKAARIKELKK-----------------------------
RL19_CAUVC      EVKRRGVVRRAKLYYLRDRRGKSARIAERAGGPKASASTEA-------------------
RL19_RHILO      EIVRRGKVRRAKLYYLRDRRGKSARISENTGVRARKLNDEERDALNAEKARIEAEKVAAA
RL19_NEIMA      EVKRRGDVRRAKLYYLRGLTGKAARIKEKLPARKG-------------------------
RL19_NEIMB      EVKRRGDVRRAKLYYLRGLTGKAARIKEKLPARKG-------------------------
RL19_RICPR      DVVKYGVVRRAKLYYLRHRNGKAARIREKLISRAKPKTAIS-------------------
RL19_PASMU      TVKRKGAVRQAKLYYLRERSGKSARIKERLGD----------------------------
RL19_HAEIN      AVKRKGAVRKAKLYYLRERSGKSARIKERLGA----------------------------
RL19_ECOLI      SVKRRGAVRKAKLYYLRERTGKAARIKERLN-----------------------------
RL19_SERMA      TVKRRGAVRKAKLYYLRERTGKAARIKERLNRVG--------------------------
RL19_SALTY      AVKRRGAVRKAKLYYLRERTGKAARIKERLN-----------------------------
RL19_VIBCH      EVKRRGAVRRAKLYYLRDLSGKAARIKEKLAKK---------------------------
RL19_PSEAE      SVKRRGDVRKAKLYYLRALSGKAARIKEKLV-----------------------------
RL19_XYLFA      EIKRRGKVRAAKLYYLRGLEGKAARIKEDLAATAQEKLARKTVTAKAG------------
RL19_BUCAI      LVKRKGLVRKAKLYYLRTRTGKAARIKERLN-----------------------------
RL19_GEOSE      EVIRRGKVRRAKLYYLRELRGKAARIKEKTAQ----------------------------
RL19_BACSU      EVVRYGKVRRAKLYYLRELRGKAARIKEIRR-----------------------------
RL19_LISMO      EVIRRGKVRRAKLYYLRNLRGKAARIKEIR------------------------------
RL19_BACHD      EVKRRGKVRRAKLYYLRNLRGKAARIKEIR------------------------------
RL19_STRP1      EVIRHGKVRRAKLYYLRALQGKAARIKEIRR-----------------------------
RL19_STRTR      EVVRYGKVRRAKLYYLRALQGKAARIKEIRK-----------------------------
RL19_LACLA      EVIRHGKVRRAKLYYLRALTGKKARIAERRR-----------------------------
RL19_MYCLE      EMVIRGDVRRAKLYYLRELRGKKAKIKEKR------------------------------
RL19_MYCTU      EVVTRGDVRRAKLYYLRELRGKKAKIKEKR------------------------------
RL19_STRCO      ELVTRGDVRRAKLYYLRELRGKAAKIKEKRDS----------------------------
RL19_DEIRA      TIVERGKVRRAKLYYLRELRGKAARIKSDRSRVMKDAARAQQDKANASASQAAAAQADVT
RL19_AQUAE      EVVKIGKVRRAKLYYLRELKGKEAERKIKEIKQWEYEAMQRRKEEARKQREEEQKQAQEQ
RL19_THEMA      EVVRKGKVRRAKLYYLRNVRGKIRIKERRD------------------------------
RL19_BORBU      EVLRRGKVRRAKLYYMRNRIGKAAMKIKERLTIKKVKH----------------------
RL19_TREPA      DVVRAGKVRRAKLYYIREKIGKAA-RIKARIVKKPSPSA---------------------
RL19_CHLMU      EVVKRGKVSRARLFYLRGKTGKAAKVKELIGPRAAKK-----------------------
RL19_CHLTR      EVVKRGKVSRARLFYLRGKTGKAAKVKELIGSRAAKK-----------------------
RL19_CHLPN      EIVKRGKVARARLYYLRGKTGKAAKVKEFVGPRSSKK-----------------------
RL19_SYNY3      KVLRRGKVRRAKLYYLRDRVGKATRIKQRFDRAL--------------------------
RK19_THAWE      EVLRHSKVRRSKLYYLRNLRGKASRLKQRFE-----------------------------
RK19_TRICV      EVLRSSKVRRSKLYYLRNLKGKASRLKQQFR-----------------------------
RK19_MESVI      EVISNSKVRRAKLYYLRERIGKATRLKQKFSKV---------------------------
RK19_CYAPA      NIIRRSKVRRAKLYYLRTLTGKATRLKQRLIKHYRLIY----------------------
RK19_GUITH      EILRKSKIRRAKLYYLRTRSGKATRLQQRFN-----------------------------
RK19_PROWI      QVLRRSQVSRAKLYYLRNRTGKATRLKEKFEKLPPIWVNKLP------------------
RK19_CHLVU      QVLRRAQVSRAKLYYLRSRTGKATRLKEKFETLPQIWMNQNQH-----------------
RK19_NEPOL      EFIRHSKARRAKLYYLRNRVGKQSRLEERFDLVTNTILLDLLASESDPSNSRT-------
RK19_PORPU      KVIRRAKVRRAKLYYLRDLLGKASRLKQIFN-----------------------------
RK19_CYACA      KILKHYKVRRAKLYYLRRKENVKKK-----------------------------------
                 .        : : *:*   .                                       

RL19_MYCGE      ---------------------------------
RL19_MYCPN      ---------------------------------
RL19_MYCGA      ---------------------------------
RL19_UREPA      ---------------------------------
RL19_HELPY      ---------------------------------
RL19_HELPJ      ---------------------------------
RL19_CAMJE      ---------------------------------
RL19_CAUVC      ---------------------------------
RL19_RHILO      QALAAETAAKEAAEKKAAAEAEAAKAAEATPAE
RL19_NEIMA      ---------------------------------
RL19_NEIMB      ---------------------------------
RL19_RICPR      ---------------------------------
RL19_PASMU      ---------------------------------
RL19_HAEIN      ---------------------------------
RL19_ECOLI      ---------------------------------
RL19_SERMA      ---------------------------------
RL19_SALTY      ---------------------------------
RL19_VIBCH      ---------------------------------
RL19_PSEAE      ---------------------------------
RL19_XYLFA      ---------------------------------
RL19_BUCAI      ---------------------------------
RL19_GEOSE      ---------------------------------
RL19_BACSU      ---------------------------------
RL19_LISMO      ---------------------------------
RL19_BACHD      ---------------------------------
RL19_STRP1      ---------------------------------
RL19_STRTR      ---------------------------------
RL19_LACLA      ---------------------------------
RL19_MYCLE      ---------------------------------
RL19_MYCTU      ---------------------------------
RL19_STRCO      ---------------------------------
RL19_DEIRA      VISAAPEVAPETQGE------------------
RL19_AQUAE      AQEQEQNA-------------------------
RL19_THEMA      ---------------------------------
RL19_BORBU      ---------------------------------
RL19_TREPA      ---------------------------------
RL19_CHLMU      ---------------------------------
RL19_CHLTR      ---------------------------------
RL19_CHLPN      ---------------------------------
RL19_SYNY3      ---------------------------------
RK19_THAWE      ---------------------------------
RK19_TRICV      ---------------------------------
RK19_MESVI      ---------------------------------
RK19_CYAPA      ---------------------------------
RK19_GUITH      ---------------------------------
RK19_PROWI      ---------------------------------
RK19_CHLVU      ---------------------------------
RK19_NEPOL      ---------------------------------
RK19_PORPU      ---------------------------------
RK19_CYACA      ---------------------------------