CLUSTAL format seed alignment for MF_00409

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LPXK_BURPS      ----------MSARPGLLARAEARLTREWQRRGAL----------AWALAPFACAFGAIA
LPXK_BURP1      ----------MSARPGLLARAEARLTREWQRRGAL----------AWALAPFACAFGAIA
LPXK_BURTA      ----------MSARPGLLARAEARLTREWQRRGAL----------AWALTPFACAFGAIA
LPXK_BURCA      ----------MSAPGGPLARLEARLTREWQRRGAL----------AWALTPFACVFGLCA
LPXK_BURCM      ----------MSAPGGPLARLEARVTREWQRRGAL----------AWALTPFACVFGLCA
LPXK_BURL3      ----------MSAPDGPLARLEARLTREWQRRGAL----------AWALTPFACVFGLCA
LPXK_BURCH      ----------MSAPGGPLARLEARLTREWQRRGAL----------AWALTPFACVFGLCA
LPXK_PARXL      ----------MSEISN---RLEARLAREWQQRGPL----------AWALTPFACVFGAIA
LPXK_CUPPJ      ----------MSAPRH---DLADFVTAQWQRRGWF----------AWLMLPFSLLFGLIA
LPXK_CUPNH      ----------MPVPRH---ALADFVTAQWQRRGWF----------AWAMLPFSLLFGLIA
LPXK_CUPMC      ----------MAAPQH---TLADFVTDQWQRRSWF----------TWLMWPLSLLFGLIA
LPXK_RALSO      ----------MPVAQH---RLASFVTRQWQRRGWF----------ARMLWPLSLLFGAVS
LPXK_POLNA      --------------------MKQVLLKAWRARGWL----------ARLLWPVAQLHGLLV
LPXK_POLSJ      -------------------------MRTWLTRGWL----------ARLLWPLAQLHGQAV
LPXK_VEREI      --------MGALRPQPPRMPAGHVAPAYWQKRGLA----------AWALWPLAQLYRALV
LPXK_BORBR      ----------MNAPRC----LRRLLERQWRQGGWL----------STLLRPLAALTGLVV
LPXK_BORPE      ----------MNAPRC----LRRLLERQWRQGGWL----------STLLRPLAALTGLVV
LPXK_BORPA      ----------MNAPRC----LRRLLERQWRQGGWL----------STLLRPLAALTGLVV
LPXK_BORA1      ----------MSLNNY----WSRLLQTQWRDGGWL----------SRLLHPLSRLVDRSV
LPXK_AROAE      --------------------MARNAPAFWQTRSLA----------ARLLLPLSGLFLLLA
LPXK_AZOSB      --------------MAAARGAMPTAPSYWRSRGPR----------ALLLYPLSLLFGLLA
LPXK_DECAR      ---------------MLARWLQRQWFDQRR-RQPA----------LWLLLPLAWLYAGLS
LPXK_NEIMB      -------------MPNCFKFHTVIERHWQKPYPVL----------SFLLKPLSGLFAKIA
LPXK_NEIMF      -------------MPNCFKFHTVIERHWQKPYPVL----------SFLLKPLSGLFAKIA
LPXK_NEIMA      -------------MPNCFKFHTVIERHWQKPYPVL----------SFLLKPLSGLFAKIA
LPXK_NEIG1      -------------MPNFFKFHTVIERHWQKPYPVL----------SFLLKPLSGLFAKIA
LPXK_CHRVO      --------------------MRLIEQHWYRPRGWL----------TALLAPLEGLFALLA
LPXK_THIDA      --------------------MLSLPRLWTHT-GPL----------TLLLLPVAWFFASLV
LPXK_PSEAE      ------------------MSFSERLLAAWYQGHP----------ALALLRPLEALYRRVA
LPXK_PSEAB      ------------------MSFSERLLAAWYQGHP----------ALALLRPLEALYRRVA
LPXK_PSEF5      ------------------MALSDRLLNAWYNGHP----------ALKLLRPLECLYRRVV
LPXK_PSEPF      ------------------MAMSDRLLAAWYHGHP----------ALTLLRPLEWLYRRVV
LPXK_PSE14      ------------------MAFTDRLLDAWYKGHP----------ALALLRPLEGLYRRVV
LPXK_PSEU2      ------------------MAFTDRLLDAWYKGHP----------ALALLRPLEGLYRRVV
LPXK_PSESM      ------------------MALTDRLLDAWYKGHP----------ALTLLRPLESLYRRVV
LPXK_PSEPK      ------------------MAFADRLLAAWYAGHP----------ALALLRPLEALYRRVV
LPXK_PSEE4      ------------------MAFADRLLAAWYAGHP----------ALALLRPLEALYRRVV
LPXK_ALCBS      -----------------MGSLSEWVQQGWYKGSP----------WLVPLRPLSALVSFEA
LPXK_HAHCH      --------------------MIAWVERVWYGGSR----------WKFLLWPLSWLYLLVV
LPXK_SHESM      --------------------MQVLVNKIWYEGHPLRW----------LLLPFSVLFALIT
LPXK_SHESR      --------------------MQVLVNKIWYEGHPLRW----------LLLPFSVLFALIT
LPXK_SHESA      --------------------MQALVNKIWYEGHPLRW----------LLLPFSVLFALIT
LPXK_SHEON      --------------------MQALVNKIWYQGHPLRW----------LLLPLSALFAFIT
LPXK_SHESW      --------------------MQTLVNKIWYQGHPLQW----------LLLPLSFVFGFIT
LPXK_SHEFN      --------------------MQQLIHRIWYQGHQAKW----------LLLPLSGIFWFIS
LPXK_SHEDO      --------------------MQRWINNIWYGSNPIKW----------LLVPLSGLFWLIS
LPXK_SHEAM      --------------------MQSFVHKIWYQGHPAAW----------LLLPLSLLFWLVS
LPXK_SHELP      --------------------MQALVNRLWYDRQAGVHW-----LLVLLLLPLSGLFYLLT
LPXK_PSEA6      -------------------------------------------------MPLTVLFWLIS
LPXK_BLOFL      -----------------------MLFNIWFGSSL----------CYLFLLPFSWVYGFFS
LPXK_BLOPB      -----------------------MFDRIWFKSSF----------FYLFLLPFSWLYGVIS
LPXK_WIGBR      MRKSTVYSWINKKKYILKINVISIINYIWFKKTI----------MRFFLYPFSLIYFLVI
LPXK_PECAS      -----------------------MIERIWSGQSR----------LYWLLLPLSWLYGLIT
LPXK_SODGM      -----------------------MIARIWSGASR----------LYWLLLPFSWLYGLIT
LPXK_SHIFL      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_SHISS      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_SHIF8      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_ECOLI      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_SHIBS      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_ECO57      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_SHIDS      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_ECOK1      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_ECOUT      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_ECOL5      -----------------------MIEKIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_SALCH      -----------------------MIARIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_SALTY      -----------------------MIARIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_SALPA      -----------------------MIARIWSGESS----------LWRLLLPLSWLYGLVS
LPXK_SALTI      -----------------------MIARIWSGESP----------LWRLLLPLSWLYGLVS
LPXK_YERPE      -----------------------MIERIWSGQSR----------LYLLLLPLSWLYGAVT
LPXK_YERPS      -----------------------MIERIWSGQSR----------LYLLLLPLSWLYGAVT
LPXK_YERPA      -----------------------MIERIWSGQSR----------LYLLLLPLSWLYGAVT
LPXK_YERPN      -----------------------MIERIWSGQSR----------LYLLLLPLSWLYGAVT
LPXK_YERE8      -----------------------MIERIWSGKSW----------LYLLLLPLSWLYGAIT
LPXK_PHOLL      -----------------------MIERIWSGRSW----------LYLLLLPFSALYGLIS
LPXK_PHOPR      --------------------MAALIEKFWFGHHPKGLMLLLNVLFWPVFWPLSKLFGFIS
LPXK_ALIF1      -----------------------MIEKIWFDNH------FLGKLLWPLLWPLSYLFKWIA
LPXK_VIBVU      -----------------------MIEKIWFENHP------VKYLLWPLLWPLSLLFGAIS
LPXK_VIBVY      -----------------------MIEKIWFENHP------VKYLLWPLLWPLSLLFGAIS
LPXK_VIBPA      -----------------------MVEKIWFENHP------LKYLLWPLLWPLSVLFGAIS
LPXK_VIBCH      ----------------------MVIEKIWFHRHP------LGYLLWPLLWPFSVLFGVIS
LPXK_HAEIN      -------------------------MPFWYSN----------SKLIWLLSPFSLLFWLIS
LPXK_HAEI8      -------------------------MPFWYSN----------SKLIWLLSPFSLLFWLIS
LPXK_MANSM      -------------------------MKFWYTK----------SWIAYLLLPFSFLFWLVS
LPXK_PASMU      -------------------------MQFWYSR----------TWITWLMLPLSFLFWLIS
LPXK_HAES1      -------------------------MFFWYQNHV------IAKLLVWLLFPFSLVFWFIS
LPXK_HAEDU      -------------------------MNIWQKK----------SIISWLLFPFSCLFWLIS
LPXK_AERHH      -----------------------MLERLWYAKSG----------WRWLLAPFALLFAIIS
LPXK_PSYIN      -------------------------MPFWYRPVT----------WAWLLLPLALLFKMIS
LPXK_COLP3      ---------------------MRLIEKVWFNDHPA------KWLLVPMLLPLSALFWLIS
LPXK_PSEHT      ---------------------MSKIEQSWYQPVS---------LITILLLPLAALFWLIS
LPXK_SACD2      ----------------MSAALAKAIERRWYSRPG----------ILWLLYPLALLFRLLS
LPXK_FRANO      -----------------------MLDKIWYRSKP--------NLLSRVLQPISLVFIDIA
LPXK_IDILO      ----------------------MWLQKQWYKARL--------HPLLFLLTPLSLVFWLVT
LPXK_HYDCU      ----------------------MSWPTFWYQTPKQ-------SWKTALLWPVGKLVCWVA
LPXK_LEGPA      --------------------MSFFVNRIWYGNHF----------LQWMLVPFSWLYRIVI
LPXK_LEGPH      --------------------MSFFVNRIWYGNHF----------LQWILVPFSWLYRIVI
LPXK_LEGPL      --------------------MSFFVNRVWYGNHF----------LQWILVPFSWLYRIVI
LPXK_RUTMC      --------------------MNLNIRGI----------------INYSLLPISGIFYLVS
LPXK_PSYA2      ------------------MNIETTITRAWQRQAA----------WLWLLLPVSWLYSLLM
LPXK_PSYCK      ------------------MNIETIITRAWQRKAA----------WLWLLLPVSWLYALLM
LPXK_COXBU      ---------------------MLKAPRFWYQPRS---------LLGGILSPFSFLYQIIV
LPXK_NITOC      -----------------MSDYSSLILRYWYSNQ----------PSRWLLTPLSGLFQLAV
LPXK_METFK      ----------------MGQSFSRWLERQWYGHT----------GWQLILRPFSWLFYILI
LPXK_XANAC      -------------MSK----RGTRTPGYWYDN----------TPIPLPARILAPVYGAAI
LPXK_XANC5      -------------MSK----RGTRTPGYWYDN----------TPIPLPARILAPVYGAAI
LPXK_XANOR      -------------MSK----RGARTPGFWYDN--N-------TPIPLPARILVPVYGAAI
LPXK_XANOM      -------------MSK----RGARTPGFWYDN--N-------TPIPLPARILVPVYGAAI
LPXK_XANCP      -------------MSK----RGARTPGYWYDN----------TPIPLPARMLAPVYGAVT
LPXK_XANC8      -------------MSK----RGARTPGYWYDN----------TPIPLPARMLAPVYGAVT
LPXK_XYLFA      -------------MSSG---RGPRIPEYWYGQ----------VPVPPFMRFMEVIYAGAV
LPXK_XYLFT      -------------MSSG---RGSRIPEYWYGQ----------VPVPPFMRFMEVIYAGAV
LPXK_METCA      -------------MSRSNGVIDAWLQRQWYAE----------AQPPWGLRALSRGFGAAV
LPXK_ALKEH      ---------------------MSELPAFWLRRPP--------DWRAHALRPLAALYGGVM
LPXK_HALHL      ----------------------MSVPGFWLE--D--------GLPARALAPLAALYGAGV
LPXK_NITEC      ---------------------MNWSELYWQRITPL----------HLLLWPVSLLFVLFQ
LPXK_NITEU      ---------------------MNWYELYWQRITPL----------HLFLWPVSQLLILFQ
LPXK_RHIEC      --------------------MISEAPPFWWRK---------ADWRAWLLAPLSFLYGRIA
