CLUSTAL format seed alignment for MF_00406

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FABZ_ECOLI       -------------MTTNTH---TLQIEEILELLPHRFPFLLVDRVLDFE-EGRFLRAVKN
FABZ_YEREN       -------------MTTDTH---TLHIEEILDLLPHRFPFLLVDRVLDFE-EGKFLRAVKN
FABZ_HAEIN       -------------MSEQQP--KVIESKEIMTLLPHRYPFLLVDRVLDFK-EGEWLKAIKN
FABZ_PASMU       -------------MTTETTTTKIIEANEIMKLLPHRYPFLLVDRVVDYE-EGKWLKAVKN
FABZ_VIBCH       -------------MMTLTTDKKTMNITEIQSLLPHRYPFLLIDRVTDYE-EGKYLIGLKN
FABZ_NEIMA       -------------MDVQLP----IEAKDIQKLIPHRYPFLQLDRITAFE-PMKTLTAIKN
FABZ_NEIMB       -------------MDVQLP----IEAKDIQKLIPHRYPFLQLDRITAFE-PMKTLTAIKN
FABZ_HELPY       ------------MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRIIELQ-ANKKIVAYKN
FABZ_HELPJ       ------------MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRIIELQ-ANQKIVAYKN
FABZ_CAMJE       ----------------------MIDVMQIQEILPHRYPFLLVDKITELK-VKEVVLGYKN
FABZ_THEMA       -----------------------MNIDYVKSILPHRYPFLLVDGVIE-E-SEDRIVAFKN
FABZ_AQUAE       -----------------------MDIQEIMEILPHRYPILLVDKILEIE-EGKRIIGLKN
FABZ_BACHD       ----------------------MLTIEDIKKIIPHRYPFLLIDRLEELE-DGKRAVGIKN
FABZ_BACSU       ----------------------MLDTQQIKEIIPHRYPFLLVDRITEVE-EGKRAKGYKN
FABZ_SYNY3       MSTPEVTPTLSDSNGNEAGVQTQFTIQEISDLLPHRYPFALVDRIIDFQ-PGKCAVGLKN
FABZ_CHLMU       -----------------MSEKPVLGIQDIQNLLPHRYPFLLVDKILSYDLNTRSIVAQKN
FABZ_CHLTR       -----------------MNEKPVLGIQDIQNLLPHRYPFLLVDKILSYDLNTRSVVAQKN
FABZ_CHLPN       -----------------MNQPSVIKLRELLDLLPHRYPFLLVDKVLSYDIEARSITAQKN
FABZ_PARUW       -------------MVNLSDNPQALDINQIINILPHRYPFLLVDRVLEIDVEKGYILAQKN
FABZ_PSEAE       ----------------------MMDINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKN
FABZ_XYLFA       --------MSDSPTTAHTRLELPIDIIKIQALLPHRYPFLLVDRILELDQKQKRIVAQKN
FABZ_DEIRA       -----------------MSLMTPLLIRDVLKALPHRYPFVLVDRVFSTE--NGEVHALKN
FABZ_STRPN       ----------------------MIDIQGIKEALPHRYPMLLVDRVLEVS-ED-TIVAIKN
FABZ_STRP1       -----------------------MDIREIQAALPHRYPMLLVDRVLEVS-DD-HIVAIKN
FABZ2_LACLA      ------------------MTEVNINVTEIMEALPHRYPFLLVDRVIDIA-ED-EITAIKN
FABZ1_ENTFA      -------------------MKKVMTATEIMEMIPNRYPICYIDYVDEII-PNEKIIATKN
FABZ1_LACLA      -----------------MTKKYAMTATEVMEVIPNRYPIMFIDYVDEIS-EN-KIVATKN
FABZ_LACPL       --------------------MSVLEASEIMQLIPNRYPILFMDRVDELN-PGESIVVTKN
FABZ_WOLPM       ---------------------MQFNISDIIKTLPHSYPFLLVDRVIECD-PGKSIKAIKN
FABZ_ANAMM       -------------------MTMALDHKQIMRMLPHSYPFLLVDRVLECI-PGKSIVALKN
FABZ_RICPR       ---------------------MIIAITEIMDLIPHRYPFLLVDRVLKID-PNKSIIGIKN
