CLUSTAL format seed alignment for MF_00403_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RS12_CHLFF      MPTINQLIRKKRQSSASRKKSPALQKC--------------PQRRGVCLQVKTKTPKKPN
RS12_CHLPN      MPTINQLIRKRRKSSLARKKSPALQKC--------------PQKRGVCLQVKTKTPKKPN
RS12_PARUW      MPTIQQLIRQPRAPKKRRSKSPALQKC--------------PQRRGVCLQVKTKTPKKPN
RS12_CORGB      MPTIQQLVRKGRHDKSAKVATAALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_CORJK      MPTIQQLVRKGRHDKSTKVATAALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_FRAAA      MPTIQQLVRKGRQDKVEKTKTPALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_THEFY      MPTIQQLVRKGRKTKVSKNKTPALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_NOCSJ      MPTIQQLVRKGRQDKVSKNKTPALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_CUTAK      MPTIQQLVRKGRTDKISKNKTPALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_ACIC1      MPTIQQLVRKGRQAKASKTKTPALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_MYCLE      MPTIQQLVRKGRRDKIGKVKTAALKGN--------------PQRRGVCTRVYTSTPKKPN
RS12_NOCFA      MPTINQLVRKGRRDKVAKTKTAALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_SACEN      MPTIQQLVRKGRQDKVAKTKTAALKGS--------------PQRRGVCTRVYTTTPKKPN
RS12_STRCO      MPTIQQLVRKGRQDKVEKNKTPALEGS--------------PQRRGVCTRVFTTTPKKPN
RS12_TROWT      MPTIQQLVRKGRRPKVNKTKSPALRGN--------------PQQRGVCSRVYTTTPKKPN
RS12_LEIXX      MPTIQQLVRKGRTPKVTKTKAPALKAN--------------PQQRGVCTRVYTTTPKKPN
RS12_ARTS2      MPTINQLVRKGRTPKVKKTKAPALNGS--------------PMRRGVCTRVYTTTPKKPN
RS12_BIFAA      MPTIEQLVRKGRQAKPKKSKTLALKGS--------------PLRRGVCTRVYTTTPKKPN
RS12_BACTN      MPTIQQLVRKGREVLVEKSKSPALDSC--------------PQRRGVCVRVYTTTPKKPN
RS12_PORGI      MPTIQQLVRKGRESFADKSKSPALNSC--------------PQRRGVCVRVYTTTPKKPN
RS12_CYTH3      MPTIQQLVRKGREQLVFKSKSPALDSC--------------PQRRGVCTRVYTTTPKKPN
RS12_GRAFK      MPTISQLVRKGRAKITKKSKSAALDSC--------------PQRRGVCTRVYTTTPKKPN
RS12_FUSNN      MPTLSQLVKKGRQTLTEKKKSPALQGN--------------PQRRGVCIRVYTTTPKKPN
RS12_SALRD      MPTTQQLIRKGRKTEEETSDAPALEGS--------------PQRRGVCTRVYTTTPKKPN
RS12_RUBXD      MPTTNQLVRKERKRQTKKTATPALQGS--------------PQRRGVCTRVSTTTPKKPN
RR12_EUGLO      MSTIQQLVRKRRKKIKKKKKLAAL-DSC-------------PQKKCICLKVHTITPKKPN
RR12_EUGGR      MPTLEHLTRSPRKKIKRKTKSPAL-KGC-------------PQKRAICMRVYTTTPKKPN
RS12_CARRP      -MTLNQILKFKRKKSVKKKKTPAL-LSS-------------PQKKGICIKVYTTTPKKPN
RR12_HELSJ      MPTLQQLVRKGRIQKHTKTKTPAL-NNS-------------PQKRGICIRSYTITPKKPN
RS12_DEIRA      MPTTQQLLRKGRKVLQKKSKVPAL-KGS-------------PFRRGVCTVVKTTTPKKPN
RS12_THET8      MPTINQLVRKGREKVRKKSKVPAL-KGA-------------PFRRGVCTVVRTVTPKKPN
RS12_WOLPM      MPTINQLIRKGRLGLTHKKKVPALGESN-------------PQRRGVCTKVYTTTPRKPN
RS12_WOLTR      MPTINQLVRKGRLKLSCKKKVPALGKSN-------------PQRRGVCTKVYTTTPRKPN
RS12_ANAMM      MPTINQLVRRPRRPRESANKAPAL-QHN-------------PQKRAVCVKVYTTTPKKPN
RS12_ANAPZ      MPTINQLVRRPRKPSVSANKAPAL-QHN-------------PQKRAVCVKVYTTTPKKPN
RS12_EHRCR      MPTINQLVRKPRKSRSSLNKAPAL-QHN-------------PQKRAVCVKVYTTTPKKPN
RS12_EHRRW      MPTINQLVRSPRKSRALLNKAPAL-QHN-------------PQKRAVCVKVYTTTPRKPN
RS12_NEOSM      MPTINQLVRKPRKTPARINRVPAL-NKN-------------PLKRGICSKVYTTTPKKPN
RS12_PELUB      MPTINQLLRKKRIKPVARNKVPAL-QKQ-------------PLKRGVCVKVYTTTPKKPN
RS12_SYNE7      MPTIQQLIRDEREKITKKTKSPALKNC--------------PQRRGVCTRVYTTTPKKPN
RS12_THEEB      MPTIQQLIRQERELLKRKTKSPALKGC--------------PQRRGVCTRVYTTTPKKPN
RS12_TRIV2      MPTIQQLIRTEREKARQKTKSPALKQC--------------PQRRGVCTRVYTTTPKKPN
RS12_SYNJA      MPTIQQLIREERKAAVRKTKAPALKGC--------------PQRRGVCTRVYTTTPKKPN
RS12_GLOVI      MPTIAQLIRRERGIAQRKTKSPALKAC--------------PQRRGVCTRVYTTTPKKPN
RS12_TRIEI      MPTIQQLIRSARQDTEKQTKSPALKSC--------------PQRRGVCTRVYTTTPKKPN
RS12_PROM3      MPTIQQLIRTERQHLTRKTKSPALRAC--------------PERRGVCTRVYTSTPKKPN
RS12_PROMA      MPTIQQLIRTERQRLTRKTKSPALRSC--------------PERRGVCTRVYTSTPKKPN
RS12_SYNS9      MPTIQQLIRTERSRLKVKTKSPALKSC--------------PERRGVCTRVYTSTPKKPN
RS12_SYNPW      MPTIQQLIRTERQSSKAKTKSPALKSC--------------PERRGVCTRVYTSTPKKPN
RS12_SYNS3      MPTIQQLIRHERQTLKAKTKSPALRAC--------------PERRGVCTRVYTSTPKKPN
RS12_PROM1      MPTIQQLIRTERKTLKTKTKSPALRGC--------------PERRGVCTRVYTSTPKKPN
RS12_PROM0      MPTISQLVGSERKRLTKKTKSPALKSC--------------PERRGVCTRVYTSTPKKPN
RR12_MESVI      MPTIQQLIRSERKRVYNKTKSPALKAC--------------PQRRGVCTRVYTTTPKKPN
RR12_NEPOL      MPTIQQLVRAQRKRIVKKTKSPALCAC--------------PQRRGVCTRVYTTTPKKPN
RR12_CHLRE      MPTIQQLIRSARKKITKKTKSPALKSC--------------PQRRGICLRVYTVTPKKPN
RR12_TETOB      MPTIQQLIRSARKKVSKKTKAPALKSC--------------AQRRGICLRVYTVTPKKPN
RR12_STIHE      MPTIQQLVKSARQKLVNKTKAPALKSC--------------PQRRGICLRVYTVTPKKPN
RR12_OLTVI      MPTVQQLVRSARQKITTKTKSPALKSC--------------PQRRGVCTRVYTTTPKKPN
RR12_CHLVU      MPTIQQLVRSARTRLSKKTKSPALKSC--------------PQRRGVCTRVYTTTPKKPN
RR12_TUPAK      MPTIQQLIHSAREKITNKTKSPALKAC--------------PQRRGVCTRVYTTTPKKPN
RR12_BIGNA      MPTIQQLIRSSRKKITKKTKSPALKMC--------------PQRRGVCSRVYTTTPKKPN
RR12_OSTTA      MPTIQQLIRSQRIKCETKTKSPALKAC--------------PQRRGICTRVYTTTPKKPN
RR12_CHLAT      MPTIQQLIRSQRKKVEKKTKSPALRGC--------------PQRRGVCTRVYTTTPKKPN
RR12_CYAPA      MPTIQQLIRSKRTKIEKKTKSPALKAC--------------PQRRGVCTRVYTTTPKKPN
RR12_GRATL      MPTIQQLVRSERHKSSKKTKSPALKGC--------------PQRRGVCTRVYTTTPKKPN
RR12_EMIHU      MPTIQQLVRFERQTSEKKTKSPALKSC--------------PQRRGVCTRVYTTTPKKPN
RR12_PYRYE      MPTIQQLVRSERRKIHKKTKSPALQSC--------------PQRRGVCTRVYTTTPKKPN
RS12_SYNY3      MPTIQQLIRSERSKVQKKTKSPALKQC--------------PQRRGVCTRVYTTTPKKPN
RR12_LIRTU      MPTIKQLIRNTRQPIRNVTKSPALRGC--------------PQRRGTCTRVYTITPKKPN
RR12_GOSBA      MPTIKQLIRNARQLIRNVTKSPTLGGC--------------PQRRGTCTRVYTITPKKPN
RR12_JASNU      MPTINQLIRNTRQSIRNVKKSPALQGC--------------PQRRGICTRVYTINPKKPN
RR12_LOTJA      MPTMKQLIRKTRQPIRNVTKSPALRGC--------------PQRRGTCTRVYTITPKKPN
RR12_MAIZE      MPTVKQLIRNARQPIRNARKSAALKGC--------------PQRRGTCARVYTINPKKPN
RR12_EPIVI      MPTIKQLIRKKRQPNLNVTKSPALRGC--------------PQRRGTCTRVYTITPKKPN
RR12_PINTH      MPTIQQLIRNARQPIENRKKSPALRGC--------------PQRRGVCARVYTITPKKPN
RR12_PHYPA      MPTIQQLIRNRRQPIENRTKSPALRGC--------------PQRRGVCTRVYTVTPKKPN
RR12_MARPO      MPTIQQLIRNKRQPIENRTKSPALKGC--------------PQRRGVCTRVYTTTPKKPN
RR12_HUPLU      MPTIQQLIRNQRQPVENRTKSPALQGC--------------PQRRGVCTRVYTTTPKKPN
RR12_PSINU      MPTIQQLIRNARQPIRSRTKSPALRGC--------------PQRRGVCIRVYTTTPKKPN
RR12_ANGEV      MSTIQQLIRNTRQPIEDRTKSPALRGC--------------PQRRGVCTRVYTTTPKKPN
RR12_PELHO      MPTSNQLLRNSRQPVRKTKKTPALRGC--------------PQRRGRCSKVYIINPKKPN
RR12_ANTAG      MPTIQQLIRSKRQLVKSRTKSPALQGC--------------PQRRGVCTRVYTTTPKKPN
RR12_ADICA      MPTNQQLIRKARQRLESGTKSPALRGC--------------PQRRGVCTRVYTTTPKKPN
RR12_STAPU      MPTIQQLIRNSRQPAENRTKSPALRAC--------------PQRRGVCTRVYTTTPKKPN
RR12_ZYGCR      MPTIQQLIRNTRQPTQNRTKSPALKAC--------------PQRRGVCTRVYTTTPKKPN
RR12_CHAGL      MPTIQQLIRNRREPIENRTKSPALRSC--------------PQRRGVCTRVYTTTPKKPN
RR12_CHAVU      MTTIQQLIRKKRKPIENKTKSPALRNC--------------PQRRGVCIRVYTTTPKKPN
RR12_TRICV      MPTIQQLVRSRRIQIKKKTKSPALVNC--------------PQRRGVCTRVYTTTPKKPN
RR12_PHATC      MPTIQQLVRSRRIQIKKKTKSPALVNC--------------PQRRGVCTRVYTTTPKKPN
RR12_THAPS      MPTIQQLVRLRRIQITKKTKSPALVNC--------------PQRRGVCTRVYTTTPKKPN
RR12_CYAM1      MPTLQQLIRFGRQQVMVRPKSAALKRC--------------PQRRGVCVKVYTTTPKKPN