LPXK_RHIL3      --------------------MISEAPPFWWRK---------ADWRAWLLLPLSFLYGRIA
LPXK_RHIME      --------------------MVSEAPPFWWTK---------ADWRAYALWPFSWVYGRIA
LPXK_AGRFC      --------------------MVSEAPPFWWQK---------AGWQAWLLSPFSLLYGKVA
LPXK_CHESB      -------------------MAASEAPPFWWEK---------PDWRAWALWPLSSAYGFAA
LPXK_BRUAB      --------------------MASEAPPFWWDE---------PDWRALALAPAAWIYGRVS
LPXK_BRUA2      --------------------MASEAPPFWWDE---------PDWRALALAPAAWIYGRVS
LPXK_BRUME      --------------------MASEAPPFWWDE---------PDWRALALAPAAWIYGRVS
LPXK_BRUSU      --------------------MASEAPPFWWDE---------PDWRALALAPAAWIYGRVS
LPXK_RHILO      --------------------MASEAPPFWWEE---------PDWKVLALSPLSAVYALVA
LPXK_BARHE      --------------------MHLSAPHFWWKN---------KSFLRFLLAPISWGYAYFS
LPXK_BARQU      --------------------MLISTPHFWWKD---------KSFLRFLLTPVSWGYGYFS
LPXK_BARBK      --------------------MYISAPHFWWKN---------KSFLSFLLTPFSKVYGYCA
LPXK_NITWN      ----------------------MREPAFWRRP---------SSLLSRLLIPVGALYGAIA
LPXK_NITHX      ----------------------MHEPAFWHRP---------SSLLSRLLMPVGALYGAVA
LPXK_RHOPB      ----------------------MREPGFWYRP---------PSLLSSLLRPLGAIYGAVA
LPXK_RHOP2      ----------------------MREPGFWHRP---------PSWLSRLLLPLGAVYGEIT
LPXK_RHOPS      ----------------------MREPAFWHRP---------PSLLSRLLLPFGAVYGEVT
LPXK_RHOPA      ----------------------MREPGFWHRP---------PSLVSRLLLPIAAIYGNIA
LPXK_BRADU      ----------------------MREPAFWYRP---------RSPESQILRPLGALYGAIT
LPXK_RHOP5      ----------------------MREPEFWRR----------RSLLSLLLMPLAALYGAIA
LPXK_CAUVC      --------------------MKLGTPRWWYV-----KSGAPAPVTRALLTPLSWLWADTT
LPXK_HYPNA      ----------------------MKAPYFWSADLDP-KSREAAPLTRLLLTPFAMLYLWAL
LPXK_RHOS4      ----------------------MRPPAFWFT------PPDSPALAARLLAPLGQAYAAAT
LPXK_RHOS1      ----------------------MRPPAFWFT------PPDSPALAARLLAPLGQAYAAAT
LPXK_PARDP      --------------------MSRRAPDFWFQ------PP---GLRARLLAPLGALYAAAT
LPXK_RUEPO      ----------------------MRAPEFWQN------DPAHPGWQSRLLAPLGALYARAT
LPXK_RUEST      ----------------------MRPPEFWNK------PPSHFDLRACLLSPLGALYAKGT
LPXK_ROSDO      ----------------------MRAPDFWYT------PPQAPALLARLLQPFGKIYGMAT
LPXK_JANSC      ----------------------MRAPGFWHE------PA---GVASTLLAPLGALYAAGT
LPXK_RHORT      ----------------------MRAPEFWHK------DG----FAARLLEPVGLVYAALT
LPXK_MAGSA      ----------------------MRAPDFWRK------DN----AVSRLLAPLGAIYGWAV
LPXK_GLUOX      --------------------MTRRPPRFWLR------PTR--SIAARLLRPFSFIATTLT
LPXK_RICCN      -------------------MIKLLYPEFWQKR----------NIIAYLLLPISVIYKFLG
LPXK_RICRI      -------------------MIKLLYPEFWQKR----------NIIAYLLLPISLIYQFLG
LPXK_RICMO      -------------------MIKLLYPEFWQKR----------NIIAYLLLPISLIYQFLG
LPXK_RICFE      -------------------MIKLLYPEFWQKR----------NIIAYLLLPISLIYQFLG
LPXK_RICPR      -------------------MIKLLYPQFWQER----------NIIAYLLLPISLIYQFLS
LPXK_RICTY      -------------------MIKLLYPQFWQER----------NIIAYLLLPISLIYQFLS
LPXK_RICBR      -------------------MIKLLYPKFWQKR----------NIIAYILFPISWIYQFLG
LPXK_CHLMU      ----------------MRFSFLSGIRDLFRHFIISAASGALSDRLGWVWGAIAKVFSGSV
LPXK_CHLTR      ----------------MRFSFFSGIRDLFRHLIISATSGALSDRLGWLWAVIARVFSGSV
LPXK_CHLPN      ----------------MKKRFPSTLFLFYRRVTIAISLEGILGW-GWLGSLLSKVFAFLV
LPXK_CHLAB      ----------------MKTRFPSPFFIFYRRLTVAISLGKILGW-GCFGKLLSWIFAATV
LPXK_GEOMG      ---------------------------------------MLDRLVLALLAVLSVPYALAV
LPXK_GEOSL      ----------------------MSCTGFWRKLASGEECGAAARLLGAVLAIPAALYGLVV
LPXK_PELPD      --------------------MNSSLATYWRALASGTRRSLPDRSLLSLLVPFSLLYALIQ
LPXK_SYNAS      ----------------------MNVRERCRRLWEDPGPRKDRSPFALLLEVFSLFYRVGV
LPXK_DESPS      --------------------------------------MQKKDILFSIGWPLSSLYAGIM
LPXK_ANADE      -------------------------MSGLEAIWWRERPGPLGALAGAPLLLAEAPFRAAA
LPXK_HELPH      --------------MKSDK---PFLERYFYDPTLL------QKGLIFALYPFSLIYQGIA
LPXK_HELPJ      --------------MKSDK---PFLERYFYDPTLL------QKGLIFALYPFSLIYQCIA
LPXK_HELPY      --------------MKSDK---PFLERYFYDPTLL------QKGLIFALYPFSLIYQGIA
LPXK_HELAH      --------------MKSDK---PFLERYFYTPTLL------QKGLIFALYPFSLIYQCIA
LPXK_CAMJE      --------------MNEEKNYELWLDNYFFKPNFW------QKCLAFILLPLSVLYAFFA
LPXK_CAMJR      --------------MNEEKNYELWLDNYFFKPNFW------QKCLAFILLPLSVLYAFFA
LPXK_CAMJJ      --------------MSEEKNYELWLDNYFFKPNFW------QKCLTFVLFPLSVLYAFFA
LPXK_AQUAE      -------------------------------------------MLRSSLLPFSYLYEKII
                                                                            

LPXK_BURPS      ---ALRRAAYAR-----GWKARVDCGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTP
LPXK_BURP1      ---ALRRAAYAR-----GWKARVDCGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTP
LPXK_BURTA      ---ALRRAAYAR-----GWKARVDCGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTP
LPXK_BURCA      ---ALRRTAYAQ-----GWKQPVDVGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTP
LPXK_BURCM      ---ALRRTAYAQ-----GWKQPVDVGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTP
LPXK_BURL3      ---ALRRTAYAQ-----GWKKPVDVGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTP
LPXK_BURCH      ---ALRRTAYAQ-----GWKQPVDVGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTP
LPXK_PARXL      ---AARRAAFSF-----GWLKSVRVGVPVVVVGNVTVGGTGKTPTVIALVEALRVAGFNP
LPXK_CUPPJ      ---RVRRYGYLH-----GWFKSTRLPMPVIVVGNVTVGGTGKTPAVIALAQALTEAGLRP
LPXK_CUPNH      ---RVRRHGYQR-----GWFKSTRLPMPVVVVGNVTVGGTGKTPAVIALAQALTEAGLRP
LPXK_CUPMC      ---RIRRYGYQQ-----GWFKSTRLPMPVIVVGNVTVGGTGKTPAVIALAHALAEAGLRP
LPXK_RALSO      ---GLRRRLFRW-----GWLRSVRLPVPVVVVGNVTVGGAGKTPAVIALASALADAGLRP
LPXK_POLNA      ---RLRRALYRR-----GMLSSERFKVPVIVVGNVVAGGAGKTPLVMALVKHFQAQGLRV
LPXK_POLSJ      ---RLRRALYRS-----GILESCRFGVPVIVAGNVVAGGAGKTPLVMALVRHLQAQGLQV
LPXK_VEREI      ---AARRGLYRA-----GWLKAQHPGRPVIVVGNVIAGGAGKTPVVIALARHLQARGLRV
LPXK_BORBR      ---ARKRNAYLT-----GARAAWRAPVPVVVVGNIYVGGTGKTPVVIEVVRQLQARGWTP
LPXK_BORPE      ---ARKRNAYLT-----GARAAWRAPVPVVVVGNIYVGGTGKTPVVIEVVRQLQARGWTP
LPXK_BORPA      ---ARKRNAYLT-----GARAAWRAPVPVVVVGNIYVGGTGKTPVVIEVVRQLQARGWTP
LPXK_BORA1      ---RLKREAYRD-----GRKQAWRAPVPVVVVGNIYVGGTGKTPVVVAVLEGLRARGYTP
LPXK_AROAE      ---AVRRQLFRL-----GIRRAVRLPVPVVVVGNIAVGGSGKTPVVEWLVARLRDAGFTP
LPXK_AZOSB      ---ALRRRLYRA-----GLLSQVRLPVKVIVVGNIAVGGSGKTPVVAWLVEQLRAAGWHP
LPXK_DECAR      ---ALNRLLAK----------PKHLPVPVIVVGNIIVGGAGKTPLTLWLARQLRDRGWRP
LPXK_NEIMB      ---AKRRTDFLS-----GKRQSEKLPVPVVVVGNIHAGGTGKTPIVAALVSGLQEKGVKV
LPXK_NEIMF      ---AKRRTDFLS-----GKRQSEKLPVPVVVVGNIHAGGTGKTPIVAALVSGLQEKGVKV
LPXK_NEIMA      ---AKRRTDFLS-----GKRQSEKLPVPVVVVGNIHAGGTGKTPIVAALVSGLQEKGVKV
LPXK_NEIG1      ---AKWRADFLS-----GKRQSEKLSVPVVVVGNIHAGGTGKTPIAAALVSGLQEKGVKV
LPXK_CHRVO      ---AARRQAFRR-----GWKTSGRLPVPVVVIGNINVGGVGKTPLTLALLRDFAARGVKV
LPXK_THIDA      ---TVRRLAFRR-----GWLTRVDVGIPVIVVGNITAGGSGKTPLVIWLTNWLREQGHRP
LPXK_PSEAE      ---NGRRADFL-----SGRKPAYRAPLPVLVVGNITVGGTGKTPMILWMIEHCRARGLRV
LPXK_PSEAB      ---NGRRADFL-----SGRKPAYRAPLPVLVVGNITVGGTGKTPMILWMIEHCRARGLRV
LPXK_PSEF5      ---TGKRQRFL-----AGEGAIYQPPVPLIVVGNITVGGTGKTPLILWLVEHCQRLGLRV
LPXK_PSEPF      ---AGKRQRFL-----DGEGEIYQSPVPVIVVGNITVGGTGKTPMILWLIEHCRRHGLRV
LPXK_PSE14      ---EGKRARFL-----AGEGTIYRAPVPVIVVGNITIGGTGKTPLILWMIEHCRRRGLRV
LPXK_PSEU2      ---ERKRARFL-----AGEGDIYRAPVPVIVVGNITVGGTGKTPLILWMIEHCRRRGLRV
LPXK_PSESM      ---DGKRAKFL-----AGEGDIYRAPVPVIVVGNITIGGTGKTPLILWMIEHCQRKGLRV
LPXK_PSEPK      ---TRKRARFL-----RGDSASYRAPVPVIVVGNITVGGTGKTPMILWLIEHCRRQGLKV
LPXK_PSEE4      ---TRKRARFL-----SGESASYRAPVPVIVVGNITVGGTGKTPMILWLIEHCRRQGLKV
LPXK_ALCBS      ---RRRLQRFR-----KQRP---RPPVPVLVVGNITVGGTGKTPLVIALVEAARSRGLKV
LPXK_HAHCH      ---AIRKTLFAVIKSSASEAGSASIRPPIIVVGNLTVGGAGKTPLVVALVEHFQRRGLRP
LPXK_SHESM      ---AIRRSLFR-----LGLKSQTPLPVPVIVVGNITVGGSGKTPTVIYLIELLRQQGFNP
LPXK_SHESR      ---AIRRSLFR-----LGLKSQTPLPVPVIVVGNITVGGSGKTPTVIYLIELLRQQGFNP
LPXK_SHESA      ---AIRRSLFR-----LGLKSQTALPVPVIVVGNITVGGSGKTPTVIYLIELLRQHGFNP
LPXK_SHEON      ---AFRRSLFR-----LGIKSQTTLPVPVIVVGNITVGGSGKTPTVIYLIELLRNQGFNP
LPXK_SHESW      ---FVRRGLFQ-----LGLKAQTILPVPVIVVGNITVGGSGKTPMVIYLIELLRAHGFNP
LPXK_SHEFN      ---YIRRLLFS-----FGFKQAQVLPVPVIVVGNITAGGSGKTPTVIYLIELLRQHGYKP
LPXK_SHEDO      ---SLRRKKFA-----GSPSASEALGVPVIIVGNITVGGSGKTPMVIYLIELLRRQGYRP
LPXK_SHEAM      ---SLRRAAFR-----LGLKRSERLPVPVVVVGNITAGGSGKTPTVLYLIELLRREGWRP
LPXK_SHELP      ---SLRRQLFR-----LGLKASARLDVPVIVVGNITVGGSGKTPTVIYLIELLRRNGYRP
LPXK_PSEA6      ---KARRWAFL-----TGLKSSVKVSAPVIIVGNISVGGNGKTPLVVHLAQFLQANGYRP
LPXK_BLOFL      ---TLNRISYK-----YGWRKVYRFSVPIIVIGNLTIGGNGKTPMVLWLIDQLKTRGWRV
LPXK_BLOPB      ---TLNRISYQ-----YGWRKVYRFSVPIIIIGNLTIGGNGKTPMVLWLVEHLKRRGWKV
LPXK_WIGBR      ---KIIYILYK-----CNFKKTYNFNIPIIVIGNITVGGNGKTPLVIWLSKQLKKRKWKV
LPXK_PECAS      ---FLIRQSYR-----LGWRKSWRSPVPIVVVGNLTAGGNGKTPVVIWLVEQLQRRGYRV
LPXK_SODGM      ---ALIRFSYR-----RGWRKVHRFPLPIVVVGNLTAGGNGKTPVVLWLVAQLQQRGWRV