FABZ_RICRI       ---------------------MIIDITEIMDWIPHRYPFLLVDRVLKID-PNKSITGIKN
FABZ_BRUAB       ------------MSDDNQTKLEAADIQALLAVLPHRYPFLLIDRIVDID-GDVSATGIKN
FABZ_ZYMMO       ----------MTETTEKVESIGPLDVKRVMAALPHRFPMLLVDRVETLI-PGEKIVAIKA
FABZ_BUCAP       ----------------MNSDEYIFNIKDILNILPHRYPFLLIDRILDFK-AFQYLKALKN
FABZ_BUCBP       --------------------MYNSNITDITTLLPHRYPFLLIDRIIAYQ-KNFNILTIKN
                                             :   :*: :*:  :* :             * 

FABZ_ECOLI       VSVNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSV----GKLEPGELYYFAGIDEA
FABZ_YEREN       VSFNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSR----GKLEPGELYYFAGIDEA
FABZ_HAEIN       ISVNEPCFTGHFPGEPILPGVLILEALAQAMGILAFKTH----ELKG-GELFYFAGIDEA
FABZ_PASMU       ISVNEPCFTGHFPEQPIFPGVLILEAMAQATGVLACKTY----RQLE-NEIYYFAAIDNA
FABZ_VIBCH       VSVNEPQFTGHFPQLPVFPGVLILEAMAQATGLLAFKTF----GAPKENELYYFASIDEA
FABZ_NEIMA       VTINEPQFQGHFPDLPVMPGVLIIEAMAQACGTLAILSE----GGRKENEFFFFAGIDEA
FABZ_NEIMB       VTINEPQFQGHFPDLPVMPGVLIIEAMAQACGTLAILSE----GGRKENEFFFFAGIDEA
FABZ_HELPY       ITFNEDVFNGHFPNKPIFPGVLIVEGMAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKV
FABZ_HELPJ       ITFNEDVFNGHFPNKPIFPGVLIVEGMAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKV
FABZ_CAMJE       ISISDHVFMGHFPGHPIYPGVLILEGMAQTGGVLAFESME--DKVDPKSKVVYFTGIDGA
FABZ_THEMA       ISISDPVFQGHFPEYPIYPGVLIVEGLAQTAGILLLKSVE---------GIPLFLGIDEA
FABZ_AQUAE       VSVNEPVFQGHFPGFPLFPGVYILEAMAQVGGILMIKSLN----LEIGKYAVVFAGIDDA
FABZ_BACHD       VTVNEDFFNGHFPDYPVMPGVLIVEALAQVGACAILNV------EENKGKLAFFAGIDNC
FABZ_BACSU       VTANEEFFNGHFPQYPVMPGVLIVEALAQVGAVAMLIK------EENRGRLAFFAGIDNC
FABZ_SYNY3       VTINEPFFPGHIPDRPIMPGVLIVESMAQVGGVILTQL------PGMRGKFFAFAGIDGV
FABZ_CHLMU       VTINEPFFVGHFPEAPIMPGVLILEALAQAAGVLLGIIL----ENDRDKKIALFLGIQKA
FABZ_CHLTR       VTINEPFFAGHFPGAPIMPGVLILEALAQAAGVLLGIIL----ENDRDKKIALFLGIQKA
FABZ_CHLPN       VTINEPFFMGHFPNAPIMPGVLILEALAQAAGVLIGLVL----ENDRNKRIALFLGIQKA
FABZ_PARUW       VTINESFFQGHFPNAPIMPGVLILEALAQAGGILVHLRG----PGD---KIAILLNVNHA
FABZ_PSEAE       VSINEPFFNGHFPEHPIMPGVLIIEAMAQAAGILGFKMLD---VKPADGTLYYFVGSDKL
FABZ_XYLFA       VSINEPFFQGHFPEHPVMPGVLIIEALAQAGGVMTQLNLS---HNGHSSLLFYMVRVDNA
FABZ_DEIRA       VTINEPFFMGHFPTEPVMPGVLITEALAQASMFCLHGQME---PGQ----IGYLAGIEGA
FABZ_STRPN       VTINEPFFNGHFPQYPVMPGVVIMEALAQTAGVLELS------KPENKGKLVFYAGMDKV
FABZ_STRP1       VTINEPFFNGHFPHYPVMPGVLIMEALAQTAGVLELS------KEENKGKLVFYAGMDKV
FABZ2_LACLA      VTINEEFFQGHFPQYPVMPGVLIMEALAQAAGVLELS------KPENKGKLVFYAGMDNV
FABZ1_ENTFA      VTINEEFFQGHFPGNPTMPGVLIIEALAQVGSILILK------MDQFEGETAYIGGINKA