RR12_CYACA      MPTIQQLIRFERKQIVGTSKSAALESC--------------PQKKGVCTKVYTTTPKKPN
RS12_HYPNA      MPTIQQLIRNPREPKRTRTKTPALKAC--------------PQRRGVCTRVYTTTPKKPN
RS12_CAMJR      MPTINQLVRKERKKVLEKSKSPALKNC--------------PQRRGVCTRVYTTTPKKPN
RS12_CAMFF      MPTINQLVRKERKKVIVKSKSPALKEC--------------PQRRGVCTRVYTTTPKKPN
RS12_SULDN      MPTINQLIRKERQKVVKKSKSPALVSC--------------PQRRGVCTRVYTTTPKKPN
RS12_HELAH      MPTINQLIRKERKKVVKKTKSPALVEC--------------PQRRGVCTRVYTTTPKKPN
RS12_HELHP      MPTINQLIRKERKKVIRKTKSPALLEC--------------PQRRGVCTRVYTTTPKKPN
RS12_WOLSU      MPTINQLIRKERKKAIKKSKSPALVNC--------------PQRRGVCTRVYTTTPKKPN
RS12_BDEBA      MPTINQLIKSERTVQKNQTKSPALDSC--------------PQRRGVCTRVYTTTPKKPN
RS12_ECOLI      MATVNQLVRKPRARKVAKSNVPALEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_SODGM      MATINQLVRKPRSMKVAKSNVPALDAC--------------PQKRGVCTRVYTTTPKKPN
RS12_BAUCH      MVTINQLVRHPRSMKVAKSNVPALEGC--------------PQKRGVCTRVYTTTPKKPN
RS12_BUCBP      MATVNQLVRKSRSRKLIKNNVPALNKC--------------PQKRGVCIRVYTTTPKKPN
RS12_BUCCC      MSTINQLVRFSRVRKVTKSNVPALSKC--------------PQKRGVCTRVYTTTPKKPN
RS12_BUCAI      MATVNQLVRKPRVRKVIKSNVPALGKS--------------PQKRGVCTRVYTTTPKKPN
RS12_BUCAP      MATVNQLVRKPRLRKIVKTNVPALEGS--------------PQKRGVCTRVYTTTPKKPN
RS12_BLOFL      MVTINQLVGNARSIRVVKSSVPALESC--------------PQKRGVCIRVYTTTPKKPN
RS12_BLOPB      MTTVNQLVRNARPTKTFKSNVPALGAC--------------PQKRGVCVRVYTTTPKKPN
RS12_WIGBR      MVTINQLVRKSRSNKIIKTNVPALSSC--------------PQKRGVCIRVYTTTPKKPN
RS12_VIBCH      MATINQLVRKPRAKQVVKSNVPALAAC--------------PQKRGVCTRVYTTTPKKPN
RS12_AERS4      MATINQLVRKPRIKLVVKSNVPALEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_HAES1      MATINQLVRKPRVKKVVKSNVPALESC--------------PQKRGVCTRVYTTTPKKPN
RS12_IDILO      MATVNQLVRKGRQKPVVKSNVPALEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_PSEA6      MATVNQLVRKPRQKPDAKSNVAALQAC--------------PQRRGVCTRVYTTTPKKPN
RS12_COLP3      MATINQLVRKPRVRQVTKSNVPALQAC--------------PQRRGVCTRVYTTTPKKPN
RS12_PSET1      MATINQLVRKPRRSKVTKSNSAALKAC--------------PQKRGVCTRVYTTTPKKPN
RS12_SHELP      MATVNQLVRKPRSPKVIKTNVPALNAC--------------PQKRGVCTRVYTTTPKKPN
RS12_SHEAM      MATVNQLVRKPRAPKVDKTNVPALEAC--------------PQKRGVCTRVYTTAPKKPN
RS12_MARHV      MATINQLVRKPRKRKVAKSDVPALQAC--------------PQRRGVCTRVYTTTPKKPN
RS12_CHRSD      MATINQLVRKPRKRPVAKSDVPALQSC--------------PQKRGVCTRVYTTTPKKPN
RS12_HAHCH      MATINQLVRKPRSRKVAKSDVPALQGC--------------PQRRGVCTRVYTTTPKKPN
RS12_ALCBS      MATVNQLVRKPRKSKVEKSDSVALQGC--------------PQRRGVCTRVYTTTPKKPN
RS12_PSEE4      MATINQLVRQPRKRSVEKSDVPALQNC--------------PQRRGVCTRVYTTTPKKPN
RS12_PSEU5      MATINQLVRQPRKRVVEKSDVPALQNC--------------PQRRGVCTRVYTTTPKKPN
RS12_PSEAB      MATINQLVRKPRKRMVDKSDVPALQNC--------------PQRRGVCTRVYTTTPKKPN
RS12_SACD2      MATINQLVRKPRKRKVQKSDVPALQAC--------------PQRRGVCTRVYTTTPKKPN
RS12_METCA      MTTINQLVRKPRVSKKEKSNVPALEGC--------------PQRRGVCTRVYTTTPKKPN
RS12_HYDCU      MATINQLVRKPRKDKMKKSNVPALEAC--------------PQRRGVCTRVYTTTPKKPN
RS12_LEGPH      MATINQLVRKPRVDVKKKSNVPALESC--------------PQRRGVCTRVYTTTPKKPN
RS12_VESOH      MSTINQLVRNPRKKKVIKSGVPALDSC--------------PQKRGVCTRVYTTTPKKPN
RS12_PSYIN      MATISQLVRNPRKDKVQKTSVPALEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_NITOC      MATINQLVRKPRVRQKQKSNVPALQAC--------------PQKRGVCTRVYTTTPKKPN
RS12_DICNV      MATINQLVRKPRVKLVDKNNVPALQEC--------------PQKRGVCTRVYTTTPKKPN
RS12_ALKEH      MATINQLVRKGRKRRVAKSNVPALEAS--------------PQKRGVCTRVYTTTPKKPN
RS12_HALHL      MATVNQLVRKGRTKRTAKSSVPALEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_XYLFT      MATINQLVRKPRQASTYKSASPALDKC--------------PQRRGVCTRVYTSTPKKPN
RS12_COXBU      MARINQLVRKPRRARAKKSDVPALEGC--------------PQRRGVCTRVYTTTPKKPN
RS12_FRATN      MATINQLVNNPRKRSVVKSKVPALKAC--------------PQRRGVCTRVYTTTPKKPN
RS12_ACIBT      MATTNQLIRKGRTTLVEKSKVPALKAC--------------PQRRGVCTRVYTTTPKKPN
RS12_PSYCK      MATTNQLIRKGRKTIKEKSKVPALEAC--------------PQRRGVCTRVYTTTPKKPN
RS12_CHRVO      MPTINQLVRKGRVAITAKSKVPALEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_DECAR      MPTINQLVRKPRVAEKAKSKVPALEKC--------------PQKRGVCTRVYTTTPKKPN
RS12_NEIG1      MPTINQLVRKGRQKPVYVNKVPALEAC--------------PQKRGVCTRVYTTTPRKPN
RS12_METFK      MPTINQLVRKPRQKVVAKSKVPALESC--------------PQKRGVCTRVYTTTPKKPN
RS12_AZOSB      MPTINQLVRKPRQMDVVKSKVPALEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_THIDA      MPTINQLIRKPRQAPVEKSKVPALKAC--------------PQRRGVCTRVYTTTPKKPN
RS12_NITEC      MPTISQLVRKPRKAKQVKSKVPALESC--------------PQKRGVCTRVYTTTPKKPN
RS12_NITMU      MPTISQLVRKPRAAKPLKSKVPALGNS--------------PQKRGVCTRVYTTTPKKPN
RS12_BORPE      MPTISQLVRKPREVSIIKSKSPALENC--------------PQRRGVCTRVYTTTPKKPN
RS12_RALSO      MPTINQLVRKPRVSEKLKSKSPALENC--------------PQRRGVCTRVYTTTPKKPN
RS12_VEREI      MPTINQLVRQGREVEKIKSKSPAMENS--------------PQRRGVCTRVYTTTPKKPN
RS12_ACISJ      MPTINQLVRQGRTVEVVKSKSPAMENC--------------PQRRGVCTRVYTTTPKKPN
RS12_METPP      MPTINQLVRHGRQTEVTKSKSPAMQGG--------------PQRRGVCTRVYTTTPKKPN
RS12_PARXL      MPTINQLVRKGRASETTKSKSPALQDC--------------PQRRGVCTRVYTTTPKKPN
RS12_HERAR      MPTINQLIRQPRVSARVKSKSPALENS--------------PQKRGVCTRVYTTTPKKPN
RS12_CHESB      MPTVNQLIAKPRKAPVKRNKVPAMEAN--------------PQKRGVCTRVYTTSPKKPN
RS12_BARBK      MPTVNQLIRKPRVVPVKRNKVPALQAN--------------PQKRGVCTRVYTTTPKKPN
RS12_RHOP2      MPTINQLIARPRVVQKSRKKVPALQQS--------------PQKRGVCTRVYTTTPKKPN
RS12_MAGSA      MPTINQLIRKPRQPVAARNKVPAMEAC--------------PQKRGVCTRVYTTTPKKPN
RS12_RHORT      MPTINQLIRKPRKAVVKRNKVPAMQAC--------------PQKRGVCTRVYTTTPKKPN
RS12_CAUVC      MPTINQLIRKPRSPKPVRNKVPALKGC--------------PQRRGVCTRVYTTTPKKPN
RS12_MARMM      MPTINQLIRKPRKDKPKRNKVPALQAC--------------PQRRGVCTRVYTTTPKKPN
RS12_GLUOX      MPTINQLIANGREPAAKRNKVPALQGC--------------PQKRGVCTRVYTVTPKKPN
RS12_GRABC      MPTINQLIAKGREPNKARNKVPALQGC--------------PQKRGVCTRVYTTTPKKPN
RS12_JANSC      MPTIQQLIRKPRQPKIKRSKSQHMEGC--------------PQKRGVCTRVYTTTPKKPN
RS12_ROSDO      MPTIQQLIRKPRQPKIKRSKSMHLQEC--------------PQKRGVCTRVYTTTPKKPN
RS12_PARDP      MPTIQQLIRKPRQPKVQRSKSQHLQSC--------------PQKRGVCTRVYTTTPKKPN
RS12_ERYLH      MPTINQLVRKGRVPQKAKSKVPAMEQN--------------PQKRGVCTRVYTTTPKKPN
RS12_SPHAL      MPTINQLVRKGRTPQKVKSKVPAMDAN--------------PQKRGVCTRVYTTTPKKPN
RS12_MAGMM      MPTVNQLVRLGRKPQKKKTNVPALQAC--------------PQRRGVCTRVYTTTPKKPN
RS12_SYNAS      MPTINQLVRNGRLRAAKKASTPALAGS--------------PQRRGVCVRVYTSTPKKPN
RS12_DESPS      MPTINQLVRQGRKKSVKKTNTPALKGC--------------PQKRGVCVRVYTTTPKKPN
RS12_ANADE      MPTISQLVRRGRERLQVKKKAPALKES--------------PQKRGVCTRVYTTTPKKPN
RS12_MYXXD      MPTISQLVRKGREKLVVKGKSPALKES--------------PQKRGVCTRVYTTTPKKPN
RS12_SYNFM      MPTINQLVRKGREEIRKKSSTPALQCC--------------PQKRGVCVRVYTTTPKKPN
RS12_SYNWW      MPTINQLVRKGREKGEQKSTAPALKSC--------------PQKRGVCTRVYTTTPKKPN
RS12_MOOTA      MPTIQQLVRQAREKVVRKSTAPALKES--------------PQKRGVCTRVYTTTPKKPN
RS12_CARHZ      MPTINQLVRKGREKVAVKSSAPALKGC--------------PQKRGVCTRVYTTTPKKPN
RS12_GEOMG      MPTINQLIRIGRKSKKEKSNSPALKSC--------------PQKRGVCTRVYTTTPKKPN
RS12_PELPD      MPTINQLIRIGRENKRDKSTAPALKCC--------------PQKRGVCTRVYTTTPKKPN
RS12_PELCD      MPTINQLIRKGREKKVRKSTAPALKCN--------------PQKRGVCTRVYTTTPKKPN
RS12_DESHY      MPTINQLIRNGRSKIAKKSTAPAMQWGYNSLQRKQFASGGSPQKRGVCTRVYTTTPKKPN