LPXK_SHIFL      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_SHISS      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_SHIF8      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_ECOLI      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_SHIBS      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_ECO57      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_SHIDS      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_ECOK1      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_ECOUT      ---GAIRLCYK-----LKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_ECOL5      ---GAIRLCYK-----LKLKRAWRAPIPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRV
LPXK_SALCH      ---GAIRLSYK-----LGFKRAWRAPVPVVVVGNLTAGGNGKTPVVIWLVEKLQQRGVRV
LPXK_SALTY      ---GAIRLSYK-----LGFKRAWRAPVPVVVVGNLTAGGNGKTPVVIWLVEKLQQRGVRV
LPXK_SALPA      ---GAIRLSYK-----LGLKRAWRAPVPVVVVGNLTAGGNGKTPVVIWLVEKLQQRGVRV
LPXK_SALTI      ---GAIRLSYK-----LGLKRAWRAPVPVVVVGNLTAGGNGKTPVVIWLVEKLQQRGVRV
LPXK_YERPE      ---WLIRASYR-----LGLRSAWRSPVPVIIVGNLTAGGNGKTPVVIWLVEQLQQRGYRV
LPXK_YERPS      ---WLIRASYR-----LGLRSAWRSPVPVIIVGNLTAGGNGKTPVVIWLVEQLQQRGYRV
LPXK_YERPA      ---WLIRASYR-----LGLRSAWRSPVPVIIVGNLTAGGNGKTPVVIWLVEQLQQRGYRV
LPXK_YERPN      ---WLIRASYR-----LGLRSAWRSPVPVIIVGNLTAGGNGKTPVVIWLVEQLQQRGYRV
LPXK_YERE8      ---WLIRISYT-----LGLRSAWRAPVPVIIVGNLTAGGNGKTPVVIWLVEQLKQRGYRV
LPXK_PHOLL      ---GLRWLSYK-----TGLRLPWKAPVPVVVVGNLTAGGNGKTPVVIWLVEQLQKKGYRV
LPXK_PHOPR      ---VRRRNKYQ-----TGEKVAYRAPVPVVVVGNITAGGNGKTPVVVWLVEQLQAKGLKP
LPXK_ALIF1      ---TKRKSDYQ-----SGKKQSYRSSVPVVVVGNITAGGNGKTPVVVWLVEQLQSKGYKV
LPXK_VIBVU      ---RRQKAAYQ-----RGAKASFQASIPVIVVGNITAGGNGKTPVVIWLVEKLQQLGFKP
LPXK_VIBVY      ---RRQKAAYQ-----RGAKASFQASIPVIVVGNITAGGNGKTPVVIWLVEKLQQLGFKP
LPXK_VIBPA      ---RSKRQQFQ-----TGRKQAYQAPVPVVVVGNITAGGNGKTPVVVWLVEQLQHLGYKP
LPXK_VIBCH      ---RSRRKAYQ-----TGDKPSYRAPLPVVVVGNITAGGNGKTPVVVWLVETLQNLGYRP
LPXK_HAEIN      ---QLRRALFS-----LGLKSSYRAPKPVIIVGNLSVGGNGKTPVVVWLMEELKKRGLRV
LPXK_HAEI8      ---QLRHALFC-----LGIKSSYRAPKPVIIVGNLSVGGNGKTPVVVWLVEELKKRGLRV
LPXK_MANSM      ---QCRRWLFQ-----AGIIKSYRAPVPIVIVGNLSVGGNGKTPVVIWLVKALQQNGLRV
LPXK_PASMU      ---TCRQFLFR-----KGIFASYRAPVPVIVVGNLSVGGNGKTPVVIWLVKQLQQKGLKV
LPXK_HAES1      ---VIRRRLFR-----LNWLKSYRSPVPVLIVGNLSVGGNGKTPATIWLVKQFQSRGIKV
LPXK_HAEDU      ---QIRWYLFR-----KNWLKSYRSPVPVLIIGNISVGGNGKTPLVVWLVEQLQARQINV
LPXK_AERHH      ---GTRRYAYR-----HGWRKGYRSSLPVIVVGNISVGGNGKTPVVVWLVEQLQARGYRP
LPXK_PSYIN      ---FCRRLAYQ-----KGFFKRYKSKLPVIIVGNISVGGNGKTPFVIWLCEMLITVGYKP
LPXK_COLP3      ---TLRRLSYK-----IGLSRSCQLSKPVIVVGNIGVGGNGKTPIVLYLVELTRLLGLTP
LPXK_PSEHT      ---TLRKWLYT-----CGILTQFSSKTPVIVVGNISVGGNGKTPFVLWLHAHLTQQGLSV
LPXK_SACD2      ---YFRR---R-----SQTQSSVKFAVPVCIVGNIAIGGTGKTPTIIALVHALAEQGITA
LPXK_FRANO      ---NKRK---I-----KQQLKQYKSKIPIIVVGNISVGGTGKTPVVRMLAQQYLAQGKKP
LPXK_IDILO      ---NLRRSFYA-----LGLMPRYKADVPVIVVGNISVGGTGKTPMVVALSQWLKDEGWNP
LPXK_HYDCU      ---ARRLKRFK-----KKG-PSKITAAQVVVIGNIVVGGSGKTPFIQWLGRQLSEHGLTF
LPXK_LEGPA      ---RTRRWYLQ-----R--FCQQLYPIPIIVVGNVTVGGVGKTPLVIEIAKKIQQKGLKV
LPXK_LEGPH      ---RTRRWYLQ-----R--FCQQLYPIPIIVVGNVTVGGVGKTPLVIEIAKKIQQKGLKV
LPXK_LEGPL      ---RTRRWYLQ-----R--FCQQLYPIPIIVVGNVTVGGVGKTPLVIEIAKKIQQKGLKV
LPXK_RUTMC      ---VFRKWLYR-----VNFFKVQKFKYPVIVVGNITVGGTGKTPIVIALAQYFKQQGKQV
LPXK_PSYA2      ---ILRRQAYK-----AGIFSSYRAPIPVMVIGNITVGGSGKTPLIIALVRHLQQQGIKV
LPXK_PSYCK      ---VLRRQAYK-----VGILASYRAPIPVMVIGNITVGGSGKTPLIIALVRHLQQQGIKV
LPXK_COXBU      ---RIRRGLYA-----VGLKKISKFPVPIVIVGNITVGGSGKTPFVIWLANELKNRGFRP
LPXK_NITOC      ---KIRQWAYT-----QGLFHTHILPLPVLVIGNLTLGGTGKTPLVIWLAQFLRQHGYRP
LPXK_METFK      ---ALRRLAYR-----LRLFKSLKLSVPVIIVGNINVGGTGKTPFVIWLVQQLRQNGWYP
LPXK_XANAC      ---ALRRALYRRGW-----RRRHGVPVPVIVVGNVTAGGTGKTPLTIALVAKLQEAGWTP
LPXK_XANC5      ---ALRRALYRRGW-----RRRHRVPVPVIVVGNVTAGGTGKTPLTIALVVKLQEAGWTP
LPXK_XANOR      ---ALRRALYRRGW-----RKRHGVPVPVIVVGNVTAGGTGKTPLTIALVAKLQEAGWTP
LPXK_XANOM      ---ALRRALYRRGW-----RKRHGVPVPVIVVGNVTAGGTGKTPLTIALVAKLQEAGWTP
LPXK_XANCP      ---AVRRSLYRRGW-----LKRHGVPVPVVVIGNVTAGGTGKTPLTITLVSRLQQAGWTP
LPXK_XANC8      ---AVRRSLYRRGW-----LKRHGVPVPVVVIGNVTAGGTGKTPLTITLVSRLQQAGWTP
LPXK_XYLFA      ---SLRRLAYRRGW-----RRRYGVAVPVVVIGNLVAGGTGKTPLTIEIVARLREAGWTP
LPXK_XYLFT      ---SLRRLAYRRGW-----RRRYGVAVPVVVIGNLVAGGTGKTPLTIEIVARLREAGWTP
LPXK_METCA      ---ALRRGYYRRN-------AKVSLGVPVIVVGNLSVGGTGKTPLVIALVELLRQHGWSP
LPXK_ALKEH      ---RLRRYGYRKGW-----IRRGRLPVPVVVVGNIFVGGTGKTPLVAWIADTLAAMGRRP
LPXK_HALHL      ---VLRRGLYQRGW-----LHRPASPVPVIVVGNLFVGGTGKTPLVAWLVTQLREYGWHP
LPXK_NITEC      ---SIRRHLYRR-----AILTSVHLPVPVIVVDSITATSPVKTPLIIQIVNMLRASGLRP
LPXK_NITEU      ---SVRRFLYRR-----AILTSIHLPVPIIIIDSITTDSPVKTSLIIQIANILKAAGLRP
LPXK_RHIEC      GHRMAHARR-------------ASVSVPVICVGNFTVGGAGKTPTALTLARAAKAKGLKP
LPXK_RHIL3      GHRMAHARR-------------ASVPVPVICVGNFTVGGAGKTPTAVTIARAAKAKGLKP
LPXK_RHIME      GMRMDRARR-------------ATSAVPLICIGNFTVGGAGKTPTAIAIARAARARGLKP
LPXK_AGRFC      GRRMRTAKR-------------ANVPVPVICIGNFTVGGAGKTPTAIAIARAAVARGMKP
LPXK_CHESB      SARLRAAKR-------------EKIPAAVLCIGNLTVGGEGKTPIAIALARHAMRKGLTV
LPXK_BRUAB      GRRLIRAVP-------------PRVSLPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKP
LPXK_BRUA2      GRRLIRAVP-------------PRVSLPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKP
LPXK_BRUME      GRRLIRAVP-------------PRVSLPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKP
LPXK_BRUSU      GRRLIRAVP-------------PRVSLPVLCVGNFTVGGAGKTPTAIAFARGAIARGMKP
LPXK_RHILO      GRVMRRARR-------------EKIEAPVLCVGNFTVGGTGKTPVAIALAQQAKRMQLKP
LPXK_BARHE      RRRMARH-P-------------PIVDLPVLCIGNFTCGGAGKTPVVIAFAKVAKELGFVP
LPXK_BARQU      HRCMVRE-L-------------PVIDLPVLCIGNFTCGGAGKTPVVIAFAKVAKELGFLP
LPXK_BARBK      RRGMERK-P-------------PVIDLPVLCVGNFTLGGAGKTPVVIVLSQAAKKLGLKP
LPXK_NITWN      ARRLSRTG--------------LRAGVPVICVGNYHLGGAGKTPTVLALAGILRSLGETP
LPXK_NITHX      ARRLMRTG--------------MRAGVPVICVGNYHVGGAGKTPTVIALAGILRSLGETP
LPXK_RHOPB      AHRMAQPG--------------TAVGVPVLCIGNFHGGGAGKTPTALALARLLLELGERP
LPXK_RHOP2      SWRMRKTG--------------VEAGAPVICVGNYHLGGAGKTPTTLALVRLLRDLDEQP
LPXK_RHOPS      AARMQKVG--------------IETGVPVLCVGNYHLGGAGKTPTTLALVQLLRDLGEHP
LPXK_RHOPA      AARMQKAG--------------TTVGVPVLCVGNYHMGGAGKTPTTLALVALLREFGETP
LPXK_BRADU      ARRMALQG--------------FDAGIPVICVGNYHVGGAGKTPTVLALTKLLRELGETP
LPXK_RHOP5      ASRMRKPG--------------RSIAVPVICVGNYHGGGAGKTPTTLTLVALLRELDETP
LPXK_CAUVC      RRRIARATP-------------AIVGAPVICVGNVTMGGAGKTPIVRELLLTLTQRGVAA
LPXK_HYPNA      RRKLAKARP-------------EAAPVPVVCIGNLTAGGAGKTPVTEAIRNRIRSAGLRA
LPXK_RHOS4      ARRL-RAPG-------------HRAGVPVICIGNLNAGGTGKTPTAIALMQRLAARGIEA
LPXK_RHOS1      ARRL-RAPG-------------HRAGVPVICIGNLNAGGTGKTPTAIALMQRLAARGIEA
LPXK_PARDP      ARRLARGPR-------------TRPGVPVICIGNLNAGGTGKTPTTIMLARLLQDRGVAV
LPXK_RUEPO      ARRLAKGDP-------------VSVPVPVICIGNLNAGGTGKTPSAIWVAERLRDAGHEP
LPXK_RUEST      ATRLRKGAP-------------TRAPVPVICVGNLNAGGTGKTPTVIWLMEQLGAAGHEV
LPXK_ROSDO      ARRLAKGTP-------------VKLDVPVICVGNLNAGGTGKTPTVIAVLTTLMDMLETP
LPXK_JANSC      ARRLRTGPR-------------VRVDVPVICIGNINAGGTGKTPTAIALAQRLLAKGVKV
LPXK_RHORT      RHRVARPPG-------------VRLGIPVVCVGNLTAGGAGKTPVALAVMDALRRRGVVG
LPXK_MAGSA      RRNLERAEE-------------YRPAVPVICVGNIVVGGAGKTPVGIALARRLIAAGVKP
LPXK_GLUOX      RRRL-RQPT-------------FHASVPVLCCGNITTGGTGKTPLTLDLVQRLRDRGHHP
LPXK_RICCN      YLRASLARP-------------IMLPAKVICVGNCSVGGTGKTQIVMYLAKLLKSRNVSF
LPXK_RICRI      YLRASLARP-------------IMLPAKVICVGNCSVGGTGKTQIVMYLAKLLKARNVSF
LPXK_RICMO      YLRASLARP-------------IMLPAKVICVGNCSVGGTGKTQIVMYLAKLLKARNVSF
LPXK_RICFE      YLRASLARP-------------IMLPAKVICVGNCSVGGTGKTQIVMYLAKLLRAKNVSF
LPXK_RICPR      YLRASLAYP-------------VILPAQVICVGNCSVGGTGKTQIVIYLAKLLKAKNVPF
LPXK_RICTY      YLRTSLACP-------------VILPAKVICVGNCSVGGTGKTQIVIYLAKLLKAKNVSF
LPXK_RICBR      FLRHVFARP-------------VILPAKVICVGNCSVGGTGKTQIVMYLANLLKTQNIDF
LPXK_CHLMU      ---WLRYKIAKP---------PHQVQATVVSVGNIVVGGTGKTPLVLWLAQALNERGISC
LPXK_CHLTR      ---WLRHKIAKS---------PHQVQATVVSVGNIVVGGTGKTPLVLWLAQALHERGLSC
LPXK_CHLPN      ---ACWNRFSWST--------PYRARSTVISVGNIVVGGAGKTPTVLWLAEALRLRGYSC
LPXK_CHLAB      ---SFRRKVLSSA--------PHRVSSTVISVGNIVLGGSGKTPTVLWLAEVLKARGYSC
LPXK_GEOMG      RLRALAYGAGIFR--------VKQLNRPVISVGNLTVGGTGKTPMVALVARLLMARGKRV
LPXK_GEOSL      RLRALAYARGLST--------VRHLDRPVISVGNLTVGGTGKTPMVAYLARRLMARGKRV
LPXK_PELPD      RLRAVLYRVRLLK--------SRRLPRPVISVGNLTVGGTGKTPVTAHIARWLLAEGYRV
LPXK_SYNAS      VLRNDFYDRELFR--------SVRLPCRVISVGNVTAGGTGKTPMVILLARLLKDLGYRP
LPXK_DESPS      KLRCLLYRRGLFR--------QHHFPVPVISVGNLTMGGTGKTPVTHYIAKLLLEHGLQP
LPXK_ANADE      ALRGALYDRGLLP--------AARAGAPVVSIGNLAVGGAGKTPAALAVAARLAGRGRRV
LPXK_HELPH      TIKRKTAKKHD-------------FKIPLISIGNLIAGGSGKTPFILEIAPRYQE----V
LPXK_HELPJ      TIKRKTAKKHD-------------FKIPIISIGNLIAGGSGKTPFILEIAPRYQE----V
LPXK_HELPY      TLKRKTAKKHD-------------FKIPIISIGNLIAGGSGKTPFILEIAPRYQE----V
LPXK_HELAH      TFKRKTAKKHD-------------FKIPIISVGNLIAGGSGKTPFILEIAPRYQE----V
LPXK_CAMJE      ILNTFFRKKIV-------------FKKPVISVGNLSFGGNGKTPLCKAIAREFDG----V
LPXK_CAMJR      ILNTFFRKKIV-------------FKKPVISVGNLSFGGNGKTPLCKAIAREFDG----V
LPXK_CAMJJ      ILNTFFRKKIV-------------FKKPVISVGNLSFGGNGKTPLCKAIAREFDG----V
LPXK_AQUAE      ---NFRNTLYDK-----GFLKIKKLPVPVISVGNLSVGGSGKTSFVMYLADLLKDK--RV
                                            :   ..    .  **     .           