FABZ1_LACLA      VTINEEVFNGHFPGNPTFPGVLILESLAQAGSILILK------KEEFQGKMAYIGGIDKA
FABZ_LACPL       VTINESFFQGHFPGNPVMPGVLIIEALAQAASILILK------SEKFAGKTAYLGAIKDA
FABZ_WOLPM       VTFNEPFFIGHFPGHPIMPGVLIIESLAQASAICVL----G--KETIENKVVYLRSIENA
FABZ_ANAMM       VTFNEPFFVGHFRDNPVMPGVLIIESMAQSSMLCVVSDREG--DEASGNRSVYFMSIDGA
FABZ_RICPR       VTVNEPQFTGHFPARPVMPGVLMVESMAQLAAILVA---KS--LDSTKNKEVFLMSIENT
FABZ_RICRI       VTVNEPQFTGHFPARPVMPGVLMVEAMAQLAAILVA---KS--LGSTKNKEVFLMTIENA
FABZ_BRUAB       VTINEPHFTGHFPENPIMPGVLIVEAMAQTAGAISL---LQ--RKTGRPGVVYFMTIDNA
FABZ_ZYMMO       VTINEPFFTGHFPGNPIMPGVLIVEALAQAAGVLAIE--SL--GLTGTGKLVYFMAINET
FABZ_BUCAP       CTVNEPFFQGHFIKEPVFPGVLMIEAMSQAAAVLIFKSI----GKLNINQLYYFVGIENT
FABZ_BUCBP       ISYSEFCFTGHFYKNPVFPGVLILEAIAQSACLLVYKSF----GMSYKNNLFYLTNIIDV
                  : .:  * **:   *  *** : *.::*                               

FABZ_ECOLI       RFKRPVVPGDQMIMEVTFEKTR-RGLTRFKGVALVDGKVVCEATMMCARSREA-------
FABZ_YEREN       RFKRPVVPGDQMIMEVEFVKER-RGLTRFTGVAKVDGEIVCTATMMCARSKPATAVVIKS
FABZ_HAEIN       RFKRPVLPGDQMELNVQVIKKR-RGITAFTGVATVNGEIACEAKLMCARR----------
FABZ_PASMU       RFKRPVLPGDQMVLEVHFLKER-RGITRFTGVATVDGQVVCEAELMCARRPA--------
FABZ_VIBCH       KFRKPVTPGDQLMVEVEFLKER-RGIALFNGVAKVDGDVVCSAQLKCARREF--------
FABZ_NEIMA       RFKRQVIPGDQLVFEVELLTSR-RGIGKFNAVAKVDGQVAVEAVIMCAKRVV--------
FABZ_NEIMB       RFKRQVIPGDQLVFEVELLTSR-RGIGKFNAVAKVDGQVAVEAIIMCAKRVV--------
FABZ_HELPY       KFRIPVTPGDRLEYHLEVLKHK-GMIWQVGGTAQVDGKVVAEAELKAMIAERD-------
FABZ_HELPJ       KFRIPVTPGDRLEYHLEVLKHK-GMIWQVGGTAQVDGKVVAEAELKAMIAERE-------
FABZ_CAMJE       KFRNPVRPGDRLDYEMSVVKNR-GNMWIFKGQAFVDGNLVAEAELKAMIVDK--------
FABZ_THEMA       RFKKEVRPGDRLIYEVRKLGEK-LGTVQVEGVAKVDDKIVAKARLLLGVKKK--------
FABZ_AQUAE       RFKKPVYPGDQLILELEVISLK-KALSKMKGVAKVDGEVVAQATLMAAARKLEDIKRNA-
FABZ_BACHD       RFKEQVKPGDQLRLEVEIVRMK-GPVGKGRGVASVNGKTVAETDLMFAIK----------
FABZ_BACSU       RFKKQVKPGDQLHLEVEIIRAR-GTIGRGKGVATVDGEVVCEVELTFALGE---------
FABZ_SYNY3       RFRRPVVPGDQLIMTVELQSFKLQRIAKMQGEARVDGQLVCGGEMLFSLID---------
FABZ_CHLMU       KFRQPVKPGDVLILKAEFSLIS-AKGGKAIAQAFVGSQIVAEGELSFVLVKKESI-----
FABZ_CHLTR       KFRQPVKPGDVLTLKAEFSLIS-AKGGKAFAQAFVGSQVVAEGELSFVLVKKESI-----
FABZ_CHLPN       KFRQAVRPGDVLTLQADFSLIS-SKGGKAWAQARVDSQLVTEAELSFALVDKESI-----
FABZ_PARUW       KFRQPVKPGDVLHLKGEGLHFS-SKGGRIKAEALVNQKIAAEAEIGFVFVDKSQI-----
FABZ_PSEAE       RFRQPVLPGDQLQLHAKFISVK-RSIWKFDCHATVDDKPVCSAEIICAERKL--------
FABZ_XYLFA       RFNKQVVPGDILILDMTMKRRI-RNMGCYYGEARVNGEVVACADIMCAGVKS--------
FABZ_DEIRA       RFKRKVIPGDQLHLHAKLEFLR-RGLGKTTCRAEVDGEVAAEMQILFAVAKG--------