RS12_DESAG      MPTINQLIRKERKKVAKRKKTPALQAC--------------PQRRGVCTRVYTTTPKKPN
RS12_LAWIP      MPTINQLIRHERKKVVKRKKTPALQGC--------------PQRRGVCTRVYTTTPKKPN
RS12_LEPIC      MPTISQLIRHGRQKQKKRTKSPALKSS--------------PQRRGVCTRVMTFTPKKPN
RS12_KORVE      MPTFNQLVRKGRTAPKFKTASPALQSC--------------PQKRGVCTRVYTQTPKKPN
RS12_SOLUE      MPTFNQLVRNGRKPPRWKTSSPALESC--------------PQKRGVCTRVYTSTPKKPN
RS12_CHLTE      MPTIQQLIRHGRSMKASKTASPALEKC--------------PQKRGVCTRVYTTTPKKPN
RS12_CHLPD      MPTIQQLIRSGRSIKASKTASPALEKC--------------PQKRGVCTRVYTTTPKKPN
RS12_PELLD      MPTIQQLIRHGRSVKVSKTASPALEKC--------------PQKRGVCTRVYTTTPKKPN
RS12_CHLCH      MPTIQQLIRLGRSVKVSKTASPALEKC--------------PQKRGVCTRVYTTTPKKPN
RS12_TREDE      MPTINQLIKKGRKSAAVKTKSPALQSC--------------PQKRGVCTSVKTITPKKPN
RS12_TREPA      MPTINQLTRIGRKAVFSRTKSPALQAC--------------PQKRGVCTRVMTVTPKKPN
RS12_BORBP      MPTINQLIRKPRKSQTEKTASPALQNC--------------PQRRGICTRVMTVTPKKPN
RS12_AQUAE      MPTFNQLVKYGREKRKKKSKAPALQ--------------GCPQKRGVCVRVYTVTPKKPN
RS12_THEMA      MPTINQLIRYGRKPKKKKSKAPALQ--------------GNPQKRGVCIKVSTMTPKKPN
RS12_CALS4      MPTVNQLVRFGRQSVKKKSAAPALQ--------------GNPQKRGVCVVVRTTTPKKPN
RS12_SYMTH      MPTINQLVRQGRKKLTEKSASPALK--------------GNPFKRGVCTVVKTTTPKKPN
RS12_CLOPS      MPTISQLVRKGRKTVASKSTAPALK--------------ECPQKRGVCTVVKTTTPKKPN
RS12_CLOAB      MPTISQLVRKGRKTLAAKSTAPALK--------------ECPQKRGVCTVVKTTTPKKPN
RS12_CLOTE      MPTINQLVRKSRKTVKAQSDSPALK--------------NCPQRRGVCTVVKTTTPKKPN
RS12_CLONN      MPTINQLVRKGRKTAEYKSNSPALK--------------QCPQKRGVCTVVKTSTPKKPN
RS12_DEHMC      MPTVNQLVRKGRTSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKRGVCTQVKTTTPKKPN
RS12_CLOD6      MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVT-DASAPQKRGVCTSVKTVTPRKPN
RS12_HUNT2      MPTFNQLVRKGRKAAKKKSTAPALQKGFNSLKKVQT-DISCPQKRGVCTVVKTTTPKKPN
RS12_BACSK      MPTINQLIRKGRVDKVKKSDSPALNKGYNSFKKSQT-DVSSPQKRGVCTRVGTMTPKKPN
RS12_BACHD      MPTINQLIRKGRKAKVKKSDSPALNKGYNSFKKVQT-DLSSPQKRGVCTRVGTMTPKKPN
RS12_BACLD      MPTINQLVRKGRVSKVETSKSPALNKGYNSFKKEHT-NVSSPQKRGVCTRVGTMTPKKPN
RS12_BACSU      MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHT-NVSSPQKRGVCTRVGTMTPKKPN
RS12_GEOTN      MPTINQLVRKGRQKKVFKSKSPALNKGYNSFKKEQT-NVSSPQKRGVCTRVGTMTPKKPN
RS12_BACCR      MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKST-DISAPQKRGVCTRVGTMTPKKPN
RS12_LISW6      MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELT-DVNSPQKRGVCTRVGTMTPKKPN
RS12_OCEIH      MPTINQLVRKGRVSKTKKSDSPALNKGYNSFKKRMT-DQNAPQKRGVCTRVGTLTPKKPN
RS12_STAS1      MPTINQLVRKPRQSKSKKSDSPALNRNFNSKKKKFT-DLNSPQKRGVCTRVGTMTPKKPN
RS12_STAHJ      MPTINQLVRKPRQSKSKKSDSPVLNRGFNSKKKQFT-NLNSPQKRGVCTRVGTMTPRKPN
RS12_STAEQ      MPTINQLVRKPRKSKTKQSDSPALNRGFNSKKKQFT-NLNSPQKRGVCTRVGTMTPKKPN
RS12_STRS2      MPTINQLVRKPRKSKVEKSKSPALNVGYNSRKKVQT-NVSSPQKRGVATRVGTMTPKKPN
RS12_STRTD      MPTINQLVRKPRQSKVVKSKSPALNVGYNSHKKVQT-NVSSPQKRGVATRVGTMTPKKPN
RS12_ENTFA      MPTINQLVRKPRKSKVEKSDSPALNKGYNSFKKTQT-NVNSPQKRGVCTRVGTMTPKKPN
RS12_STRP6      MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQT-KMAAPQKRGVATRVGTMTPKKPN
RS12_STRPB      MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQT-KMAAPQKRGVATRVGTMTPKKPN
RS12_STRMU      MPTINQLVRKPRKSKVEKSDSPALNIGYNSHKKVHT-KLAAPQKRGVATRVGTMTPKKPN
RS12_LACLS      MPTINQLVRKPRRAQVTKSKSPAMNVGYNSRKKVQT-KLASPQKRGVATRVGTMTPKKPN
RS12_LACDB      MPTINQLVRKGRHSKTTKSKSPALNYSYNSMKKEQV-FNPAPQMRGVATRVGTMTPKKPN
RS12_LACAC      MPTINQLVRKGRHSKVTKSKSPALNYSYNSMKKESV-FNPAPQMRGVATRVGTMTPKKPN
RS12_LACGA      MPTINQLVRKGRHSKTTKSDSPALNYAYNSMKKKMN-YNPAPQMRGVATRVGTMTPKKPN
RS12_LACBA      MPTINQLVRKGRKSKSSKSDAPALNYGYNSFKKAQV-KNPAPQKRGVATRVGTMTPKKPN
RS12_PEDPA      MPTINQLVRKGRRSQSSKSKAPALNYGYNSMKKSQV-NNPAPQKRGVATRVGTMTPKKPN
RS12_LACPL      MPTINQLIRKGRKSKVSKSNAPALNFGYNSYKKVAT-NNPAPQKRGVATRVGTMTPKKPN
RS12_LACSS      MPTINQLVRKGRKSRTSKSDAPALNFGYNSMKKKAT-DNPAPQKRGVATRVGTMTPKKPN
RS12_LEUMM      MPTINQLVRKPRKSKVSKSKSPALNFGYNSMKKKAT-NNAAPQKRGVATRVGTMTPKKPN
RS12_LACS1      MPTINQLIRKGRKSKGSKSNSPALNFGYNSYKKVQT-NNSAPQKRGVATRVGTMTPKKPN
RS12_LACP3      MPTINQLVRQGRKSISTKSDSPALNFGYNSKKKSLT-NNPAPQKRGVATRVGTMTPKKPN
RS12_OENOB      MPTINQLVRKPRKPRTFKSKVPALNFGYNSMSRKQT-NNTAPQKRGVATRVGTMTPKKPN
RS12_MYCMS      MPTINQLVKVNRKAKTWKTKAPALNRGINTLIKKVT-KIASPQKRGVCTRVATMTPKKPN
RS12_MESFL      MPTINQLVKTNRKAKTWKTKAPALNRGVNSLKKKVT-KVSAPQKRGVCTRVATMTPKKPN
RS12_MYCMO      MPTINQLVSQGRKKKVWKTSSPALSLVYNSLNKKQT-EIPAPFKRGVCTRVATMTPKKPN
RS12_MYCPU      MPTINQLVTKGRKRKASKTKSPALNQSYNSLHKKYK-KLSAPFKRGVCTRVATMTPKKPN
RS12_MYCS5      MPTTNQLVNRGRTSKVQKQNAPALSWSYNSLIKRSK-KMPSPFKRGVCTRVATMTPKKPN
RS12_MYCHJ      MPTISQLAKGCRVKKTWKSKVPALNMLYNSLHKKEL-KLSAPFKRGVCTRVATMTPKKPN
RS12_MYCGE      MATIAQLIRKPRQKKKVKSKSPALHYNLNLLNKKTT-NVYSPLKRGVCTRVGTMTPRKPN
RS12_MYCPN      MATIAQLIRKPRKKKKVKSKSPALHYNLNLLNKKVT-NVYSPLKRGVCTRVGTMTPKKPN
RS12_MYCGA      MATIAQLIRKPRRHKVKKSKSPALQVNLNTLEKKVT-SKSSPFKRGVCTRVGTMTPKKPN
RS12_MYCPE      MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRT-YNPSPYKRGVCTRVGTMTPKKPN
RS12_UREPA      MPTIAQLIRNKRAPKVKKTKSPALLFTYNSLHKKTT-KNPSPLKSGVCTRVGTMTPKKPN
RS12_ONYPE      MSTVSQLIKKRRSSKTSKTKAPALSYGFNVLQKKAK-HYSSPQKMGVCLRVTTMTPKKPN
RS12_RICTY      MPTYNQLVRFGRKSKIRKTKSPALESN--------------PFKSGVCLVVKTVTPKKPN
RS12_RICBR      MPTYNQLVRFERKSKVRKTKSPALEAN--------------PFKSGVCLVVKTVTPKKPN
RS12_RHOBA      MPTINQLVRKNRKQKKSQSKSPVLEKC--------------PQKQGVCLQVRTMTPKKPN
                     ::    *           :                 .     .       *:***

RS12_CHLFF      SALRKVAWVRLS--NGQEVIAYIGGEGHNLQEHSIVLVQGGRVKDLPGVRYHIVRGALDC
RS12_CHLPN      SALRKVAWVRLS--NGQEVIAYIGGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRGTLDC
RS12_PARUW      SALRKVAWVRLS--TGQEVIAYIGGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDC
RS12_CORGB      SALRKVARVRLT--SGIEVSAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDT
RS12_CORJK      SALRKVARVRLT--SGIEVSAYIPGEGHNLQEHSMVLVRGGRVRDLPGVRYKIVRGSLDT
RS12_FRAAA      SALRKVARVRLN--SGIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDT
RS12_THEFY      SALRKVARVRLS--SQIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYRIVRGALDT
RS12_NOCSJ      SALRKVARVRLS--SGVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGTLDT
RS12_CUTAK      SALRKVARVRLS--SGIEVTAYIPGVGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDT
RS12_ACIC1      SALRKVARVRLT--SGVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDT
RS12_MYCLE      SALRKVARVKLT--SQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDT
RS12_NOCFA      SALRKVARVRLT--SQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDT
RS12_SACEN      SALRKVARVKLT--SGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSADT
RS12_STRCO      SALRKVARVRLT--SGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDT
RS12_TROWT      SALRKVARVKLS--NGTEVTVYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKVVRGALDA
RS12_LEIXX      SALRKVARVKLS--NGTEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGALDT
RS12_ARTS2      SALRKVARVRLN--GGVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGALDT
RS12_BIFAA      SALRKVARVRLS--SGVEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDT
RS12_BACTN      SAMRKVARVRLT--NQKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDT
RS12_PORGI      SAMRKVARVRLT--NSKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDT
RS12_CYTH3      SAMRKVARVRLT--NSKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGALDT
RS12_GRAFK      SAMRKVARVRLT--NGKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDT
RS12_FUSNN      SALRKVARVKLT--NGIEVTCYIPGEGHNLQEHSIVLVRGGRTKDLPGVRYKIIRGALDT
RS12_SALRD      SALRKVARVRLT--NGNEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDT
RS12_RUBXD      SALRKIARVRLT--NGHEVTAYVPGEGHNLQEHSVVLVRGGRVKDLPGVRYKVVRGALDA
RR12_EUGLO      SALRKVTRVKIISISKMFTTAYIPGIGHNLQEHSMVLIRGGRVKDLPGVKYKVIRGCLDA
RR12_EUGGR      SALRKVTRVRLS--SGLEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVKYHVIRGCLDA
RS12_CARRP      SALRKVCRVKLS--NKNEITAYIPGEGHNLQEHSNVLVRGGRVKDLPGVKYHIIRNVYDL
RR12_HELSJ      SALRKVARVRLT--SKLEITAYIPGIGHNIQEHSVLLIRGGRVKDLPGVRYQIIRGTRDV
RS12_DEIRA      SALRKIARVRLS-SGF-EVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDT
RS12_THET8      SALRKVAKVRLT-SGY-EVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDA
RS12_WOLPM      SALRKVARVKIS-GYG-EVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDL
RS12_WOLTR      SALRKVARVRIS-GYG-EVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDL
RS12_ANAMM      SALRKVARVRIA-GYGSEVIAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDA
RS12_ANAPZ      SALRKVARVRIA-GYGSEVIAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_EHRCR      SALRKVARVKIA-GYGSEVIAYIPGEGHNLQEHSVILIRGGRVKDLPGVRYHIIRGALDS
RS12_EHRRW      SALRKVARVKIA-GYGSEVIAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDS
RS12_NEOSM      SALRKVARVRLS-GGA-EVIAYIPGEGHNLQEHSVVCIRGGRVKDLPGVRYHIVRGVFDT
RS12_PELUB      SALRKVARVRLS-NGF-EVTAYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGNLDT
RS12_SYNE7      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDT
RS12_THEEB      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDT
RS12_TRIV2      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDT
RS12_SYNJA      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDA
RS12_GLOVI      SALRKVARVRLT--SGFEVTAYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDT
RS12_TRIEI      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDT
RS12_PROM3      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
RS12_PROMA      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDT
RS12_SYNS9      SALRKVARVRLT--SGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
RS12_SYNPW      SALRKVARVRLT--SGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
RS12_SYNS3      SALRKVARVRLT--SGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
RS12_PROM1      SALRKVARVRLT--SGFEVTAYIGGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGTLDT
RS12_PROM0      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDT
RR12_MESVI      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGILDT
RR12_NEPOL      SALRKVARVRLS--SGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDT
RR12_CHLRE      SALRKVARVRLT--TGFEVTAYIPGVGHNLQEHAVVLVRGGRVKDLPGVRYHIVRGSLDT
RR12_TETOB      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHAVVLVRGGRVKDLPGVRYHIVRGTLDT
RR12_STIHE      SALRKVARVRLS--SGFEVTAYIPGIGHNLQEHAVVLVRGGRVKDLPGVRYHIVRGTLDT
RR12_OLTVI      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLVRGGKVKDLPGVRYHVVRGTLDT
RR12_CHLVU      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDS
RR12_TUPAK      SALRKVARIRLT--TGFEVTAYIPGVGHTLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDT
RR12_BIGNA      SALRKVARIKLT--SGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
RR12_OSTTA      SALRKVARVRLT--TGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDT
RR12_CHLAT      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGILDT
RR12_CYAPA      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDA
RR12_GRATL      SALRKVARVRLT--SGFEVTAYIPGIGHNIQEHSVVLIRGGRVKDLPGVRYHIVRGILDA
RR12_EMIHU      SALRKVARVRLT--SGFEVTAYIPGIGHNIQEHSVVLIRGGRVKDLPGCRYHVVRGSLDA
RR12_PYRYE      SALRKVARVRLT--SGFEVTAYIPGVGHNIQEHSVVLIRGGRIKDLPGVRYHVVRGTLDA
RS12_SYNY3      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDA
RR12_LIRTU      SALRKVARVRLT--SGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_GOSBA      SALRKVARVRLT--SGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_JASNU      SATRKVARVRLT--SGFEITAYIPGIGHNSQEHSSVLVRGGRVPDLPGVKYHIVRGTLDA
RR12_LOTJA      SALRKVARVRLT--SGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_MAIZE      SALRKVARVRLT--SGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYRIIRGTLDA
RR12_EPIVI      SALRKVARVRLT--SGIEITAYIPGIGHNLQEHSSVLVRGGRVKDLPGVRYHIIRGTLDA
RR12_PINTH      SALRKVARVRLT--SGFEITAYIPGIDHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_PHYPA      SALRKVARVRLT--SGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_MARPO      SALRKIARVRLT--SGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGTLDA
RR12_HUPLU      SALRKVARVRLT--SGFEITAYIPGIGHNSQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_PSINU      SALRKVARVRLT--SGFEITAYIPGIGHNLQEHSVVSVRGGRVKDLPGVRYHIVRGTLDA
RR12_ANGEV      SALRKVARVRLT--SGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_PELHO      SGNRKVARVRLT--SGFEITAYIPGVGHNVQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RR12_ANTAG      SALRKVARVKLT--SGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDT
RR12_ADICA      SALRKVARVRLT--SKFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDA
RR12_STAPU      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVILVRGGRVKDLPGVRYHIVRGTLDA
RR12_ZYGCR      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDA
RR12_CHAGL      SALRKVARVRLT--SGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDS
RR12_CHAVU      SALRKVARVRLT--SSFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDT
RR12_TRICV      SAIRKVARVRLT--SDLKVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDS
RR12_PHATC      SAIRKVARVRLT--SGFEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDT
RR12_THAPS      SAIRKVARVRLT--SGFEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDS
RR12_CYAM1      SALRKVARVKLT--SGYEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGALDT
RR12_CYACA      SALRKVARVRLT--SGFEITAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDS
RS12_HYPNA      SALRKVAKVRMT--SGFESLCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_CAMJR      SALRKVAKVRLT--SGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDT
RS12_CAMFF      SALRKVAKVRLT--SGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDT
RS12_SULDN      SALRKVAKVRLT--SGFEVISYIMGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDT
RS12_HELAH      SALRKVAKVRLT--SKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDT
RS12_HELHP      SALRKVAKVKLT--SKVEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIIRGALDT
RS12_WOLSU      SALRKVAKVRLT--SGFEVISYIPGEGHNLQEHSIVLIRGGRVKDLPGVKYHIIRGALDT
RS12_BDEBA      SALRKVAKVRLS--NGFEVISYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVLDL
RS12_ECOLI      SALRKVCRVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
RS12_SODGM      SALRKVCRVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
RS12_BAUCH      SALRKVCRVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTLRGTLDC
RS12_BUCBP      SALRKVCRVRLT--NGYEVTAYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHVIRGALDC
RS12_BUCCC      SALRKVCRVRLT--NGHEVTAYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHVIRGALDC
RS12_BUCAI      SALRKVCRVRLT--NGFEVTAYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHIVRGSLDC
RS12_BUCAP      SALRKVCRVRLT--NGFEVTAYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHIVRGSLDC
RS12_BLOFL      SALRKVCRVRLT--NGLEVTCYIGGEGHNLQEHASILIRGGRVKDLPGVRYHVVRGALDC
RS12_BLOPB      SALRKVCRVRLT--NGLEVTSYIGGEGHNLQEHASILIRGGRVKDLPGVRYHVVRGALDC
RS12_WIGBR      SALRKVCRVRLT--NGFEVTSYIGGEGHNLQEHSSVLIRGGRVKDLPGVRYHIVRGALDC
RS12_VIBCH      SALRKVCRVRLT--NGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
RS12_AERS4      SALRKVCRVRLT--NGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
RS12_HAES1      SALRKVCRIRLT--NGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
RS12_IDILO      SAMRKVCRVRLT--NGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
RS12_PSEA6      SALRKVCRVRLT--NGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDC
RS12_COLP3      SALRKVARVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
RS12_PSET1      SALRKVARVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDC
RS12_SHELP      SALRKVARVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
RS12_SHEAM      SALRKVARVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTIRGALDC
RS12_MARHV      SALRKVCRVRLT--NGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDT
RS12_CHRSD      SALRKVCRVRLT--NGYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDT
RS12_HAHCH      SALRKVCRVRLT--NGYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDT
RS12_ALCBS      SALRKVCRVRLT--NGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDT
RS12_PSEE4      SALRKVCRVRLT--NGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_PSEU5      SALRKVCRVRLT--NGYEVASYIGGEGHNLQEHSVVLIRGGRVRDLPGVRYHTVRGSLDT
RS12_PSEAB      SALRKVCRVRLT--NGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_SACD2      SALRKVCRVRLT--NGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_METCA      SALRKVARVRLT--NGAEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHVVRGSLDT
RS12_HYDCU      SALRKVARVRLT--NGYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGSLDC
RS12_LEGPH      SAMRKVARVRLT--NGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_VESOH      SALRKVARVRLT--NANEVTTYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDT
RS12_PSYIN      SAMRKVARVRLT--NGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDT
RS12_NITOC      SAMRKVARIRLT--NGMEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDT
RS12_DICNV      SAMRKVARTRLT--NKYEVTAYIGGEGHNLQEHSLVLIRGGRVKDLPGVRYHIVRGALDT
RS12_ALKEH      SALRKVARVRLT--NNYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGAADT
RS12_HALHL      SALRKVARVRLT--NSYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGAADT
RS12_XYLFT      SALRKVAKVRLT--NQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDA
RS12_COXBU      SALRKVARVRIT--NGAEVTAYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDT
RS12_FRATN      SALRKVARVRLT--SGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_ACIBT      SAMRKVCRVRLT--SGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDC
RS12_PSYCK      SAMRKVCRVRLT--SGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
RS12_CHRVO      SALRKVCKVRLT--NGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_DECAR      SALRKVCKVRLT--NGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_NEIG1      SALRKVCKVRLT--NGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_METFK      SALRKVAKVRLT--NGYEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDT
RS12_AZOSB      SALRKVAKVRLT--NGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDL
RS12_THIDA      SALRKVCKVKLT--SGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHTVRGSLDT
RS12_NITEC      SALRKVARVRLT--NGYEVSSYIGGEGHNLQEHSVVLIRGGRVRDLPGVRYHTVRGSLDT
RS12_NITMU      SALRKVARVRLT--NGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
RS12_BORPE      SALRKVAKVRLT--NGYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
RS12_RALSO      SALRKVAKVRLT--NGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDL
RS12_VEREI      SALRKVAKVRLT--NGSEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
RS12_ACISJ      SALRKVAKVRLT--NGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
RS12_METPP      SALRKVAKVRLT--NGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
RS12_PARXL      SALRKVAKVRLT--NGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDT
RS12_HERAR      SALRKVAKVRLT--NGFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGALDT
RS12_CHESB      SAMRKVAKIRLA--NGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDT
RS12_BARBK      SALRKVAKVRLT--NGFEVIGYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIIRGLLDT
RS12_RHOP2      SALRKVAKVRLT--NGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDT
RS12_MAGSA      SALRKVARVRLT--NGFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDT
RS12_RHORT      SALRKVARVRLT--NGFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDT
RS12_CAUVC      SALRKVAKVRLT--TGIEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
RS12_MARMM      SALRKVAKVRLT--NGHEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
RS12_GLUOX      SALRKVAKVRLT--NGYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
RS12_GRABC      SALRKVAKVRLT--NGYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
RS12_JANSC      SAMRKVAKVRLT--NGYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
RS12_ROSDO      SAMRKVAKVRLT--NGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
RS12_PARDP      SAMRKVAKVRLT--NGFEVISYIPGEKHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDT
RS12_ERYLH      SALRKVAKVRLT--NQREVISYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDT
RS12_SPHAL      SALRKVAKVRLT--NAREVITYIPGEGHNLQEHSVVLIRGGRVRDLPGVRYHVLRGVLDT
RS12_MAGMM      SALRKVARVRLT--NGHEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGSLDT
RS12_SYNAS      SALRKVARVRLT--SRYEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RS12_DESPS      SALRKVARVRLT--NGIEVTSYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHVIRGTLDT
RS12_ANADE      SALRKVARVRLT--NGFEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDA
RS12_MYXXD      SALRKVARVRLT--NGIEVTSYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDS
RS12_SYNFM      SALRKIARVRLT--NGIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDA
RS12_SYNWW      SALRKIARVRLT--NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDA
RS12_MOOTA      SALRKVARVRLT--NGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDA
RS12_CARHZ      SALRKVARVRLT--NGIEVTAYIGGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDC
RS12_GEOMG      SALRKVARVRLT--NGIEVSSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDS
RS12_PELPD      SALRKVARVRLT--NGIEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDS
RS12_PELCD      SALRKVARVRLT--NGIVVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDL
RS12_DESHY      SALRKVARVRLT--NTIEVSSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDT
RS12_DESAG      SALRKVARVRLT--NAIEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDT
RS12_LAWIP      SALRKVARVRLT--NGLEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