LPXK_BURPS      GVVSRGYGAKIA----APTAVTAA-SPPQQAGDEPL--LIAR----RTLAPVWVCPDRVA
LPXK_BURP1      GVVSRGYGAKIA----APTAVTAA-SPPQQAGDEPL--LIAR----RTLAPVWVCPDRVA
LPXK_BURTA      GVVSRGYGAKIV----APTAVTPA-SAPQQAGDEPL--LIAR----RTLAPVWVCPDRVA
LPXK_BURCA      GVVSRGYGANVK----APTAVTPA-SRAAAAGDEPL--LIAR----RTGAPVWVCPDRVA
LPXK_BURCM      GVVSRGYGANVK----TPTAVTPA-SRASAAGDEPL--LIAR----RTDAPVWVCPDRVA
LPXK_BURL3      GIVSRGYGANVK----APTAVTTA-SRASAGGDEPL--LIAR----RTGAPVWVCPDRVA
LPXK_BURCH      GVVSRGYGANVK----APTAVTPA-SRAAAAGDEPL--LIAR----RTGAPVWVCPDRVA
LPXK_PARXL      GVVSRGYGARVT----TPTQITPA-SAASVGGDEPL--LISR----RTGAPVWVCPDRVA
LPXK_CUPPJ      GVVSRGYGVTLK----HPRRVKPT-SKASDVGDEPL--LIAR----AADVPVWVFPDRAL
LPXK_CUPNH      GVVSRGYGVELK----HPRRVKPT-SKASDVGDEPL--LIAR----ATDVPVWVFPDRAL
LPXK_CUPMC      GVVSRGYGVKLN----HPRRVKPT-SKAADVGDEPL--LIAR----AADVPVWVFPDRAL
LPXK_RALSO      GIVSRGYGAQLK----HPRPVREH-SRAEDVGDEPL--LIAR----ATDLPVWVYPDRVL
LPXK_POLNA      GVVSRGYGRSGH----ESLEVRPG-TPVDESGDEPA--LIQH----ATGAPVFVAQRRTQ
LPXK_POLSJ      GVVSRGYGRSSH----ESLEVSIG-TPVAQSGDEPA--LIKR----ATNAPVFVAKKRAD
LPXK_VEREI      GVIARGHGRSRR----DCRAVLPD-SPASAVGDEPA--LIARHFANGPAVPVFVARRRIS
LPXK_BORBR      GVVSRGYGVDVG----AAPRVGQGQLAAADYGDEPA--LIAR----ATGAAIAVHPHRPR
LPXK_BORPE      GVVSRGYGVDVG----AAPRVGQGQLAAADYGDEPA--LIAR----ATGAAIAVHPHRPR
LPXK_BORPA      GVVSRGYGVDVG----AAPRVGQGQLAAADYGDEPA--LIAR----ATGAAIAVHPHRPR
LPXK_BORA1      GMVSRGYGARIQ----GPPRVGQGQLDPAAFGDEPA--LIAA----ATGAPVAVHPRRAL
LPXK_AROAE      GIVSRGYGGKAP----GAVIVPPH-GDVRLFGDEPV--LLAR----LTACPVAVGADRPA
LPXK_AZOSB      GIISRGHGGSAR----GVLEVVAS-GDAGVCGDEPL--LLAR----LTGVPVFVGRDRPA
LPXK_DECAR      GIVSRGYGRSGD----EVRTVSAQ-SRPEEVGDEPL--LLAR----RSGVPVWVGRHRAV
LPXK_NEIMB      GIISRGYGRKSK----AVHVLNAE-SRAEDAGDEPL--LLFR----KTGAPTAVGSSRAE
LPXK_NEIMF      GIISRGYGRKSK----AVHVLNAE-SRAEDAGDEPL--LLFR----KTGAPTAVGSSRAE
LPXK_NEIMA      GIISRGYGRKSK----AVHVLNAE-SRAEDAGDEPL--LLFR----KTGAPTAVGSSRAE
LPXK_NEIG1      GIISRGYGRKSK----AVYVLNAA-SRAEDAGDEPL--LLFR----KTGAPTAVGSSRVE
LPXK_CHRVO      GVISRGYGGKAP----APTEVGPD-SDPALVGDEP---LLLA----AAGAPVVVGRDRVA
LPXK_THIDA      GVVSRGYGGKAR----RCVELGAE-STAAEVGDEPL--LIHR----KTGAPVVVGRDRPA
LPXK_PSEAE      GVISRGYGARPP----TTPWRVRAEQDAAEAGDEP--LMIVR----RSGVPLMIDPDRPR
LPXK_PSEAB      GVISRGYGARPP----TTPWRVRAEQDAAEAGDEP--LMIVR----RSGVPLMIDPDRPR
LPXK_PSEF5      GVVSRGYGAKPA----QLPWRVSAEDCAAVAGDEP--LLIVQ----RCGVPLMIDPDRGR
LPXK_PSEPF      GVVSRGYGAKPA----QLPWRVQADQTADIAGDEP--LLIVQ----RTGVPLMIDPDRSA
LPXK_PSE14      GVVSRGYGAKPP----SLPWRVKADQSASEAGDEP--LLIVK----RSGVPLMIDPDRSR
LPXK_PSEU2      GVVSRGYGAKPP----SLPWRVLPDQSASEAGDEP--LLIVQ----RCGVPLMIDPDRSR
LPXK_PSESM      GVVSRGYGAKPP----SLPWRVQPDQSASEAGDEP--LLIVQ----RSGVPLMIDPDRSR
LPXK_PSEPK      GVVSRGYGAKPP----QLPWRVQADQAADQAGDEP--LLIVQ----RTGVPLMIDPDRSR
LPXK_PSEE4      GVVSRGYGAKPP----QHPWHVQADQPAEQAGDEP--LLIVQ----RTGVPLVIDPDRSR
LPXK_ALCBS      AVVSRGFAGKTN----HYPQHVTASSDALDMGDEP--VLIAR----RTGVPVVLDPDRRN
LPXK_HAHCH      GVVSRGYGGVSE----SYPVLVERNPDPGVTGDEP--ALIYM----RTGCPVVVAPKRAQ
LPXK_SHESM      GVISRGYGADM-----QGVKVVTAADSAASVGDEP--AMIVA----RTGVPMVVGAKRVD
LPXK_SHESR      GVISRGYGADI-----QGVKVVTAADSAASVGDEP--AMIVA----RTGVPMVVGAKRVD
LPXK_SHESA      GVISRGYGADI-----QGVKVVTAVDSAAAVGDEP--AMIVA----RTSVPMVVGAKRVD
LPXK_SHEON      GVISRGYGAQF-----QGVKVVTVKDAATDVGDEP--AMIVA----RTGVPMVVGAKRVE
LPXK_SHESW      GVISRGYGANI-----DGVKQVAYNASATDVGDEP--AMIVA----RSGVPMVVGSKRVE
LPXK_SHEFN      GVISRGYGVNV-----DGVVAVTPNAKASDVGDEP--AMIVA----RTQVPMVVGAKRVS
LPXK_SHEDO      GVISRGYGVKI-----DGVKLVEAQASAVDVGDEP--AMIVA----RTQVPMAVGPDRLA
LPXK_SHEAM      GVISRGYGASF-----DGELDVVAGMSPAQVGDEP--AMIAM----RTGIPMVVGRNRIK
LPXK_SHELP      GVISRGYGVEF-----SGCKRVIAGMPANEVGDEP--AMIVA----RTQVPMVIGSDRVA
LPXK_PSEA6      GVLSRGYGGNSR----DYPCAVTRNSQPSEVGDEP--VLMRQ----RIHCPMVVDPHRGR
LPXK_BLOFL      GVVSRGYGGRSD----KYPIIINSTSCSKKCGDEP--LLIWR----RTGVLVSVSPNRVK
LPXK_BLOPB      GVISRGYKGKSN----NYPIIINMNSHSEECGDEP--MLIWK----RTGVSVAVSPKRAD
LPXK_WIGBR      GVVSRGY-GRKY----DFPIIINSNFTHDICGDEP--ILIHK----RSNVPVAVSSNRIL
LPXK_PECAS      GVVSRGYGGKAE----RYPLLLNESVTTVQAGDEP--VLIFQ----RTGAPVAVAPRRAE
LPXK_SODGM      GVVSRGYGGRAA----RYPLLLDATTTSDQCGDEP--LLIWQ----RTGAPVAVAPRRSE
LPXK_SHIFL      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTDAPVAVSPVRSD
LPXK_SHISS      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTDAPVAVSPVRSD
LPXK_SHIF8      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTDAPVAVSPVRSD
LPXK_ECOLI      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTDAPVAVSPVRSD
LPXK_SHIBS      GVVSRGYGSKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTDAPVAVSPVRSD
LPXK_ECO57      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTDAPVAVSPVRSD
LPXK_SHIDS      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTDAPVAVSPVRSD
LPXK_ECOK1      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTGAPVAVSPVRSD
LPXK_ECOUT      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTGAPVAVSPVRSD
LPXK_ECOL5      GVVSRGYGGKAE----SYPLLLSADTTTAQAGDEP--VLIYQ----RTGAPVAVSPVRSD
LPXK_SALCH      GVVSRGYGGKAA----AYPLLLTPETTTAEAGDEP--VLIYQ----RTGAPVAVAPERAA
LPXK_SALTY      GVVSRGYGGKAA----AYPLLLTPETTTAEAGDEP--VLIYQ----RTGAPVAVAPERAA
LPXK_SALPA      GVVSRGYGGKAA----AYPLLLTPETTTAEAGDEP--VLIYQ----RTGAPVAVAPERAA
LPXK_SALTI      GVVSRGYGGKAA----AYPLLLTPETTTAEAGDEP--VLIYQ----RTGAPVAVAPERAA
LPXK_YERPE      GVVSRGYGGKSA----VYPLLLSDNTTTAQAGDEP--VLIFQ----RTGAPVAVSPKRAD
LPXK_YERPS      GVVSRGYGGKSA----VYPLLLSDNTTTAQAGDEP--VLIFQ----RTGAPVAVSPKRAD
LPXK_YERPA      GVVSRGYGGKSA----VYPLLLSDNTTTAQAGDEP--VLIFQ----RTGAPVAVSPKRAD
LPXK_YERPN      GVVSRGYGGKSA----VYPLLLSDNTTTAQAGDEP--VLIFQ----RTGAPVAVSPKRAD
LPXK_YERE8      GVVSRGYGGKSD----VYPLLLSNSTTTSQAGDEP--VLIYQ----RTAAPVAVSPKRSD
LPXK_PHOLL      GVVSRGYGGKAE----SYPLLVTENVTTAQAGDEP--VLIHR----RTGAPVAVAPKRVA
LPXK_PHOPR      GVVSRGYGGKAP----HYPYLVEDKTSTDLVGDEP--VLIRR----RTGAPVAVSPIRSD
LPXK_ALIF1      GVASRGYGGKAP----HYPYLLTETTTPDISGDEP--VLIKQ----RTKAEVAVAPVRSE
LPXK_VIBVU      GVVSRGYGAKAP----VYPMVVDSESLTSHCGDEP--KLIFE----RTGALVAVDPIRPN
LPXK_VIBVY      GVVSRGYGAKAP----VYPMVVDSESLTSHCGDEP--KLIFE----RTGALVAVDPIRPN
LPXK_VIBPA      GVVSRGYGAKAP----QYPLVLNDDTPTQHCGDEP--KLIHR----RTGAPVAVDPVRAN
LPXK_VIBCH      GVVSRGYGAKAP----SYPLVVNEQTPAQHCGDEP--KLIFQ----RTKAPVAVDPVRSQ
LPXK_HAEIN      GVISRGYGSKSK----TYPLFVTKNTNPIEGGDEP--VLIAK----RTNAPVVISPNRQQ
LPXK_HAEI8      GVISRGYGSKSK----TYPLFVTENTRPIEGGDEP--VLIAK----RTNAPVVISPNRQQ
LPXK_MANSM      GVISRGYGSQSA----VYPLLVTEKTDPLEGGDEP--VLIAQ----RTQVPVCISANRQQ
LPXK_PASMU      GVISRGYGSQSS----VYPLLVTPDTDPIQGGDEP--VLIAK----RTQVPVCISANRQH
LPXK_HAES1      GVISRGYGSRAE----HYPYLVKIDDNPTRSGDEP--LLIAQ----RTGVPVCISPNRQQ
LPXK_HAEDU      GVISRGYGGKTT----QFPQLVDAQSQAEMVGDEP--VLIVQ----RTGVPLAISPNRKQ
LPXK_AERHH      GVVSRGYGGKAP----HYPYRLDAASTTAQAGDEP--VLIAR----RCGCPVVVAPKRAD
LPXK_PSYIN      AVISRGYGGKSN----HYPLLVGDHIKGHEAGDEP--VLIHK----RLGIPVVVDPNRKN
LPXK_COLP3      GVISRGYGGKAP----HYPYLLDEKSTSIEAGDEP--ILIQQ----RCQVPIAVGSDRI-
LPXK_PSEHT      GIISRGYGGHAK----QYPLLVDHNSTTLEAGDEP--ILLYH----RLQCPIAVGPNRQ-
LPXK_SACD2      GVVARGYGASLA--K-DEVRVLDANATAAMVGDEP--LLIYK----RTGCVVAVGSNRVA
LPXK_FRANO      AIISRGYGAKADN----YPFEVTSGTLATQCGDEPAMLFDAL----QAQVPIVIAPERVQ
LPXK_IDILO      GIISRGYGAKGP-----FPYEVLESDSPEKAGDEP--LLMRR----RTGCPVVIAPKRAQ
LPXK_HYDCU      GVVSRGYGGQSK----VWPQWVTEHSEPTMVGDEP--VLLAQ----SLHCPVAVSPNRAD
LPXK_LEGPA      GIVSRGYKAAIK----HFPYEVKLNDSAELVGDEP--LMMAR----KINCPVVIAPKRNE
LPXK_LEGPH      GIVSRGYKAAIK----HFPYEVKLNDSAELVGDEP--LMMAR----KINCPVVIAPKRNE
LPXK_LEGPL      GIVSRGYKAAIK----HFPYEVKLNDSAELVGDEP--LMMAR----KINCPVVIAPKRNE
LPXK_RUTMC      GIVSRGYGGAHH----QGSLLVNKDTNVYLSGDEP--LLIAL----QTDLPVMINKNRAK
LPXK_PSYA2      GVISRGYGGDSS----QMPALVNTESVPNIVGDEP--CLIVN----MTGVAMAVCPNRQQ
LPXK_PSYCK      GVISRGYGGDSS----QMPALVTTESPPNVVGDEP--CLIVN----TTGTAMAVSPNRQQ
LPXK_COXBU      GVVSRGYGGKAN----RFPQTVTENSDPLQVGDEA--VLLMK----KIDCPMVVCRDRGA
LPXK_NITOC      GLISRGYGGHAQ----NYPQQVYPDSDPHLVGDEA--VLLAR----RTGCPLVVGPDRVA
LPXK_METFK      GIISRGYGGKS-----IHTHQVTKDSLPQEVGDEP--VLLVQ----RTGLPLYVGRKRTR
LPXK_XANAC      GVASRGYGRDDAG----TARWVEADTPVALGGDEP--VLIAW----KTGARVRVDSDRLA
LPXK_XANC5      GVASRGYGRDDAG----TARWVEADTPVALGGDEP--VLIAW----KTGARVRVDSDRLA
LPXK_XANOR      GVASRGYGRDEAG----KARWVEADTPVALGGDEP--VLIAW----KTGARVRVDSDRLA
LPXK_XANOM      GVASRGYGRDEAG----KARWVEADTPVALGGDEP--VLIAW----KTGARVRVDSDRLA
LPXK_XANCP      GVASRGYGRDDAG----TARWVDADTPVALGGDEP--VLIAW----KTGARVRVDTDRLA
LPXK_XANC8      GVASRGYGRDDAG----TARWVDADTPVALGGDEP--VLIAW----KTGARVRVDTDRLA
LPXK_XYLFA      GIASRGYGRRDPK----TPRWIQPDTPIELAGDEP--AMIAW----KTGMRVRVDVDRSA
LPXK_XYLFT      GIASRGYGRRDPK----TPRWIQPDTPIELAGDEP--AMIAW----KTGMRVRVDVDRSA
LPXK_METCA      GVVSRGY-RGSAR----APLEVFCGSDPAEVGDEP--LLIRQ----RTGGPVFVSPRRVE
LPXK_ALKEH      GIVSRGYGGRSRE----WPRRVAADSDPAEVGDEP--LLLAR----GTGCPVAVGPDRVA
LPXK_HALHL      AIVARGYGGRAGK----GPVAVTADSDPADSGDEP--LLLAR----RCAVPVFVGSDRPA
LPXK_NITEC      GIIGHGYTDNYH-----SPMSVTIDSPLQLAGKKS--LLLAYYL--RETCPVWIGHDRIE
LPXK_NITEU      GIISRGYPDNHR-----PPTRVTISSHPHLTGEKS--LLLTYHL--RETCPVWIGYDRIE
LPXK_RHIEC      GFLSRGYGGSLD----VTTVVDPLHHRAVAVGDEP--LLLAQ------EALTVISRRRL-
LPXK_RHIL3      GFLSRGYGGSLD----VTTVVDPDHHRAIAVGDEP--LLLAQ------EALTVISRRRV-
LPXK_RHIME      AFLSRGYGGSLD----VTTVVDPEHHRARDVGDEP--LLLAR------EALTVICRRRV-
LPXK_AGRFC      GFLSRGYGGTLD----VTTLVDAQHHRAAAVGDEP--LLLAR------EAVTVISRRRV-
LPXK_CHESB      GFLSRGYGGSHF----KPHIVSPEDDSARAVGDEP--LLLAR------QALTVISRDRA-
LPXK_BRUAB      GIVSRGYGGNYS----GLHLVDPGHDGARHVGDEP--LLLAR------HAAVALSPDRV-
LPXK_BRUA2      GIVSRGYGGNYS----GLHLVDPGHDGARHVGDEP--LLLAR------HAAVALSPDRV-
LPXK_BRUME      GIVSRGYGGNYS----GLHLVDPGHDGARHVGDEP--LLLAR------HAAVALSPDRV-
LPXK_BRUSU      GIVSRGYGGNYS----GLHLVDPGHDGARHVGDEP--LLLAR------HAAVALSPDRV-