FABZ_STRPN       KFKKQVVPGDQLVMTATFVKRR-GTIAVVEAKAEVDGKLAASGTLTFAIGN---------
FABZ_STRP1       KFKKQVVPGDQLVMTATFIKRR-GTIAVVEARAEVDGKLAASGTLTFACGQ---------
FABZ2_LACLA      KYKKQVTPGDQLVLHAKFIKRR-GPIAVVEAEATVDGKLAAKGTLTFALGR---------
FABZ1_ENTFA      KFRQKVVPGDVLKLHFEIVKLR-DFVGIGKATAYVEDKKVCECELTFIVGR---------
FABZ1_LACLA      KFRQKVTPGDVMKLEFEITKFR-GKVGTADAAAYVDGKKVTTCQFTFIVDEAAEQTN---
FABZ_LACPL       KFRKIVRPGDVLKLHVQMVKQR-SNMGTVSCQAMVGDKAACTTDLTFIVGATDSK-----
FABZ_WOLPM       KFRKLVTPGDTLILQANIQSVC-LGVYKFRCIASVSEEKVAEATISAVLQNK--------
FABZ_ANAMM       KFRRVVVPGDTLTIKSAVIHMR-GTTCKFQCHAYVGDELASEAQILAMMG----------
FABZ_RICPR       KFRRIVQPGDTMHIHSVIDQQR-ANVWKFSSKVMVECEIAAESKFTAMIKDKM-------
FABZ_RICRI       KFRRIVQPGDTMHIHAVIDQQR-ANVWKFSSTVTVEGEIAAESKFTAMIKDKT-------
FABZ_BRUAB       KFRRPVVPGDRLLLYVKKIKQR-ANISKYECVAEVDGVKVAEAEVAAMISVADENL----
FABZ_ZYMMO       KFRIPVEPGILLRLEVEFLQKR-AKICKFKARALIEDKVAAETEFTAMIADPAN------
FABZ_BUCAP       RFKKIVVPGDQIFIEVIYLKSK-KNFIKFKIFAIVNKKNVCKSTIIFYKKNIFN------
FABZ_BUCBP       KFKKKVIPGDQMLINVFVDKHH-HRLIRFVGHVSVSKYIVCKATISCLLTNDVVSR----
                 ::.  * **  :                    . :    .    .               

FABZ_ECOLI       --------------------
FABZ_YEREN       EVTKSEGTKSEVGKPDVKES
FABZ_HAEIN       --------------------
FABZ_PASMU       --------------------
FABZ_VIBCH       --------------------
FABZ_NEIMA       --------------------
FABZ_NEIMB       --------------------
FABZ_HELPY       --------------------
FABZ_HELPJ       --------------------
FABZ_CAMJE       --------------------
FABZ_THEMA       --------------------
FABZ_AQUAE       --------------------
FABZ_BACHD       --------------------
FABZ_BACSU       --------------------
FABZ_SYNY3       --------------------
FABZ_CHLMU       --------------------
FABZ_CHLTR       --------------------
FABZ_CHLPN       --------------------
FABZ_PARUW       --------------------
FABZ_PSEAE       --------------------
FABZ_XYLFA       --------------------
FABZ_DEIRA       --------------------
FABZ_STRPN       --------------------
FABZ_STRP1       --------------------
FABZ2_LACLA      --------------------
FABZ1_ENTFA      --------------------
FABZ1_LACLA      --------------------
FABZ_LACPL       --------------------
FABZ_WOLPM       --------------------
FABZ_ANAMM       --------------------
FABZ_RICPR       --------------------
FABZ_RICRI       --------------------
FABZ_BRUAB       --------------------
FABZ_ZYMMO       --------------------
FABZ_BUCAP       --------------------
FABZ_BUCBP       --------------------