RS12_LEPIC      SALRKVARVRLT--TGIEVTAYIPGEGHNLQEHNVVLIRGGRVKDLPGVRYHIIRGTLDT
RS12_KORVE      SALRKVARVRLT--NGIEVTTYIPGIGHNLQEHSIVLIRGGRVKDLPGVRYHVVRGTLDS
RS12_SOLUE      SALRKVARVRLT--NGIEVTTYIPGVGHNLQEHSIVLIRGGRVKDLPGVRYHVIRGALDT
RS12_CHLTE      SALRKVARVRLS--NKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDT
RS12_CHLPD      SALRKVARVRLS--NKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDT
RS12_PELLD      SALRKVARVRLS--NKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGTLDT
RS12_CHLCH      SALRKVARVRLS--NKVEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDT
RS12_TREDE      SALRKVARIRLS--NGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIIRGTKDA
RS12_TREPA      SALRKVARVRLS--SGVEVTAYIPGIGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGAKDT
RS12_BORBP      SALRKVARVRLS--NGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGAKDT
RS12_AQUAE      SALRKVARVRLS--NGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDA
RS12_THEMA      SALRKIARVRLS--NGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDA
RS12_CALS4      SALRKIARVRLT--NGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYKIIRGALDA
RS12_SYMTH      SALRKIARVRLS--NNIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDA
RS12_CLOPS      SALRKIARVRLT--NGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDS
RS12_CLOAB      SALRKIARVRLT--NGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDA
RS12_CLOTE      SALRKIARVRLT--NGYEVSAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDS
RS12_CLONN      SALRKVARVRLT--NGYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDA
RS12_DEHMC      SALRKIARVRLS--NHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDLPGVRYHIIRGTLDT
RS12_CLOD6      SALRKVARVRLT--NGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDT
RS12_HUNT2      SALRKIARVRLT--NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDA
RS12_BACSK      SALRKYARVRLT--NQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_BACHD      SALRKYARVRLS--NQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_BACLD      SALRKYARVRLT--NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_BACSU      SALRKYARVRLT--NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_GEOTN      SALRKYARVRLT--NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_BACCR      SALRKYARVRLT--NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_LISW6      SALRKYARVRLS--NGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_OCEIH      SALRKYARVRLS--NNMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_STAS1      SALRKYARVRLS--NNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDT
RS12_STAHJ      SALRKYARVRLS--NNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDT
RS12_STAEQ      SALRKYARVRLS--NNIEVNAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDT
RS12_STRS2      SALRKFARVRLS--NLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDT
RS12_STRTD      SALRKFARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_ENTFA      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDT
RS12_STRP6      SALRKFARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_STRPB      SALRKFARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_STRMU      SALRKFARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_LACLS      SALRKFARVRLS--NLMEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDT
RS12_LACDB      SALRKYARVRLS--NLTEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_LACAC      SALRKYARVRLS--NLIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_LACGA      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDT
RS12_LACBA      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDT
RS12_PEDPA      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDT
RS12_LACPL      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDT
RS12_LACSS      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDT
RS12_LEUMM      SALRKYARVRLS--NLYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDT
RS12_LACS1      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_LACP3      SALRKYARVRLS--NLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDT
RS12_OENOB      SALRKYARVRLS--NQYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDT
RS12_MYCMS      SALRKYARVRLT--NGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGTLDT
RS12_MESFL      SALRKYARVRLT--NGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDT
RS12_MYCMO      SALRKYARVKLS--NGFEVTAYIPGEGHNIQEHSVVLIRGGRVKDLPGVRYTIVRGTQDA
RS12_MYCPU      SALRKYARVKLS--NGMEVTAYIPGEGHNLQEHSVVLIKGASVKDLPGVRYSIIRGTQDA
RS12_MYCS5      SALRKFARVKLS--NGMEVTAYIPGEKHNIQEHSVVLIRGGRVKDLPGVRYHIVRGTQDV
RS12_MYCHJ      SALRKFARVKLS--NGIEVNAYIPGEGHNLQEHSIVLIRGGKVKDLPGIRYHIVRGTQDT
RS12_MYCGE      SALRKYAKVRLT--NGFEVLAYIPGEGHNLQEHSVTLLRGGRVKDLPGVRYHIVRGTLDT
RS12_MYCPN      SALRKYAKVRLT--NGFEVLTYIPGEGHNLQEHSVTLLRGGRVKDLPGVRYHIVRGTLDT
RS12_MYCGA      SALRKYAKVKLT--NGMEVLAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDT
RS12_MYCPE      SALRKYAKVKLT--NGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDT
RS12_UREPA      SALRKYAKVRLS--NGFEVLAYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIVRGAGDA
RS12_ONYPE      SALRKFARVRLS--NGSEVTAYIPGVGHSLQEHSSVLVRGGRVKDLPGVRYHIVRGALDA
RS12_RICTY      SALRKIATVRLS--NKRTVNAYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHIVLGAYDI
RS12_RICBR      SALRKVATVRLS--NKRTVNVYIPGEKHSVKEHDRVLVRGGQVPDLPGVKYHVVLGAYDI
RS12_RHOBA      SALRKITRVRLS--NGKEVTVYIPGEGHNLQEHSIVLVRGGRVRDLPGVRYQVVRGSRDA
                *. **    ::          *: *  *. :**    :.*.   **** ::  : .  * 

RS12_CHLFF      AAVKNRKQSRS---------RYGAKR-----PK--------------
RS12_CHLPN      AAVKNRKQSRS---------RYGAKR-----PK--------------
RS12_PARUW      AAVKDRKQGRS---------KYGAKR-----PKSKK-----------
RS12_CORGB      QGVKDRKQARS---------RYGAKR-----G---------------
RS12_CORJK      QGVKDRKQARS---------RYGAKK-----EK--------------
RS12_FRAAA      QGVRNRKQARS---------RYGAKK-----EKG-------------
RS12_THEFY      QGVRNRKQARS---------RYGAKK-----EK--------------
RS12_NOCSJ      QGVKNRKQARS---------RYGAKK-----EKS-------------
RS12_CUTAK      QGVKGRKQARS---------RYGAKK-----EK--------------
RS12_ACIC1      QGVRNRKQGRS---------RYGAKK-----EKS-------------
RS12_MYCLE      QGVKNRKQARS---------RYGAKK-----EKS-------------
RS12_NOCFA      QGVKNRKQARS---------RYGAKK-----EKS-------------
RS12_SACEN      QGVKNRKQARS---------RYGAKK-----EKS-------------
RS12_STRCO      QGVKNRKQARS---------RYGAKK-----EK--------------
RS12_TROWT      QAVKDRKQARS---------RYGAKM-----EKK-------------
RS12_LEIXX      QAVKNRKQARS---------RYGAKM-----EKK-------------
RS12_ARTS2      QGVKNRKQARS---------RYGAKM-----EKK-------------
RS12_BIFAA      QGVKDRKQGRS---------LYGAKK-----AK--------------
RS12_BACTN      AGVAGRTQRRS---------KYGAKR-----PKPGQ--AAPAKKK--
RS12_PORGI      AGVNGRTQRRS---------KYGAKR-----PKPGQ--APAAKGKK-
RS12_CYTH3      AGVNGRKQSRS---------KYGAKR-----PKPGQAAAAPAKGKKK
RS12_GRAFK      AGVEGRTQRRS---------KYGAKR-----PKK-------------
RS12_FUSNN      AGVAKRKQGRS---------KYGAKN-----A---------------
RS12_SALRD      AGVEERRQGRS---------KYGTKK-----PRE-------------
RS12_RUBXD      LGVEGRKQGRS---------KYGTKK-----S---------------
RR12_EUGLO      AGVKNRKNGRS---------KYGVKR-----PK--------------