LPXK_RHILO      GFLSRGHGGSFA----EPHVVDAHHDAAKHVGDEP--LLLAE------HAPVAVTPNRA-
LPXK_BARHE      GVVSRGYGGRVK----GIHLVNEEHDNAYDVGDEA--LLLAR------HAFVAISVDRY-
LPXK_BARQU      GVVSRGYGGAVK----GVHLINEQFDNARDVGDEA--LLLAR------HAFVAISSNRY-
LPXK_BARBK      GVVSRGYGRTVK----GVHLVDVECDDAYHVGDEP--LLLAR------HALVAISPDRY-
LPXK_NITWN      VVISRGYGGRLR----GPVRVDPDRHAAADVGDEP--LMMAR------TLPVIVSRQRA-
LPXK_NITHX      VVLSRGYGGRLH----GPVHVDPHRHTAADVGDEP--LMMAW------TIPVIVSRQRA-
LPXK_RHOPB      VVLSRGYGGRLH----GPVSVDPGRHGAADVGDEP--LMMAR------DIPVVVARDRV-
LPXK_RHOP2      IVLSRGYGGRLK----GPILVDPQRHDAADVGDEP--LMMAR------RVPVVVARDRV-
LPXK_RHOPS      VVLSRGYGGRLR----GPILVDAKRHSAADVGDEP--LMMAR------TAPVVVARERT-
LPXK_RHOPA      VVLSRGYGGRLQ----GPVQVDPSRHSAADIGDEP--LMMAR------RVPVVVARDRT-
LPXK_BRADU      VVLSRGYGGRLQ----GPVMVDGARHIAADVGDEP--LMMAR------DVPVVVARDRL-
LPXK_RHOP5      VVLSRGYGGSLN----GPVEVDPDRHSAAEVGDEP--LMMAR------SVPVVVAKDRV-
LPXK_CAUVC      HGLSRGYGGKLK----GPVRVDTIRHTAADVGDEP--LMLAQ------DFPMWIAADRV-
LPXK_HYPNA      ASLSRGHGGAEP----GPLKVDPARHTSRDVGDEP--LLLAG------SGEAWIGRKRP-
LPXK_RHOS4      HVVSRGYGGRLE----GPVEVDARRHRAADVGDEP--LLLAA------FGRAWVARDRA-
LPXK_RHOS1      HVVSRGYGGRLE----GPVEVDARRHRAADVGDEP--LLLAA------FGRAWVARDRA-
LPXK_PARDP      HIVSRGYGGSEK----GPRRVEEARHSAAEVGDEP--LLMAA------FAPVWVADDRL-
LPXK_RUEPO      HVVTRGYGGTLE----GPVQVDPRRHRAEQVGDEP--LLLAA------FAEVWVAKDRA-
LPXK_RUEST      HVVSRGYGGRLE----GPVQVDPRRHSAADVGDEP--LLMAA------FGEVWVARDRG-
LPXK_ROSDO      HVVTRGYGGSLK----GPVRVDPSKHTAKQVGDEP--LLLAA------FAEVWVARDRA-
LPXK_JANSC      HAVTRGYGGEVE----GPLCVEERTHTAKQVGDEA--LLLSA------FLPTWVSTDRQ-
LPXK_RHORT      HFLSRGYGGKME----GPVAVDPVGHGPEDVGDEP--LLLAN------SAPCWVSRNRA-
LPXK_MAGSA      HFLTRGYGGTEV----GPRAVDLDRHDFARVGDEA--LLLAR------EAPTWVSRWRP-
LPXK_GLUOX      HILSRGHGGRER----GPIGVNPNRSTPRDVGDEP--LLLAQ------SAPTWIGADRA-
LPXK_RICCN      VIVTKAYGSNLK----SATTIH-QGHTALEVGDEG--VILAK------YGAVIATKNIK-
LPXK_RICRI      VIVTKAYGSNLK----SATTIH-QGHTALEVGDEG--VILAK------YGAVIATKNIK-
LPXK_RICMO      VIVTKAYGSNLK----SATTIH-QGHTALEAGDEG--VILAK------YGAVIATKSIK-
LPXK_RICFE      VIVTKAYGSNLK----SATTIH-QGHTALEVGDEG--VILAK------YGTVIATKNIK-
LPXK_RICPR      VIITKAYGSHIK----STTIIQ-KGHTALEVGDEG--IMLAR------YGTVIAAKYVK-
LPXK_RICTY      VIITKAYGSNIK----STTIIQ-KWHTALEVGDEG--IMLAK------YGTAIAAKHIK-
LPXK_RICBR      VIVTKAYGSNLK----EATIVK-AEHSTLEVGDES--VILAK------HGTVIATKNIK-
LPXK_CHLMU      AVLSRGYKGKCSQ-RKSFTIVDPALHTAACVGDEP--LLLAKHLP---AGTVRIQKDRKA
LPXK_CHLTR      AVLSRGYKGKYSK-KKAFTIVNPALHTASCVGDEP--LLLAKYLP---SGTVRIQKDRKT
LPXK_CHLPN      GVLSRGYKSQSSR-QKKLTVVDSKVHSASYVGDEP--LLMAEKLP---EGSVWVHKDRRI
LPXK_CHLAB      AILSRGYKGKCSG-QRKLTIVDPEIHDAAYVGDEP--LLMAGKLS---KGAVFVHKDRRL
LPXK_GEOMG      AVISRGYGGSLEGKTHIVSDGQRVFLSAAEAGDEP--VHLAT----AVPGLMAVIGTDRY
LPXK_GEOSL      AVISRGYGGSLEGETRIVSDGRTIVLSAAEAGDEP--VHLAT----SVPGLMTVIGTDRY
LPXK_PELPD      AVLSRGYGGSLEGHTAVVSDGRTVMMEAEQCGDEP--FLLSS----TIPGLMVVMGSDRF
LPXK_SYNAS      AVLSRGYGGKGKAPVNIVSDGASILMSPLEGGDEP--VLIAR----SVPGIPVLTGSDRC
LPXK_DESPS      AIISRGYSGKSGGEVNIVSDGQRILLSAEQAGDEP--YMLAS----MLAGVIVITGKKRY
LPXK_ANADE      AILSRGY-GAARADARVASDGAGALLPAAEAGDEP--ALLAR----RLPGVAVLCGPRRA
LPXK_HELPH      AIVSRGYQRDSKG-LVVVSVKGNILVPQQTAGDEAYLLALNL-----KQASVIVSEKREL
LPXK_HELPJ      AVVSRGYQRDSKG-LVVVSVKGNILVPQKTAGDEAYLLALNL-----KQASVIVSEKREL
LPXK_HELPY      AVVSRGYQRDSKG-LVVVSVKGNILVSQKTAGDEAYLLALNL-----KQASVIVSEKREL
LPXK_HELAH      AIISRGYQRNSKG-LVVVSVKGKILVSQNTAGDEAYLLALNL-----KQASVIVSEKREL
LPXK_CAMJE      FIVLRGYKRKSKG-LFVVKNQNEILCTLTQSGDEAMEYAFEE-----NIKGVIVSEDRVK
LPXK_CAMJR      FIVLRGYKRKSKG-LFVVKNQNEILCTLVQSGDEAMEYAFEE-----NIKGVIVSEDRVK
LPXK_CAMJJ      FIVLRGYKRKSKG-LFVVKNQNEILCTLAQSGDEAMEYAFEE-----NIKGVIVSEDRVK
LPXK_AQUAE      CILSRGYKRKSKG-TLIVSEYGNLKVSWEEAGDEP--YLMAK----LLPHVSVVASEDRY
                    :..                        *.:                          

LPXK_BURPS      AVRALKAAHPEVDVVVSDDGLQHYRLARAVEIVVFDHR------LGGNGFLLPAGPLREP
LPXK_BURP1      AVRALKVAHPEVDVVVSDDGLQHYRLARAVEIVVFDHR------LGGNGFLLPAGPLREP
LPXK_BURTA      AVRALKAAHPEVDVVVSDDGLQHYRLARAVEIVVFDHR------LGGNGFLLPAGPLREP
LPXK_BURCA      AAQALRAAHPDVDVIVSDDGLQHYRLARTVELVVFDHR------LGGNGFLLPAGPLREP
LPXK_BURCM      AAQALRAAHPDVDVIVSDDGLQHYRLARTVELVVFDHR------LGGNGFLLPAGPLREP
LPXK_BURL3      AAQALRAAHPDVDVIVSDDGLQHYRLARTVELVVFDHR------LGGNGFLLPAGPLREP
LPXK_BURCH      AAQALRAAHPDVDVIVSDDGLQHYRLARTVELVVFDHR------LGGNGFLLPAGPLREP
LPXK_PARXL      AAQALCAAHREVDVIVSDDGLQHYRLQRDVELVVFDHR------LGGNGFLLPAGPLREP
LPXK_CUPPJ      CAQTMLVSHPGVNVLLLDDGLQHYRLQRDFEIVMFDSR------MGGNGLMLPAGPLREP
LPXK_CUPNH      CAQTMLVSHPGVNVLLLDDGLQHYKLQRDFEIVMFDSR------MGGNGLLLPAGPLREP
LPXK_CUPMC      CTQAMLVSHPGVNVLLLDDGLQHYKLQRDFEIVMFDTR------MGGNGMMLPAGPLREP
LPXK_RALSO      CAQTLLASHPGCNVIVCDDGLQHYRLRRDIEIVVFDLR------MGGNGFLLPAGPLREP
LPXK_POLNA      ALRDLLAAYPATAVVVCDDGLQHYALQRDIEIAVFDDR------GVGNGWLLPAGPLREP
LPXK_POLSJ      AVRRLLATYPSTAVVVCDDGLQHYALQRDIEIAVFDDR------GVGNGWLLPAGPLREP
LPXK_VEREI      AARALLAAHPDTDVLLCDDGLQHLALRRDLEICVFNDQ------GLGNGFLQPAGPLREP
LPXK_BORBR      AVQALLRAHPGVDVVVSDDGLQHLALARDVEIVVQDER------GVGNGRLLPAGPLREP
LPXK_BORPE      AVQALLRAHPGVDVVVSDDGLQHLALARDVEIVVQDER------GVGNGRLLPVGPLREP
LPXK_BORPA      AVQALLRAHPGVDVVVSDDGLQHLALARDVEIVVQDER------GVGNGRLLPAGPLREP
LPXK_BORA1      AAQALLAAHPEIDVIIADDGLQHLALARDIEIVVQDER------GTGNGLLLPAGPLREP
LPXK_AROAE      AARALLQAYPGCDVIVADDGLQHYPLARDVEIAVVDER------TLGNRWLLPAGPLREG
LPXK_AZOSB      AAAALLQAHPECDVIVSDDGMQHYRLARDLELAVVDPA------TLGNRWLLPAGPLREP
LPXK_DECAR      AGEALLAAHPEVNVLLCDDGLQHYALARDVELVVFDVR------GAGNGWRLPVGPLREP
LPXK_NEIMB      AGRALLAAHPDIGLIVADDGLQHYALRRDVEIAVFPAAD----TGRTDLDLLPNGSLREP
LPXK_NEIMF      AGRALLAAHPDIGLIVADDGLQHYALRRDVEIAVFPSAD----TGRTDLDLLPNGSLREP
LPXK_NEIMA      AGRALLAAHPDIGLIVADDGLQHYALRRDVEIAVFPAAD----TGRTDLDLLPNGNLREP
LPXK_NEIG1      AGRALLAAHPELELIVADDGLQHYALQRDVEIAVFPAAD----TGRTDLDLLPNGNLREP
LPXK_CHRVO      AGRHLLARHPDVELILSDDGLQHYRLARDLEIVVLDGS-----RGLGSGRLLPNGPLREP
LPXK_THIDA      AARVLRARHPEVDIIVSDDGLQHYRLGRALELAVLDAA-----TGFGNGWPLPAGPLREP
LPXK_PSEAE      ALQALLAEE-QLDLVLCDDGLQHYRLARDLELVLIDAA-----RGLGNGRCLPAGPLREP
LPXK_PSEAB      ALQALLAEE-QLDLVLCDDGLQHYRLARDLELVLIDAA-----RGLGNGRCLPAGPLREP
LPXK_PSEF5      AVQALLAAE-PLDLILSDDGLQHYRLARDLELVLIDAA-----RGLGNRRCLPAGPLREP
LPXK_PSEPF      AVRALLDSE-PLDLILSDDGMQHYRLARDLELVLIDAA-----RGLGNRRCLPAGPLREP
LPXK_PSE14      AVQALLAAE-PLDLILSDDGLQHYRLARDLELVLIDAA-----RGLGNRRCLPAGPLREP
LPXK_PSEU2      AVQALLAAE-PLDLILSDDGLQHYRLARDLELVLIDAA-----RGLGNRRCLPAGPLREP
LPXK_PSESM      AVQALLAAE-PLDLILSDDGLQHYRLARDLELVLIDAA-----RGLGNRRCLPAGPLREP
LPXK_PSEPK      AVQALLASE-LLDLILCDDGMQHYRLARDLELVLIDAA-----RGLGNGRCLPAGPLREP
LPXK_PSEE4      AVQALLASD-APDLILCDDGMQHYRLARDLELVLIDAV-----RGLGNRRCLPAGPLREP
LPXK_ALCBS      ALDVAIREY-APDLVISDDGLQHYALPRSAEVVVVDAQ-----RGLGNGRCLPEGPLREP
LPXK_HAHCH      ALQTLLDMY-DCDVVISDDGLQHLALPRDMEVVVVDAQ-----RGWGNGLCLPAGPLREP
LPXK_SHESM      TAKALLAQF-AVDVIICDDGLQHYALGRDIELVVIDGK-----RGLGNRHLLPAGPLREG
LPXK_SHESR      TAKALLAQF-AVDVIICDDGLQHYALGRDIELVVIDGK-----RGLGNRHLLPAGPLREG
LPXK_SHESA      TAKALLAEF-AVDVIICDDGLQHYALGRDIELVVIDGK-----RGLGNRHLLPAGPLREG
LPXK_SHEON      TAKALLTQF-AVDVIICDDGLQHYALGRDIELVVIDGK-----RGLGNRNLLPAGPLREG
LPXK_SHESW      AANVLIAEH-GVDVIICDDGLQHYALGRDIELVVIDGQ-----RRLGNEYLLPAGPLREG
LPXK_SHEFN      AAQTLLTDF-DVDVIISDDGLQHYALGRDIEIALVDGE-----RRYGNHCLLPAGPLREG
LPXK_SHEDO      AVSLLQRHY-DIDVIISDDGLQHYKLTRDIELVIIDGA-----RRFGNGYLLPAGPLREG
LPXK_SHEAM      AAHKLLQCH-DVNVILCDDGLQHYALERDVEILVIDGE-----RRFGNGWLLPAGPLREG
LPXK_SHELP      AGKALMDWQ-AVDVIISDDGLQHYRLKRDIEILVLDGK-----RRFGNGLLLPAGPLREG
LPXK_PSEA6      GAQCLVEEH-DCDVIICDDGLQHYALQRDIEIVVMDAK-----RRTGNHFLLPSGPLRES
LPXK_BLOFL      AVSALLKKQPLLDIIISDDGLQHYALFRDIEWVVVHSL-----RRFGNGCWLPAGPMRER
LPXK_BLOPB      AVAALLRKQ-ELDIIISDDGLQHYALFRDIEWVIVNSV-----LRFGNGCWLPAGPMRER
LPXK_WIGBR      AIKMLLEYY-NLDIIISDDGLQHHSMGRCIEWIVIDNN-----RKFGNNLLLPAGPMRET
LPXK_PECAS      AVSALLARH-TLDVVITDDGLQHYALARDIELVVIDGM-----RRFGNGWWLPAGPMRER
LPXK_SODGM      AVAALLRAQ-SLDVVVTDDGLQHYALGRDIEWVVIDGE-----RRFGNGWWLPAGPMRER
LPXK_SHIFL      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_SHISS      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_SHIF8      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_ECOLI      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_SHIBS      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_ECO57      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_SHIDS      AVKAILAQHPDVQIIVTDDGLQHYCLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_ECOK1      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_ECOUT      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_ECOL5      AVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVAIDGV-----RRFGNGWWLPAGPMRER
LPXK_SALCH      AVKAILAAH-NVQIIITDDGLQHYRLARDIEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_SALTY      AVKAILAAH-NVQIIITDDGLQHYRLARDIEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_SALPA      AVKAILAAH-NVQIIITDDGLQHYRLARDIEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_SALTI      AVKAILAAH-NVQIIITDDGLQHYRLARDIEIVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_YERPE      AIKALLQSH-AVDFIITDDGLQHYALQRDFELVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_YERPS      AIKALLQSH-AVDFIITDDGLQHYALQRDFELVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_YERPA      AIKALLQSH-AVDFIITDDGLQHYALQRDFELVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_YERPN      AIKALLQSH-AVDFIITDDGLQHYALQRDFELVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_YERE8      AVKALLKSH-DLDFIITDDGLQHYALQRDFELVVIDGV-----RRFGNGWWLPAGPMRER
LPXK_PHOLL      AVKALLANT-SLDIIVTDDGLQHYALQRDFEIAVIDGV-----RRFGNGWWLPAGPMREL