RR12_EUGGR      ASVKNRKNARS---------KYGVKK-----PKPK------------
RS12_CARRP      SGVINRKTSRS---------KYGKKK---------------------
RR12_HELSJ      SGVTARRQSHS---------KYGTKK-----VKN-------------
RS12_DEIRA      QGVKDRNKSRS---------KYGTKK-----PK-AGAAAAKK-----
RS12_THET8      AGVKDRKKSRS---------KYGTKK-----PKEAAKTAAKK-----
RS12_WOLPM      RGVQNRKKARS---------KYGVKK-----SG--------------
RS12_WOLTR      RGVQNRKKARS---------KYGVKK-----SS--------------
RS12_ANAMM      KGVQGRKKARS---------KYGVKR-----GV--------------
RS12_ANAPZ      KGVQGRKKARS---------KYGVKR-----GS--------------
RS12_EHRCR      RGVQNRKKARS---------KYGVKK-----S---------------
RS12_EHRRW      RGVQNRKKARS---------KYGVKK-----S---------------
RS12_NEOSM      EGVKGRKKGRS---------KYGAKK-----S---------------
RS12_PELUB      QGVANRKKRRS---------LYGTKK-----GK--------------
RS12_SYNE7      AGVKDRRQSRS---------KYGAKR-----PKA-------------
RS12_THEEB      AGVKDRKQGRS---------KYGAKR-----PKPGEAAATGKKK---
RS12_TRIV2      AGVKDRKQGRS---------KYGTKR-----PKEAKK----------
RS12_SYNJA      AGVKDRKQGRS---------KYGAKR-----PKPGQAPAAAGKKK--
RS12_GLOVI      AGVKNRMQSRS---------KYGTKR-----PKPGQAAAPAGKKR--
RS12_TRIEI      AGVKDRKQSRS---------KYGAKK-----PKA-------------
RS12_PROM3      AGVKDRSQSRS---------KYGAKA-----SKQD------------
RS12_PROMA      AGVKDRRQARS---------KYGAKA-----PKS-------------
RS12_SYNS9      SGVKDRRQSRS---------KYGAKA-----PKE-------------
RS12_SYNPW      AGVKDRRQSRS---------KYGAKT-----PKE-------------
RS12_SYNS3      AGVKDRRQSRS---------KYGAKA-----PKE-------------
RS12_PROM1      AGVKDRRQSRS---------KYGAKS-----PKE-------------
RS12_PROM0      AGVKDRRQSRS---------KYGAKA-----PKD-------------
RR12_MESVI      AGVKDRAQSRS---------KYGVKR----S----------------
RR12_NEPOL      AGVKERKQSRS---------KYGVKR----VTKK-------------
RR12_CHLRE      AGVKNRVQSRS---------KYGVKMGSKTAAKTAGKK---------
RR12_TETOB      AGVKNRVQSRS---------KYGVKL---AATKAAAKK---------
RR12_STIHE      AGVKGRVQGRS---------KYGVKK---VSAKSAGKSK--------
RR12_OLTVI      AGVKGRVNGRS---------KYGVKR----PSDS-------------
RR12_CHLVU      AGVKDRSQSRS---------KYGVKR-----PK--------------
RR12_TUPAK      AGVKGRLKSRS---------KYGVKK----PKKK-------------
RR12_BIGNA      SAVKDRIRSRS---------KYGVSK---------------------
RR12_OSTTA      AGVKDRLQSRS---------KYGVKR-----PKS-------------
RR12_CHLAT      AGVKDRSQGRS---------KYGVKR-----PK--------------
RR12_CYAPA      AGVKDRRQSRS---------KYGAKR-----PKA-------------
RR12_GRATL      SGVKDRKKSRS---------KYGAKQ-----PKT-------------
RR12_EMIHU      SGVKDRKQGRS---------KYGGKR-----PKGD------------
RR12_PYRYE      AGVKDRRKSRS---------KYGTKK-----PKS-------------
RS12_SYNY3      TGVKDRKQGRS---------KYGTKR-----EKAKK-----------
RR12_LIRTU      VGVKDRQQGRS---------SAL------------------------
RR12_GOSBA      VGVKDRQQGRS---------KYGVKK-----PK--------------
RR12_JASNU      VGVKDRQQGRS---------KYGVKK-----PKKKK-----------
RR12_LOTJA      VGVKDRQQGRS---------KYGAKK-----PK--------------
RR12_MAIZE      VAVKNRQQGRS---------KYGAKK-----PKK-------------
RR12_EPIVI      VGVKDRQQGRS---------KYGVKI-----KNK-------------
RR12_PINTH      AEVKDRQQGRS---------KYGVKK-----QK--------------
RR12_PHYPA      VGVKDRQQGRS---------KYGVKK-----PK--------------
RR12_MARPO      VGVKDRQQGRS---------KYGVKK-----SK--------------
RR12_HUPLU      VGVKNRQQGRS---------KYGVKK-----PK--------------
RR12_PSINU      VGVKDRKQGRS---------RYGVKK-----PK--------------
RR12_ANGEV      VGVKDRKQGRS---------QYGVKK-----PK--------------
RR12_PELHO      AGVKDRKQGRS---------KYGVKK-----PK--------------
RR12_ANTAG      VGVKDRKQGRS---------KYGVKK-----PK--------------
RR12_ADICA      VGVKDRKKGRSSALQSIVATRIIATI-----PYQLF-----------
RR12_STAPU      VGVKDRRQGRS---------KYGVKR-----PK--------------
RR12_ZYGCR      VGVKDRHQGRS---------KYGVKR-----PK--------------
RR12_CHAGL      VGVKDRHQGRS---------KYGAKK-----PK--------------
RR12_CHAVU      IGVKDRCQGRS---------KYGTKR-----PK--------------
RR12_TRICV      VGVKDRTQGRS---------KYGVKK-----PKSDK-----------
RR12_PHATC      GGVKGRTQGRS---------KYGVKK-----PKAEK-----------
RR12_THAPS      GGVKDRTQRRS---------KYGVKK-----PKS-------------
RR12_CYAM1      AGVKNRVRSRS---------KYGVKK-----A---------------
RR12_CYACA      TGVKNRLRARS---------KYGASK-----PKK-------------
RS12_HYPNA      QPVKNRKQRRS---------HYGAKK-----PK--------------
RS12_CAMJR      AGVAKRTVSRS---------KYGAKR-----PKAGAAK---------
RS12_CAMFF      AGVAKRTVSRS---------KYGAKR-----PK-DAKK---------
RS12_SULDN      AGVANRTVSRS---------KYGTKR-----PK--VKK---------
RS12_HELAH      AGVNKRTVSRS---------KYGTKK-----AKATD----NKKK---
RS12_HELHP      AGVAKRNVSRS---------KYGAKK-----AKAGG----DKK----
RS12_WOLSU      AGVQKRNVSRS---------KYGAKK-----GKAGAAPTTGKKK---
RS12_BDEBA      QGVNGRLRARS---------KYGTKR-----PKK-------------
RS12_ECOLI      SGVKDRKQARS---------KYGVKR-----PKA-------------
RS12_SODGM      SGVKDRKQGRS---------KYGVKK-----PKA-------------
RS12_BAUCH      SGVKDRKKGRS---------KYGVKK-----QKV-------------
RS12_BUCBP      SGVKSRSQGRS---------KYGVKK-----KK--------------
RS12_BUCCC      SGVKDRKKGRS---------KYGVKK-----LKV-------------
RS12_BUCAI      AGVKERKQGRS---------KYGVKK-----PKK-------------
RS12_BUCAP      AGVKERKKGRS---------KYGVKK-----AKV-------------
RS12_BLOFL      SGVKDRKNGRS---------KYGTKK-----LKS-------------
RS12_BLOPB      AGVHSRKKSRS---------KYGTKQ-----PKS-------------
RS12_WIGBR      AGVKNRKKARS---------KYGVKK-----IKNK------------
RS12_VIBCH      AGVNDRKQARS---------KYGVKR-----PKS-------------
RS12_AERS4      AGVKDRKQARS---------KYGVKR-----PKA-------------
RS12_HAES1      AGVKDRKQSRS---------KYGVKR-----PKA-------------
RS12_IDILO      SGVNDRRQGRS---------KYGAKR-----PKS-------------
RS12_PSEA6      AGVSSRKQARS---------KYGAKR-----PKS-------------
RS12_COLP3      SGVSDRRQGRS---------KYGAKR-----PKS-------------
RS12_PSET1      AGVSDRRQARS---------KYGTKR-----PKG-------------
RS12_SHELP      AGVSERRQGRS---------KYGAKR-----PKS-------------
RS12_SHEAM      AGVNARRQARS---------KYGAKR-----PKS-------------
RS12_MARHV      QGVQNRKQGRS---------KYGAKR-----PKS-------------
RS12_CHRSD      SGVQNRRQGRS---------KYGTKR-----PKS-------------
RS12_HAHCH      AGVNDRRQGRS---------KYGAKR-----GKS-------------
RS12_ALCBS      AGVQDRKQRRS---------KYGAKR-----PK--------------
RS12_PSEE4      SGVKGRNQGRS---------KYGTKR-----PK--------------
RS12_PSEU5      SGVKDRKQGRS---------KYGAKR-----PK--------------
RS12_PSEAB      SGVKDRKQGRS---------KYGAKR-----PK--------------
RS12_SACD2      SGVSDRKQGRS---------KYGTKR-----PK--------------
RS12_METCA      AGVQKRRQGRS---------KYGAKR-----PKS-------------
RS12_HYDCU      AGVDGRKQGRS---------KYGAKR-----PKG-------------
RS12_LEGPH      SGVNDRKQGRS---------KYGTKK-----PKDKK-----------
RS12_VESOH      TGVDSRMQGRS---------KYGTKK-----PKK-------------
RS12_PSYIN      SGVTARRKGRS---------KYGAKR-----PKA-------------
RS12_NITOC      AGVGDRRQGRS---------KYGAKR-----PKG-------------
RS12_DICNV      AGVKDRKKGRS---------KYGAKR-----PKA-------------
RS12_ALKEH      AGVDKRRQGRS---------KYGAKR-----PKS-------------
RS12_HALHL      AGVDKRRQGRS---------KYGAKR-----PKKK------------
RS12_XYLFT      AGVAKRRQGRS---------KYGAKR-----PKS-------------
RS12_COXBU      AGVSGRRRGRS---------KYGEKK-----PKE-------------
RS12_FRATN      SGVNNRKHGRS---------KYGTKR-----PKS-------------
RS12_ACIBT      AGVKDRNQSRS---------KYGAKR-----PKK-------------
RS12_PSYCK      AGVKDRKQGRS---------KYGAKK-----PKV-------------
RS12_CHRVO      AGVKDRKQARS---------KYGAKR-----PK--------------
RS12_DECAR      QGVKDRKQSRS---------KYGAKR-----PKAA------------
RS12_NEIG1      AGVKDRKQARS---------KYGAKR-----PK--------------
RS12_METFK      AGVKDRKQARS---------KYGAKR-----PKAA------------
RS12_AZOSB      QGVKDRKQSRS---------KYGAKR-----PKKA------------
RS12_THIDA      AGVKDRKQSRS---------KYGAKR-----PKKA------------
RS12_NITEC      AGVKDRKKARS---------KYGSKR-----PKSA------------
RS12_NITMU      AGVKDRKQGRS---------KYGAKK-----PKSA------------
RS12_BORPE      QGVKDRKQARS---------KYGAKR-----PKKA------------
RS12_RALSO      QGVKDRKQARS---------KYGAKR-----PKAA------------
RS12_VEREI      QGVKDRKQARS---------KYGAKK-----PKAK------------
RS12_ACISJ      QGVKDRKQARS---------KYGAKK-----PKAK------------
RS12_METPP      QGVKDRKQSRS---------KYGAKR-----PKKA------------
RS12_PARXL      QGVKDRKQARS---------KYGAKR-----AKAGK-----------
RS12_HERAR      QGVKDRKQARS---------KYGTKR-----AKAGKK----------
RS12_CHESB      QGVKSRKQRRS---------KYGAKR-----PK--------------
RS12_BARBK      QGVKNRKQRRS---------KYGAKR-----PK--------------
RS12_RHOP2      QGVKNRKQRRS---------KYGAKR-----PK--------------
RS12_MAGSA      QGVKDRRQRRS---------KYGAKR-----PK--------------
RS12_RHORT      QGVKDRRQRRS---------KYGAKR-----PK--------------
RS12_CAUVC      QGVKDRKQRRS---------LYGAKR-----PK--------------
RS12_MARMM      QGVKDRKQRRS---------KYGAKR-----PK--------------
RS12_GLUOX      QGLAKRRQRRS---------LYGAKR-----PK--------------
RS12_GRABC      QGIAKRRQRRS---------LYGAKR-----PK--------------
RS12_JANSC      QGVKDRRQRRS---------KYGAKR-----PK--------------
RS12_ROSDO      QGVKDRKQRRS---------KYGAKR-----PK--------------
RS12_PARDP      QGVKDRRQRRS---------KYGAKR-----PK--------------
RS12_ERYLH      QGVKDRKQSRS---------KYGAKR-----PK--------------
RS12_SPHAL      QGVKDRKQSRS---------KYGAKR-----PK--------------
RS12_MAGMM      QGVKDRKQGRS---------KYGAKR-----PK--------------
RS12_SYNAS      VGVQDRKQGRS---------KYGAKK-----PS--------------
RS12_DESPS      LGVSDRRQGRS---------KYGAKK-----PSK-------------
RS12_ANADE      VGVQGRKQGRS---------KYGAKR-----AS--------------
RS12_MYXXD      VGVAGRKQSRS---------KYGAKR-----PS--------------
RS12_SYNFM      LGVADRKQGRS---------KYGTKR-----PK--------------
RS12_SYNWW      SGVQKRNQGRS---------KYGTKR-----PKKK------------
RS12_MOOTA      AGVQNRNQGRS---------KYGAKR-----PKK-------------
RS12_CARHZ      AGVQNRNQGRS---------KYGTKR-----PKAKK-----------
RS12_GEOMG      VGVKDRKQARS---------KYGAKR-----PK--------------
RS12_PELPD      VGVKDRKKSRS---------KYGAKR-----PK--------------
RS12_PELCD      AGVKDRKQGRS---------KYGAKR-----PK--------------
RS12_DESHY      QGVQKRMQARS---------KYGAKR-----PKKGK-----------
RS12_DESAG      AGVQDRRQGRS---------KYGAKR-----PK--------------
RS12_LAWIP      SGVQDRRQRRS---------KYGAKR-----PK--------------
RS12_LEPIC      LGVDKRRNGRS---------KYGAKR-----PKA-------------
RS12_KORVE      VGVANRKQGRS---------KYGAKR-----PKA-------------
RS12_SOLUE      AGVANRKQSRS---------KYGAKR-----PKS-------------
RS12_CHLTE      SGVADRKQSRS---------KYGAKV-----PKAGAA--PAKKK---
RS12_CHLPD      SGVADRKQSRS---------KYGAKQ-----PKAGAAA-PVKGKRR-
RS12_PELLD      SGVSDRKQSRS---------KYGAKQ-----PKAVAAKK--------
RS12_CHLCH      SGVADRKQSRS---------KYGAKQ-----PKAGAPAAPVKGKGKK
RS12_TREDE      LGVEDRKRGRS---------KYGAKR-----PKA-------------
RS12_TREPA      LGVVDRKRGRS---------KYGAKR-----PRA-------------
RS12_BORBP      LGVNNRKKGRS---------KYGTKK-----PKA-------------
RS12_AQUAE      AGVEGRRQSRS---------KYGTKR-----PKEEKGG---------
RS12_THEMA      AGVEGRRQSRS---------KYGAKR-----PKDQKK----------
RS12_CALS4      AGVANRKQARS---------RYGAKK-----PKK-------------
RS12_SYMTH      AGVANRMQGRS---------KYGAKR-----PKAGKK----------
RS12_CLOPS      AGVANRMQGRS---------KYGAKK-----PKQKK-----------
RS12_CLOAB      AGVADRKQARS---------KYGAKK-----PKQK------------
RS12_CLOTE      AGVATRMQSRS---------KYGAKK-----PKQK------------
RS12_CLONN      AGVANRMQARS---------KYGAKK-----PKQK------------
RS12_DEHMC      AGVANRQQGRS---------RYGAKK-----GKAAPAKKK-------
RS12_CLOD6      AGVDKRRQSRS---------KYGAKR-----PK--EAKK--------
RS12_HUNT2      AGVAKRMQGRS---------KYGAKR-----PKSSAAAK--------
RS12_BACSK      AGVQNRMQGRS---------KYGTKK-----PKDKK-----------
RS12_BACHD      AGVQDRMQGRS---------KYGTKR-----PKDKK-----------
RS12_BACLD      AGVENRAQGRS---------KYGTKR-----PKKK------------
RS12_BACSU      AGVENRAQGRS---------KYGTKK-----PKAK------------
RS12_GEOTN      AGVANRMQGRS---------KYGAKK-----PKAAKK----------
RS12_BACCR      AGVDKRMQGRS---------KYGTKR-----PKPAKK----------
RS12_LISW6      AGVENRGQSRS---------KYGTKK-----PKK-------------
RS12_OCEIH      AGVEGRKQGRS---------KYGTKR-----PKK-------------
RS12_STAS1      SGVDGRRQGRS---------LYGTKK-----PKK-------------
RS12_STAHJ      SGVDGRRQGRS---------LYGTKK-----PKN-------------
RS12_STAEQ      SGVDGRRQGRS---------LYGTKK-----PKN-------------
RS12_STRS2      AGVNDRKQGRS---------KYGTKR-----PKG-------------
RS12_STRTD      AGVADRKQSRS---------KYGAKR-----PKG-------------
RS12_ENTFA      AGVNDRKQSRS---------KYGTKR-----PKA-------------
RS12_STRP6      AGVADRKQGRS---------KYGAKR-----PKG-------------
RS12_STRPB      AGVADRNKAVL---------NTGRNV-----QKDNRRGIRENES---
RS12_STRMU      AGVTDRKQGRS---------KYGTKK-----PKA-------------
RS12_LACLS      AGVADRKQSRS---------KYGAKK-----PKA-------------
RS12_LACDB      AGVDGRKQARS---------KYGAKK-----G---------------
RS12_LACAC      AGVEGRKQSRS---------KYGTKK-----D---------------
RS12_LACGA      AGVDGRKQGRS---------KYGAKK-----G---------------
RS12_LACBA      AGVTDRRQGRS---------KYGTKK-----PKG-------------
RS12_PEDPA      AGVTDRKQSRS---------KYGTKK-----PKK-------------
RS12_LACPL      AGVEDRRQSRS---------KYGTKK-----PKK-------------
RS12_LACSS      AGVDGRMQSRS---------KYGTKR-----PKK-------------
RS12_LEUMM      AGVDGRMTSRS---------KYGTKA-----PKK-------------
RS12_LACS1      AGVEGRMQSRS---------KYGAKK-----PKK-------------
RS12_LACP3      AGVDGRMQGRS---------KYGAKR-----PKKK------------
RS12_OENOB      AGVEGRMNGRS---------KYGAKR-----PKK-------------
RS12_MYCMS      QGVAKRSQGRS---------LYGVKR-----PKVKK-----------
RS12_MESFL      QAVNNRKQSRS---------LYGAKR-----PKK-------------
RS12_MYCMO      AGVANRNQSRS---------RYGTKK-----PKPKS-----------
RS12_MYCPU      AGVNKRNQARS---------RYGAKK-----AKK-------------
RS12_MYCS5      AGVNNRKQGRS---------LYGTKK-----DKK-------------
RS12_MYCHJ      TGVAKRSQGRS---------KYGAKR-----PKKSK-----------
RS12_MYCGE      VGVDKRRQQRS---------AYGAKK-----PKPKS-----------
RS12_MYCPN      VGVEKRRQQRS---------AYGAKK-----PKAKS-----------
RS12_MYCGA      TGVDKRRQQRS---------AYGAKR-----PKADKKK---------
RS12_MYCPE      SGVEKRRQQRS---------GYGAKR-----PKEKKE----------
RS12_UREPA      SGVEKRRQQRS---------LYGAKR-----PKKEASK---------
RS12_ONYPE      TGVANRKQGRS---------KYGSKL-----PKEKK-----------
RS12_RICTY      AGVKGRKQGRS---------RYGATRKQVAATKK-------------
RS12_RICBR      AGVKGRKQGRS---------RYGAPRKQVVATKK-------------
RS12_RHOBA      LGVDGRKQSRS---------RYGAKK---------------------
                  :  *