LPXK_PHOPR      AVMMLLEHD--VDVIITDDGLQHYALARDIEFVVIDGQ-----RRFGNQQLLPLGPLRET
LPXK_ALIF1      AVKMLEQQG--VDFIITDDGLQHYALQRDIEFIVIDGK-----RRFGNQHYIPLGPLREG
LPXK_VIBVU      AVKRLIELG--ANIIVTDDGLQHYALQRDIEVVVVDGQ-----RRFGNQQLIPLGPLREP
LPXK_VIBVY      AVKRLIELG--ANIIVTDDGLQHYALQRDIEVVVVDGQ-----RRFGNQQLIPLGPLREP
LPXK_VIBPA      AVKALVELD--VDIIITDDGLQHYALERDVELVIVDGN-----RRFGNECLIPLGPLREG
LPXK_VIBCH      AVKALLEHG--VNVIVTDDGLQHYALQRDIEIAVVDGV-----RRFGNQELIPLGPLREP
LPXK_HAEIN      AIELLL-SQAECDIIISDDGLQHYQLQRDLEIVVMDAE-----RALGNGFVLPAGPLREL
LPXK_HAEI8      AIELLL-SQAECDIIVSDDGLQHYKLQRDLEIVVMDAE-----RALGNGFVLPAGPLREL
LPXK_MANSM      AIELLLQTQP-CDVIVSDDGLQHYKLQRDFEIVVVDAQ-----RGFGNGFVMPAGPLREL
LPXK_PASMU      AIELLLQHQPDCDLIISDDGLQHYRLQRDFEIVVLDVQ-----RGFGNGFLLPAGPLREL
LPXK_HAES1      AIELLL-AQFNCDLIISDDGLQHYKLQRDFEIVVIDGE-----RVFGNGFVMPAGPLREL
LPXK_HAEDU      SIELLL-SRFPLDLIISDDGLQHYALQRNIEWVVIDGE-----RRFGNGFLLPAGSLREL
LPXK_AERHH      AVRLLEQSG-EVDIIITDDGLQHYALARDIELVVVDGA-----RRFGNACLLPMGPLREP
LPXK_PSYIN      AVKYIEQHF-LADIIISDDGLQHYALQRDIEIVIVDGK-----RRFGNQHLMPIGPLREN
LPXK_COLP3      ASAKLLIAQGC-DIIISDDGLQHYRLARDLELVVVDGK-----RLFGNGLLLPAGPLREG
LPXK_PSEHT      QNIELLEQTSAIDVIISDDGMQHYKMARSIECCIVDSA-----RQFGNGLLMPAGPLRET
LPXK_SACD2      ACETLLKSH-AVDVILSDDGMQHYKLGRDLELALVDGE-----RVFGNGQLLPVGPLREH
LPXK_FRANO      AVKYIEKNFPDTDIIISDDGLQHYKLARDKEIVVVDAI-----RMFGNKLCLPAGPLREP
LPXK_IDILO      AAKLMAEQHPKVDVIICDDGLQHYALKRDIELIMIDAE-----RGTGNGWLLPAGPLREG
LPXK_HYDCU      AIALLESKY-DLDVIISDDGLQHYKMARDIEIVMMDSE-----RLLGNEYCLPAGPLRES
LPXK_LEGPA      AVRYLLDKH-SVEIIISDDGLQHYKMGRSIEIVVIDGM-----RKLGNGFCLPAGPLREP
LPXK_LEGPH      AVRYLLDKH-SVEIIISDDGLQHYKMGRSIEIVVIDGM-----RKLGNGFCLPAGPLREP
LPXK_LEGPL      AVRYLLDKH-SVEIIISDDGLQHYKMGRSIEIVVIDGM-----RKLGNGFCLPAGPLREP
LPXK_RUTMC      AVKDLINQC-QVDLIISDDGLQHYKMDRDVEIVVIDGI-----KRFGNGFFLPLGPLRES
LPXK_PSYA2      AMTTLLASYPDLQLIIADDGLQHYALQRDIEWIVVDAA-----RGFGNKQLLPTGFLREP
LPXK_PSYCK      AIAILLEAYPDLQLIIADDGLQHYALQRDIEWVVVDAA-----RGFGNKQLLPTGFLREP
LPXK_COXBU      AVKHLLRNF-QCDVVIGDDGLQHYSLGRDLEIALLDD------RHLGNGRCLPAGPLREP
LPXK_NITOC      ASHALLAHS-DCNVLLSDDGLQHYALGRDIEILVVDGV-----RRFGNAHCLPAGPLREP
LPXK_METFK      AARHLLRDYPECNLIISDDGLQHYALERDMEIVIIDGE-----RIFGNGQLLPAGPLREP
LPXK_XANAC      AARALVEAG--CDIVICDDGLQHYRLARDVEIEVVDGQ-----RRYGNGRLLPAGPLREP
LPXK_XANC5      AARALVEAG--CDIVICDDGLQHYRLARDVEIEVVDGQ-----RRYGNGRLLPAGPLREP
LPXK_XANOR      AARALVEAG--CDIVICDDGLQHYRLARDVEIEVVDGQ-----RRYGNGRLLPAGPLREP
LPXK_XANOM      AARALVEAG--CDIVICDDGLQHYRLARDVEIEVVDGQ-----RRYGNGRLLPAGPLREP
LPXK_XANCP      AARALVEAG--CDIIVCDDGLQHYRLARDVEIEVVDGQ-----RRYGNGRMLPAGPLREP
LPXK_XANC8      AARALVEAG--CDIIVCDDGLQHYRLARDVEIEVVDGQ-----RRYGNGRMLPAGPLREP
LPXK_XYLFA      AARALVAEG--CDIVVCDDGLQHYRLMRDIEIEVIDGQ-----RRYGNGHLLPAGPLREP
LPXK_XYLFT      AARALVAEG--CDIVVCDDGLQHYRLMRDIEIEVIDGQ-----RRYGNGHLLPAGPLREP
LPXK_METCA      AARAVLAAG--ADVVVSDDGLQHYALPRDVEIAVVDGV-----RRYGNGRLLPAGPLREP
LPXK_ALKEH      AAQLLLAAG--CDVVVSDDGLQHYRLPRALELVVCDGH-----RGLGNGLCLPAGPLREP
LPXK_HALHL      TVQAAYQAG--CDVVVSDDGLQHYRMRRDAEIVVLDAH-----RRLGNRRLLPAGPLREP
LPXK_NITEC      VAKALLETHKECNVLICNDGLQDLRLQRDFEVVIVDTSV----INSGNGLIMPAGPLRDS
LPXK_NITEU      TAKALLNAHKECNVLICDDGLQDLRLQRDFEAVIVDTSV----INSGNGLIMPAGPLRDS
LPXK_RHIEC      DGARRLVA-EGADLIIMDDGFQSARLAIDYALLVIDATR-----GLGNGHIVPAGPVRAP
LPXK_RHIL3      EGAARLVA-EGADLIIMDDGFQSARLAIDYALLVIDSTR-----GLGNGHIVPGGPVRAP
LPXK_RHIME      DGARKLAA-EGADIIIMDDGFQSARLVFDFALLVVDSGR-----GIGNGHLVPSGPVRAP
LPXK_AGRFC      EGAHRLVK-EGVNLIIMDDGFQSARLTLDYALVVIDTVR-----GIGNGHLVPGGPVRAP
LPXK_CHESB      AGARRLVQ-AGCNLIIMDDGFQSARLHMDYALIVVDAMR-----GLGNGHVFPAGPMRAP
LPXK_BRUAB      KAAEYLKS-LGCDFIIMDDGFQSARLHADFSLLVVDASR-----GIGNGRVIPAGPLRAP
LPXK_BRUA2      KAAEYLKS-LGCDFIIMDDGFQSARLHADFSLLVVDASR-----GIGNGRVIPAGPLRAP
LPXK_BRUME      KAAEYLKS-LGCDFIIMDDGFQSARLHADFSLLVVDASR-----GIGNGRVIPAGPLRAP
LPXK_BRUSU      KAAEYLKS-LGCDFIIMDDGFQSARLHADFSLLVVDASR-----GIGNGRVIPAGPLRAP
LPXK_RHILO      AGARLLMAKHGCDFLIMDDGFQSARIHIDYALIVVDARY-----GIGNGRVIPGGPLRAK
LPXK_BARHE      AAAQRLKK-EGCNLILMDDGFQSRRLYMDYALLVVDAMR-----GFGNGAVFPAGPLRVP
LPXK_BARQU      VAAQRLKE-EGCNLILMDDGFQSRRLYMDYALLVVDAMR-----GFGNGAVFPAGPLRAP
LPXK_BARBK      AAAKRLKE-EGCDLILMDDGFQSRRLYMDYALLVVDAMR-----GLGNGAVFPAGPLRAP
LPXK_NITWN      AGVAPARA-LGASVILMDDGFQNPTLARDISLIVIDGDR-----GLGNRRIFPAGPLRAP
LPXK_NITHX      AGIAPARA-LGASVILMDDGFQNPALAKDISLIVIDRAR-----GLGNGQVFPAGPLRAP
LPXK_RHOPB      AGAALARS-RGASVILMDDGFQNPAVAKDAALIVIDGDR-----GLGNGYVIPAGPLRAP
LPXK_RHOP2      DGAALARS-QGASLLVMDDGFQNPALVKHLSLIVIDSRR-----GVGNGCVFPAGPLRAP
LPXK_RHOPS      DGAALARS-QGASVIVMDDGFQNPALVKDASLIVIDSRR-----GVGNGCVFPAGPLRAP
LPXK_RHOPA      DGAALACA-LGATVILMDDGFQNPALTKDASLIVVDSHR-----SIGNGSVFPAGPLRAP
LPXK_BRADU      DGVALAKS-QGATVILMDDGFQNPRLLKDASLIVIDSER-----GIGNGKVFPAGPLRAP
LPXK_RHOP5      AGATLAMS-RRASVIVMDDGFQNPALAKDVSLIVIDARR-----GIGNGRVIPSGPLRAP
LPXK_CAUVC      AGAKAAVR-AGASAIVMDDGHQNPSVKKALSLVVVDGETRGGEWPFGDGRVFPAGPMREP
LPXK_HYPNA      EAARAMAA-DGAEIILMDDGHQNPSLKKDLTLIVIDAGA-----PFGNGHVLPKGPLREK
LPXK_RHOS4      AGVRAAEA-AGAQAILLDDGFQNPSVVKDLSLIVVDAAV-----GFGNGRCLPAGPLREP
LPXK_RHOS1      AGVRAAEA-AGAQAILLDDGFQNPSVVKDLSLIVVDAAV-----GFGNGRCLPAGPLREP
LPXK_PARDP      AGARAAVE-AGAQAILLDDGFQDPALAHDLSLVVVDAAK-----GFGNGLCLPAGPLREP
LPXK_RUEPO      AGTRAAAA-AGASVIILDDGFQNPSVAKDLSIVVVDAAQ-----GFGNGRCIPAGPLREP
LPXK_RUEST      AGVTEAAA-AGASVIVMDDGFQNPSVAKDFSIIVVDAKR-----GFGNGRCLPAGPLREP
LPXK_ROSDO      AGCAAAAQ-GGASVVVLDDGFQNPSVHKDFSLIVVDAEK-----GFGNGRCLPAGPLREP
LPXK_JANSC      AGARAAVA-DGAECLILDDGFQNPALAYDLSIVVVDAWR-----GFGNGRVIPAGPLREP
LPXK_RHORT      SGGLVAEG-AGAQAVVMDDGHQNPSLAKDLSLVVVDGGY-----GFGNGRYIPAGPLRES
LPXK_MAGSA      DGAVAATE-MGAEVIIMDDGFQNGSIAKDLSLVVVDGSY-----GFGNGRTMPAGPCREP
LPXK_GLUOX      ETARLAIS-QGADCLVMDDGFQNPTLHQDVSVLVVDGVT-----GFGNGCVLPAGPLREP
LPXK_RICCN      EIVPLLNE-LKPDIIIVDDFLQNPYFHKDFTIVSVDSQR-----LFGNGFLIPAGPLRQY
LPXK_RICRI      EIVPLINE-LKPDIIIVDDFLQNPYFHKDFTIVSVDSQR-----LFGNGFLIPAGPLRQY
LPXK_RICMO      EIVPLINE-LKPDTIIVDDFLQNPYFHKDFTIVSVDSQR-----LFGNGFLIPAGPLRQY
LPXK_RICFE      EILPLINE-LKPDIIIIDDFLQNPYFHKDFTIVSVDSQR-----LFGNGFLIPAGPLRQY
LPXK_RICPR      DILPLINE-LKPDVIIVDDFLQNPYLHKDFTIVSVDSQR-----LFGNRFLIPAGPLRQN
LPXK_RICTY      DILPLINE-LKPDVIIVDDFLQNPYLHKDFTIVSVDSQR-----LFGNRFLIPAGPLRQN
LPXK_RICBR      QILPLIHE-LKPSIIIVDDFLQNPYFHKDITIVSVDRQR-----LFGNGFLIPAGPLREY
LPXK_CHLMU      LAEKSAGAF---DVLLLDDGFQCNRLHKDVEIVLVNGSD-----PFGGRAFFPKGRLRDF
LPXK_CHLTR      LAEKSAGDF---DVLLLDDGFQYNRLHKDVEIVLVNGSD-----PFGGGSFFPKGRLRDF
LPXK_CHLPN      SAARAAEKF---GILLLDDGLQYRKLHKDVEIAVVNGQD-----PLGGRAFFPKGRLRDF
LPXK_CHLAB      AAKEVAKNF---DILLLDDGFQNNKLHKDVEIVVVNGQD-----PLGGGAFFPRGRLRDS
LPXK_GEOMG      AAGLLAQERLNPDVFILDDGFQHLRLHRDLNILLMDCSA-----PLGNGMVLPAGLLREP
LPXK_GEOSL      TAGLLALEQLDPDVFILDDGYQHLRLHRDLNILLMDCNR-----PLGNGRTLPAGLLREP
LPXK_PELPD      SAGMLAMEQLAPDVFLLDDGYQHLRLTRDLNILLLDHAL-----PFGNGWTLPAGVLREP
LPXK_SYNAS      LTGRNAIERMGADVLILDDGFQHRRLFRDINIVLLDSDR-----PWGNGFLLPRGPLREP
LPXK_DESPS      LSCKYAVEKMQAEVIILDDGFQHLAVARNLDLVLFDAQT-----GMGNNRVFPGGDLREA
LPXK_ANADE      ELARTAVESLGADALVLDDGFQHRALARDLDVVVLDASN-----PFGNGHLLPRGPNREP
LPXK_HELPH      GVLKALEL--GAKIVFLDDGF-RFNFNQFNALLKPKIPP-------YYPFCLPSGLYRES
LPXK_HELPJ      GVLKALEL--GSKIVFLDDGF-RFNFNQFNALLKPKVPP-------YYPFCLPSGLYREN
LPXK_HELPY      GVLKALEL--GAKIVFLDDGF-RFNFNQFNLLLKPKVPP-------YYPFCLPSGLYRES
LPXK_HELAH      GILKALEL--GSKIVFLDDGF-RFNFNQFNLLLKPKVPP-------YYPFCLPSGLYRES
LPXK_CAMJE      GIEKAFEL--GAKIVVLDDAFSKFHIKKFDILLESKIKP-------YFNFTLPSGAYRLP
LPXK_CAMJR      GIEKAFEL--GAKIVVLDDAFSKFHIKKFDILLESKIKP-------YFDFTLPSGAYRLP
LPXK_CAMJJ      GIEKAFEL--GAKIVVLDDAFSKFHIKKFDILLESKIKP-------YFNFTLPSGAYRLP
LPXK_AQUAE      KGGLLALEKLSPEVFILDDGFQHRKLHRDLNILLLKKKD-------LKDRLLPAGNLREP
                              .. :*      .                          * *  *  

LPXK_BURPS      LS--RRRDATLVNDP------------YSRALPPWPDTFALSLAPGD-------------
LPXK_BURP1      LS--RRRDATLVNDP------------YSRALPPWPDTFALSLAPGD-------------
LPXK_BURTA      LS--RRRDATLVNDP------------YSRALPPWPDTFALSLAPGD-------------
LPXK_BURCA      LS--RHRDATLVNDP------------YSGALPPWPDTYALALTPGA-------------
LPXK_BURCM      LS--RHRDATLVNDP------------YSGALPPWPDTYALALTPGA-------------
LPXK_BURL3      LS--RHRDATLVNDP------------YSGALPPWPDTYSLALTPGA-------------
LPXK_BURCH      LS--RHRDATLVNDP------------YSGALPPWPDTYALALTPGA-------------
LPXK_PARXL      LS--RRRDATLINDP------------YARTLPAWPNTFALQLAPGD-------------
LPXK_CUPPJ      LS--RPRDATLINDP------------NFRATPERPDVYGMRLDLDE-------------
LPXK_CUPNH      LS--RPRDATLINDP------------NFRATPDRPGMYGMRLELDD-------------
LPXK_CUPMC      LT--RPRDATLINDP------------NFRATPDKPDVYGMRLELDE-------------
LPXK_RALSO      MT--RRRDATLINDP------------NYRATHDRPDIYGMRLDLQD-------------
LPXK_POLNA      WPERLRQGVDLVLHT------------GQQP---AFEGYTSRRQLAD-------------
LPXK_POLSJ      WPGRRQQGLDLVLHT------------GLKP---AFEGFTSGRQLAD-------------
LPXK_VEREI      WP----RSVDFVLHA------------GAAPGGSPAPAFGVQRSLAP-------------
LPXK_BORBR      AQRLADVDAIVTNAGRP--------RAAAAPAAGAPRQLAMWLEPTH-------------
LPXK_BORPE      AQRLADVDAIVTNAGRP--------RAAAAPAAGAPRQLAMWLEPTH-------------
LPXK_BORPA      AQRLADVDAIVTNAGRP--------RAAAAPAAGAPRQLAMWLEPTH-------------
LPXK_BORA1      PARLNEVDAIITNLN-T--------GPAQVAQTGAARHWAMWLEPLD-------------
LPXK_AROAE      PGRLRDVDIIIAHGAL---------SPALSSLLDGRPVFAMHLEGSE-------------
LPXK_AZOSB      VGRLDRVDLVIRHGD----------EGELPPRLGARAV-PMRLVGDG-------------
LPXK_DECAR      VSRLASADAVICNGQP---------ETLLPT---ATPSFEMSLKPGL-------------
LPXK_NEIMB      LLRLDSVDAVVVS-GG---------KADALFRP-SENMFHSRIEAGR-------------
LPXK_NEIMF      LLRLDSVDAVVVS-GG---------KADALFRP-SENMFHSRIEAGR-------------
LPXK_NEIMA      LLRLDSVDAVVVS-GG---------KADALFRP-SENMFHSRIEAGR-------------
LPXK_NEIG1      LSRLESVDAVVV--GG---------RAADGFMP-SEHLFGSRIEAGA-------------
LPXK_CHRVO      PSRLAAVDAVVVN-GE---------GAQLPLPD-GLPRFAMTLRPGA-------------
LPXK_THIDA      FRRLHEVDGVVQVVRG---------GGAWRTYL-GLKTWRADYRAGD-------------
LPXK_PSEAE      AERLESVDALLYNGADE----------------DPDGGYAFRLQPTA-------------
LPXK_PSEAB      AERLESVDALLYNGADE----------------DPDGGYAFRLQPTA-------------
LPXK_PSEF5      AERLQSVDAVLYNGAVD----------------DRDDGFAFHLKPSV-------------
LPXK_PSEPF      AERLQSVDGVLFNGALE----------------DRDGGFAFRLKPSA-------------
LPXK_PSE14      VERLGSVDALLYNGATA----------------DRDDGYAFMLKPSA-------------
LPXK_PSEU2      VERLSSVDALLYNGAMA----------------DRGDGYAFRLKPSA-------------
LPXK_PSESM      VERLSSVDALLYNGATA----------------DRDDGYAFTLKPSA-------------
LPXK_PSEPK      ADRLREADAVLFNGASE----------------DRTDGFGFCLQPSA-------------
LPXK_PSEE4      AERLGEADAVLFNGAEA----------------DRDDGFSFRLQPSA-------------
LPXK_ALCBS      ATRLKEVDFVISTGG------------------GWAGAYPMIMRPSG-------------
LPXK_HAHCH      VRRLQSVDLVVSNGLHA----------------QVNADYTMQLRPGR-------------
LPXK_SHESM      AWRLNQVDFVVVNGGP-----------------AQANQYEMQLSPSAVL-----------
LPXK_SHESR      AWRLNQVDFVVVNGGP-----------------AQANQYEMQLSPSAVL-----------
LPXK_SHESA      AWRLNQVDFVVVNGGP-----------------AQANQFEMQLSPSAVL-----------
LPXK_SHEON      EWRLNQVDFVIVNGGP-----------------AVANQYEMQLRPCAVL-----------
LPXK_SHESW      PWRLKDVDFVVINGGN-----------------ADVGQFEMQLAPTQVK-----------
LPXK_SHEFN      LWRLNSVDFVINNGGP-----------------AQNGEVLMALEPAPLC-----------
LPXK_SHEDO      LWRLKTIDWLINNGGK-----------------AQDNEVLMQLEPKPLL-----------
LPXK_SHEAM      AWRKNSVNFVLCNGAS-----------------AEADEYAMTLEPTGLV-----------
LPXK_SHELP      RWRQGRVDFTLVNGEG-----------------SGPEEFEMALAPGNWR-----------
LPXK_PSEA6      TARLGQVDFVVVNGQN-----------------TQSGEWLMSLAPSELV-----------
LPXK_BLOFL      ITRLNTVQAIIINGLSN---------------DIQSGAILMQLCPRS-------------
LPXK_BLOPB      INRLHTVQAIIANGSEV---------------GIQSGEVLMQLFPIA-------------
LPXK_WIGBR      KKKLNKVNKVIINGCCR---------------NKN--IIKMNLYHKNY------------
LPXK_PECAS      ESRLASVDAVVVNGGV-----------------PQTNEIGMTLTAGM-------------
LPXK_SODGM      AGRLQTVQAVIVNGGD-----------------ARPGEVPMRLAAGP-------------
LPXK_SHIFL      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_SHISS      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_SHIF8      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_ECOLI      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_SHIBS      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_ECO57      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_SHIDS      AGRLKSIDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_ECOK1      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_ECOUT      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_ECOL5      AGRLKSVDAVIVNGGV-----------------PRSGEIPMHLLPGQ-------------
LPXK_SALCH      ASRLKTVDAAIVNGGV-----------------ARVGEIPMQLAPGL-------------
LPXK_SALTY      ASRLKTVDAAIVNGGV-----------------ARAGEIPMQLAPGL-------------
LPXK_SALPA      ASRLKTVDAAIVNGGV-----------------ARAGEIPMQLAPGL-------------
LPXK_SALTI      ASRLKTVDAAIVNGGV-----------------ARAGEIPMQLAPGL-------------
LPXK_YERPE      EGRLRSVDAAITNGGL-----------------AAEGEIPMQLVARE-------------
LPXK_YERPS      EGRLRSVDAAITNGGL-----------------AAEGEIPMQLVARE-------------
LPXK_YERPA      EGRLRSVDAAITNGGL-----------------AAEGEIPMQLVARE-------------
LPXK_YERPN      EGRLRSVDAAITNGGL-----------------AAEGEIPMQLVARE-------------
LPXK_YERE8      AGRLRSVDAVITNGGI-----------------AATGEIPMQLAARE-------------
LPXK_PHOLL      SGRLNRVNTIITNGGT-----------------PQPGELSMTLAGEL-------------
LPXK_PHOPR      CDRLADVDFLICNGGK-----------------AQKNEAPMHLQPSA-------------
LPXK_ALIF1      VERLSSVDFLICNGGE-----------------SQENEVSMRLQPSE-------------
LPXK_VIBVU      TSRLQNVDFIITNGGD-----------------AHQGEIAMSLMPDM-------------
LPXK_VIBVY      TSRLQNVDFIITNGGD-----------------AHQGEIAMSLMPDM-------------
LPXK_VIBPA      VERLQEVDFIITNGGL-----------------AHQGEISMSLAPSK-------------
LPXK_VIBCH      VSRLDEVDFIITNGGV-----------------AKANEIAMRLQPTD-------------
LPXK_HAEIN      PSRLKSVDFVITNGGK-----------------NQYSDAVMRLVPHF-------------
LPXK_HAEI8      PSRLKSVDFVITNGGK-----------------NQYSDAVMYLVPHF-------------
LPXK_MANSM      PSRLDSVDLVIANGKA-----------------NRYSQTVMTLAADY-------------
LPXK_PASMU      PSRLNTVDLIICHGQA-----------------SKYSDVEMTLVPHH-------------
LPXK_HAES1      PNRLAEVDLIINNGKL-----------------TGYSNTLMLLLPKF-------------
LPXK_HAEDU      PSRLTSVQAVICNGGT-----------------ANIGEHFMKLDATF-------------
LPXK_AERHH      VTRLKRVDAIICNGGE-----------------PGRGEYPMRLVADV-------------
LPXK_PSYIN      LSRLNSVDFVVNNGGQ-----------------Q-VNEITMLLKAQN-------------
LPXK_COLP3      LWRLPKSDLVIYNGKNDQDY-----------QEKNYPCMHMTLAATE-------------
LPXK_PSEHT      KKRLKSVDLVIENGGNNPQR-----------YNLQPAALKSVLNNST-------------
LPXK_SACD2      PKRLQSVNWLLVNGGS-AEH-----------VNARLQALEAINAAELSSKPNKLNKTPAP
LPXK_FRANO      IERLKEVDQIIVIGNCSDKDKE---------LLKNYKNVTYAK-VVATE-----------
LPXK_IDILO      PWRLKGADWVI----------------------SNYGRHAFARHVVDVE-----------
LPXK_HYDCU      KRRLGLVDFVVWNGGD----AS---------DLASETSTIMKLVPQHF------------
LPXK_LEGPA      DSRLKQVDFVIVNQGA------------------AEGTYSMELIPKN-------------
LPXK_LEGPH      DSRLKQVDFVIVNQGA------------------AEGTYSMELIPKN-------------
LPXK_LEGPL      DSRLKQVDFVIVNQGA------------------AGGAYSMELIPKN-------------
LPXK_RUTMC      ITRLKSVDFVINNAGL------------------CAGEFSVKLTLKM-------------
LPXK_PSYA2      MSRLKGANVVYHQKADSLSSTD----DKYDDTCPPTKRLRMHLQPDN-------------
LPXK_PSYCK      ISRLKDANVIYHHKPDA-SSIY----NKSDHNTLLTEHLTMHLQPDD-------------
LPXK_COXBU      KSRLNTVDFVVPKQLR-----------------PN---EIYQLK-NPAKK----------
LPXK_NITOC      LSRLRTVDLVVTNGMP-----------------QGGEFAMYSQL-QDARH----------
LPXK_METFK      SSRLEDVDAVVFNGGP-----------------PAAGGYLMQLIPEDLRK----------
LPXK_XANAC      AARAQDCDFRVVNLGQAS-----ATATPQAPDDAGFGKWQMRLSIDS-------------
LPXK_XANC5      AARARDCDFRVVNLGQAS-----ATAAPQVPDDAGFGEWQMRLSIDS-------------
LPXK_XANOR      VARARDCDFRVVNLGQAS-----TTAAPQAPDDAGFGEWQMRLSIDS-------------
LPXK_XANOM      VARARDCDFRVVNLGQAS-----TTAAPQAPDDAGFGEWQMRLSIDS-------------
LPXK_XANCP      AARARECDFRVVNLGQGSDAVIPVVGTPVADTDAGFGEWQMRLSIDS-------------
LPXK_XANC8      AARARECDFRVVNLGQGSDAVIPVVGTPVADTDAGFGEWQMRLSIDS-------------
LPXK_XYLFA      MVRGRLCDFRVLNAGQYS---------DRPTSGFGPGDWQMRLHIDH-------------
LPXK_XYLFT      MVRGRLCDFRVLNAGQYS---------DRPTSGFGPSDWQMRLHIDH-------------
LPXK_METCA      VERLASVDFVVCNGGEPG-----------------PGESVMTLEGRT-------------
LPXK_ALKEH      ADRLADVDMVISNGRAPA-----------------LTPWWFELVPGP-------------
LPXK_HALHL      IGRLAGVDIVAVNGDAVP-----------------EGDCVFHLQPGA-------------
LPXK_NITEC      FARLKHSNVVVQAGHHRQ------------IPDIGEEIRTFYITPLKE------------
LPXK_NITEU      FARLKHTDAVILAGHQRR------------IPDITDEIRTIHTRPQKE------------
LPXK_RHIEC      IRQQLRSATALLKVGGG----------------NAADGIVRMAARAA-------------
LPXK_RHIL3      IGQQLRSATALLKVGGG----------------NAADRIVRMAARAA-------------
LPXK_RHIME      IGNQLRHANALLKLGHG----------------SAADPLVRRAARAG-------------
LPXK_AGRFC      LAEQMRQMTGLLKVGKG----------------HAADPLVRQAAKAA-------------
LPXK_CHESB      LTEQMRFADGVVTMGEG----------------DAADIVVRSASRAG-------------
LPXK_BRUAB      LTDQMRKTDALLCIGKG----------------NGADFVIRQAARAG-------------
LPXK_BRUA2      LTDQMRKTDALLCIGKG----------------NGADFVIRQAARAG-------------
LPXK_BRUME      LTDQMRKTDALLCIGKG----------------NGADFVIRQAARAG-------------
LPXK_BRUSU      LTDQMRKTDALLCIGKG----------------NGADFVIRQAARAG-------------
LPXK_RHILO      IVDQLVFTSGLLKMGEG----------------TAADAVVRQAARAG-------------
LPXK_BARHE      LKTQFSLMDSVLLIGDS----------------DACDYIAFLVNRTG-------------
LPXK_BARQU      LKTQFSLMDSVLLIGHS----------------DACENVVFLVTRTG-------------
LPXK_BARBK      LETQLSLMDSVLCIGHL----------------KACNHVDAFITGTG-------------
LPXK_NITWN      LPPQLARTDALVIVGPG----------------SAADDIAASIEARG-------------
LPXK_NITHX      LPPQLARTDALVIVGFG----------------PAADDVAASIGARG-------------
LPXK_RHOPB      LPPQLARTDALIVVGRG----------------RAADPVAAAVKDNG-------------
LPXK_RHOP2      LPLQIERTDALIIIGDG----------------TAADEVAAAIATRG-------------
LPXK_RHOPS      LPLQVARTDVMIIVGDG----------------QAADAVAAQIAARG-------------
LPXK_RHOPA      LPLQVARTDALVVVGDG----------------TAADGLAQQITTKG-------------
LPXK_BRADU      LKAQLARTDALVLIGDG----------------RAANDVAAELAKRN-------------
LPXK_RHOP5      LPLQCERTDALLIIGAG----------------SAADPVAARLKSKG-------------
LPXK_CAUVC      LKVGLSRADAVIVLLPV----------------DVEQPDFDLLVAFG-------------
LPXK_HYPNA      VPEGLARADAVILMGAG----------------PVPPE-----VTAS-------------
LPXK_RHOS4      VEAGLARADLLLSIGGP----------------EAQRRFATDW-PAL-------------
LPXK_RHOS1      VEAGLARADLLLSIGGP----------------EAQRRFATDW-PAL-------------
LPXK_PARDP      VDRGLARAGLLLSIGEA----------------AAQARFAATLGTRL-------------
LPXK_RUEPO      VATGLARADLVLALGDA----------------QAQEQFRDTWGAAL-------------
LPXK_RUEST      VATGLSRADLVLSLGDA----------------RAQETFQSIWGAEI-------------
LPXK_ROSDO      VDIGLKRADALLSVGAA----------------EAQARFDSST-LPT-------------
LPXK_JANSC      VEIGLKRADIVLSIGPD----------------AAQQRFATTWGRHI-------------
LPXK_RHORT      IEAGLARAGAVILIGSD----------------SENLAARIPPHLKA-------------
LPXK_MAGSA      PDQGLARADAMVVIGKD----------------RRGLAELARAH----------------
LPXK_GLUOX      VPDALARAQAVVVMGDD----------------RHNLIPTFPP-----------------
LPXK_RICCN      PNKALDAADLIFLVS------------------SHQDKIPNILTPYV-------------
LPXK_RICRI      PNKALDAADLIFLVS------------------SHQDKIPQILTPYV-------------
LPXK_RICMO      PNKVLDAADLIFLVS------------------SHQDKIPNILTPYV-------------
LPXK_RICFE      PNKALDTADLIFLVS------------------STNDKIPNILTPYI-------------
LPXK_RICPR      PKQVLDAADLIFLVS------------------SNQDQIPNELTPYI-------------
LPXK_RICTY      PKQVLDAADLIFLVS------------------SNQDQIPNELTPYI-------------
LPXK_RICBR      PNRALSAADLVFLVG------------------NNSGGIPVSLASYA-------------
LPXK_CHLMU      PERLAKANYVIVNGKC----------------SPSDQRELDLLNPAA-------------
LPXK_CHLTR      PERLAKADYVMINGRC----------------SPSDQRELDRLHPEE-------------
LPXK_CHLPN      PLRLKTVDAIIVNGG-----------------GKEAGTVVKRVSNAP-------------
LPXK_CHLAB      PKRLQEADFIIVNGSC----------------GLENQKLLHTWCTSP-------------
LPXK_GEOMG      -PLALKRADLVVYT-------------------RCTG-AEAPAVHGA-------------
LPXK_GEOSL      -QTAVRRADLVVYT-------------------RCTG-GKAPAVHGM-------------
LPXK_PELPD      -TSAAGRADLVIRT-------------------RCPRIAPCPSPLPG-------------
LPXK_SYNAS      PTRALRRADIVIRTGGMH--------------NRTSGEAAGTQVETGDSGAV--------
LPXK_DESPS      -RFALDRADAFLITG------------------KCPREEEELLAIELE------------
LPXK_ANADE      -PSALRRAGLVWLSHADR--------------AAPERLEALRALARDA------------
LPXK_HELPH      IKSYKEAHLVITEDKD-------------------YQRITSISHPTKR------------
LPXK_HELPJ      IKSYKEAHLVITEDKD-------------------YQRITSITNPTKR------------
LPXK_HELPY      IKSYEEAHLVVTEDKD-------------------YQRITSISRPTKR------------
LPXK_HELAH      IKSYKEAHLVITEDKD-------------------YKRITSTTHPTKR------------
LPXK_CAMJE      KFYEKRADFIALEGRD-------------------FVRYSFVKENPK-------------
LPXK_CAMJR      KFYEKRADFIALEGRD-------------------FVRYSFVKENPK-------------
LPXK_CAMJJ      KIYEKRADFIALEGRD-------------------FVRYSFVKENPK-------------
LPXK_AQUAE      LKEIRRADALVLTYQEVE------------PFEFFTGKPTFKMFREFC------------
                                                                            

LPXK_BURPS      --------AWHLDRPSRRKPLAQFA----------GERVLAAAGIGAPERFFATLRAAGV
LPXK_BURP1      --------AWHLDRPSRRKPLAQFA----------GERVLAAAGIGAPERFFATLRAAGV
LPXK_BURTA      --------AWHLARPSRRKPLAQFA----------GERVLAAAGIGAPERFFATLRAAGV
LPXK_BURCA      --------AWHLDQPALRRPLSQFA----------HERVLAAAGIGAPERFFATLRAAGL
LPXK_BURCM      --------AWHLDQPALRRPLSQFA----------HERVLAAAGIGAPERFFATLRAAGL
LPXK_BURL3      --------AWHLDQPALRRPLSQFA----------NERVLAAAGIGAPERFFATLRSAGL
LPXK_BURCH      --------AWHLDQPALRRPLSQFA----------HERVLAAAGIGAPERFFATLRAAGL
LPXK_PARXL      --------AWHLDNPALRRPLAQFS----------GDRVLAAAGIGAPERFFATLRAAGL
LPXK_CUPPJ      --------AWQLNDPTMARPVSAFA----------GRRVLAAAGIGNPERFFASLRGAGL
LPXK_CUPNH      --------AWQLADPTMARPVSAFA----------GRRVLAAAGIGNPERFFASLRGAGL
LPXK_CUPMC      --------AWQLNDPTMSCDVSKFA----------DKRVLAAAGIGHPERFFASLRQAGL
LPXK_RALSO      --------AYNLADPALRRPLSQFARLS-------GDQLLAAAGIGNPERFFASLRAAGL
LPXK_POLNA      --------HAVAADGS-SLALTALA----------HQPVVALAGIASPEAFFDMLRARGL
LPXK_POLSJ      --------HAIAADGS-QIALTALR----------GRTLVALAGIANPEAFFAMLRARGL
LPXK_VEREI      --------CALRSDGA-AVPLARLQ----------GQPLHALAAVARPGEFFAMLQARGL
LPXK_BORBR      --------AQRVTDGATRTLADLAALP--------PARLAAAAGIGNPARFFQTLEQAGI
LPXK_BORPE      --------AQRVTDGATRTLADLAALP--------PARLAAAAGIGNPARFFQTLEQAGI
LPXK_BORPA      --------AQRVTDGATRTLADLAALP--------PARLAAAAGIGNPARFFQTLEQAGI
LPXK_BORA1      --------AQRVTDGKRQ---ALSAFR--------GKKIAAAAGIGNPGRFFRTLESAGL
LPXK_AROAE      --------FRRLDGAGCR-NAEAFRGV----------RVHAVAGIGRPERFFAQLTRMGL
LPXK_AZOSB      --------FRGVADPARRCEASAFRGR----------RVHAVAGIGRPQRFFDQLAAMGL
LPXK_DECAR      --------FYRVDVAGQSASAESLRDRG---------RLYALAGIGNPERFFRTLESLGL
LPXK_NEIMB      --------IYRLNNPSEILDTGRLKNQ----------TVVAVAGIAKPARFFDSLRNMGI
LPXK_NEIMF      --------IYRLNNPSEILDTGRLKNQ----------TVVAVAGIAKPARFFDSLRNMGI
LPXK_NEIMA      --------IYRLNNPSEILDTGRLKNQ----------TVVAVAGIAKPARFFDSLRNMGI
LPXK_NEIG1      --------VYRLNRPSEKLDISTLSGK----------RVAAVAGIARPQRFFDTLTHMGI
LPXK_CHRVO      --------CHALDDASRARDAAGFAGR----------KVAALAGIGHPERFFDTLAGQGI
LPXK_THIDA      --------ARRLRAPEERKPLRALAQR----------EWLAATGIGRPEGFFAMLEAHGV
LPXK_PSEAE      ---------LINLQSGERRPLEHFPA---------GQEVHALAGIGNPQRFFRTLEALHW
LPXK_PSEAB      ---------LINLQSGERRPLEHFPA---------GQEVHALAGIGNPQRFFRTLEALHW
LPXK_PSEF5      ---------LVNLRSGERRALEHFAP---------GQALHAVAGIGNPQRFFNTLETLHW
LPXK_PSEPF      ---------LVNLRSGERRPLDHFPP---------GQAVHAVAGIGNPQRFFNTLEALDW
LPXK_PSE14      ---------LINLRSGERQPVDYFPA---------GQALHAVAGIGNPQRFFNTLEGLHW
LPXK_PSEU2      ---------LINLRSGERQPVDYFPA---------GQALHAVAGIGNPRRFFNTLEGLHW
LPXK_PSESM      ---------LINLRSGERQPVSYFPA---------GQALHAVAGIGNPQRFFNTLEGLHW
LPXK_PSEPK      ---------LVNVRTGERRALDHFPA---------GQRLHAVAGIGNPQRFFNTLLGLNW
LPXK_PSEE4      ---------LINLRSGERRALDLFPA---------GQALHAVAGIGNPQRFFNTLLGLNW
LPXK_ALCBS      ---------VTCLADNRTLTPDDFLRL--------HPQVHAVAGIGNPKRFFNLLSILGL
LPXK_HAHCH      ---------WKKVSGDEERGVNYFAG----------YTAHAVAAIGNPGRFFATLADLDV
LPXK_SHESM      ---------PVNPKAVAV--FDPTQPVV------------AMAGIGHPARFFETLTQQGF
LPXK_SHESR      ---------PVNPKAVAV--FDPTQPVV------------AMAGIGHPARFFETLTQQGF
LPXK_SHESA      ---------PVNPKAEAV--FNPTQPVV------------AMAGIGHPARFFETLTQQGI
LPXK_SHEON      ---------PVSPAVTAE--FDSTQPLV------------AMAGIGHPARFFETLTQQGY
LPXK_SHESW      ---------AVDGNIITTD-FDKSQPLV------------AMAGIGNPTRFFDSLQAQGY
LPXK_SHEFN      ---------LVDNNLQDK--FNQQNSVV------------AMAGIGNPQRFFNSISQLGY
LPXK_SHEDO      ---------KVKSSQPGLESLDKALPVV------------AMAGIGNPARFFDSLSGQGY
LPXK_SHEAM      ---------AVAAIHGKSQAKDNSHNAQDNATPRPGDTVNAMAGIGNPQRFFSTLMAQGF
LPXK_SHELP      ---------SVADGQVVTANVDKSHESV------------AIAGIGNPQRFFDTLSEIGV
LPXK_PSEA6      ---------NLNNPTLHLALSELDAPVI------------AAAGIGHPERFYKLLERHKV
LPXK_BLOFL      ---------IINLVTGEIRPIQPLKDV------------VAIAGIGYPKQFFMTLQDYGI
LPXK_BLOPB      ---------VVNILTGERKPLYFLNNV------------VAIAGIGYPTQFFDTLRSYGI
LPXK_WIGBR      ---------VINLLNGSKKRLNDLFPT------------ILISGISNNKNFFSMVRKSGI
LPXK_PECAS      ---------AVNLLSGESRSLSQLYDV------------VAMAGIGHPPRFFATLRDAGV
LPXK_SODGM      ---------AVNLLSGERRALASLAPI------------VAIAGIGHPPRFFATLRAGGV
LPXK_SHIFL      ---------AVNLRTGTRCDVAQLEHV------------VAMAGIGHPPRFFATLKMCGV
LPXK_SHISS      ---------AVNLRTGTRCDVAQLEHV------------VAMAGIGHPPRFFATLKMCGV
LPXK_SHIF8      ---------AVNLRIGTRCDVAQLEHV------------VAMAGIGHPPRFFATLKMCGV
LPXK_ECOLI      ---------AVNLRTGTRCDVAQLEHV------------VAMAGIGHPPRFFATLKMCGV
LPXK_SHIBS      ---------AVNLRTGTRCDVAQLEHV------------VAMAGIGHPPRFFATLKMCGV
LPXK_ECO57      ---------AVNLRTGTRCDVAQLEHV------------VAMAGIGHPPRFFATLKMCGV
LPXK_SHIDS      ---------AVNLRTGTRCDVAQLEHV------------VAMAGIGHPPRFFATLKMCGV
LPXK_ECOK1      ---------AVNLRTGTRCDVAQLEHV------------VAIAGIGHPPRFFATLKMCGV
LPXK_ECOUT      ---------AVNLRTGTRCDVAQLEHV------------VAIAGIGHPPRFFATLKMCGV
LPXK_ECOL5      ---------AVNLRTGTRCDVAQLEHV------------VAIAGIGHPPRFFATLKMCGV
LPXK_SALCH      ---------AVNLRTGARCDVAQLSNI------------VAMAGIGHPPRFFATLEACGA
LPXK_SALTY      ---------AVNLRTGARCDVAQLSNI------------VAMAGIGHPPRFFATLEACGA
LPXK_SALPA      ---------AVNLRTGARCDVAQLSNI------------VAMAGIGHPPRFFATLEACGA
LPXK_SALTI      ---------AVNLRTGARCDVAQLSNI------------VAMAGIGHPPRFFATLEACGA
LPXK_YERPE      ---------AVNLVTGQRQPAEQLQHV------------VAMAGIGHPPRFFATLNLLGI
LPXK_YERPS      ---------AVNLVTGQRQPAEQLQHV------------VAMAGIGHPPRFFATLNLLGI
LPXK_YERPA      ---------AVNLVTGQRQPAEQLQHV------------VAMAGIGHPPRFFATLNLLGI
LPXK_YERPN      ---------AVNLVTGQRQPAEQLQHV------------VAMAGIGHPPRFFATLNLLGI
LPXK_YERE8      ---------AVNLVTGERCPAQQLQHV------------VAMAGIGHPPRFFATLNLLGI
LPXK_PHOLL      ---------AVNMVSGEKRAVNLIPHA------------VAMAGIGHPPRFFATLQQLGA
LPXK_PHOPR      ---------LINVKTGERCSINELENI------------VAMAGIGHPPRFFKTLEELGV
LPXK_ALIF1      ---------AINLVTGERRSVSSLSNL------------VAFAGIGHPPRFFETLNQLKA
LPXK_VIBVU      ---------AVNLMTGEKVTVNELASL------------VAFAGIGHPPRFFKTLEQLGA
LPXK_VIBVY      ---------AVNLMTGEKVAVNELASL------------VAFAGIGHPPRFFKTLEQLGA
LPXK_VIBPA      ---------AINLKTKQQVDVSELKAL------------VAFAGIGHPPRFFNTLESMHA
LPXK_VIBCH      ---------AVNLKTGERCAVSKLTRL------------CAMAGIGHPSRFFNTLRELNA
LPXK_HAEIN      ---------AINLKTNEKRQLNEFQSG------------VAIAGIGNPQRFFTMLEKLGI
LPXK_HAEI8      ---------AINLKTNEKRQLKEFQSG------------VAIAGIGNPQRFFTMLEKLGI
LPXK_MANSM      ---------AVNLVTKEKRLLTEFESG------------SAFAGIGNPQRFFTMLQGFGI
LPXK_PASMU      ---------AINLVTGESRLLSDFHRV------------SAIAGIGHPQRFFSMLENLSM
LPXK_HAES1      ---------AVNLVSGEKKLLRDFQRIP----------LNAIAGIGYPQRFFNMLRDFAL
LPXK_HAEDU      ---------AQNLLTGEQRPLSHFTQA-----------CVAMAGIGYPPRFFNMLRRLGL
LPXK_AERHH      -----------PRRVRDEAPLAAPLSGP----------VDALAGIGHPPRFFATLEGLGY
LPXK_PSYIN      -----------CQRVDGETAQLSS-GVQ----------VNACAAIGYPQRFFDTLNQQQF
LPXK_COLP3      ---------LCNLLTGERIYLTDFIRLND--------SVNAIAGIGAPQRFFDTLKEHQF
LPXK_PSEHT      ---------LTEPIL----------------------TAHAVSAIGNPLRFEQSLQAQGI
LPXK_SACD2      VFAQLEAVKLVNLATGKTLLLQNITELGA---------FVAVAGIGNPARFFKTLQSTGI
LPXK_FRANO      ---------FVNILTAKKVAKTEFNHQNVI----------AIAGIGNPTKFFKTLEESAI
LPXK_IDILO      ---------PGNWYRVDNNEQVALKTESKFN---------AVAGIGYPQRFFNSLIEQGI
LPXK_HYDCU      ---------RSVANPKMILPISSFKHEKT----------NAMAGIGNPQRFFNTLSELGI
LPXK_LEGPA      ---------IVRLSTQEEVSNDLFTSEVA-----------AVAGIGNPQRFYSTLSQLGI
LPXK_LEGPH      ---------IVRLSTQEEVSNDLFTSEVA-----------AVAGIGNPQRFYSTLSQLGI
LPXK_LEGPL      ---------IVRLSTQEEVSKDSFTSEVA-----------AVAGIGNPQRFYSTLSQLGI
LPXK_RUTMC      ---------FVNVKTGEEKSLNYFKGKYCH----------GVAGIGHPERFFNALIRLGI
LPXK_PSYA2      ----LERLWSFDTQSDGLATVKAMAPEKGS-------RVHAVSGIGYPQRFFDTLDTLGF
LPXK_PSYCK      ----LELLWSSNNQIDNLAVV-AMAPEKGS-------QVHAVSGIGYPQRFFDTLNALGF
LPXK_COXBU      -----------IDF-NELKELT----------------VHAVAGIGNPGYFFKQLETLGA
LPXK_NITOC      -----------IKD-GTLRPLKKFRRTK----------LHGVAGIGNPERFFSQLRALEL
LPXK_METFK      -----------VSAPQERMALNELIGQH----------VHAVAGIGNPQRFFGQLEQLGL
LPXK_XANAC      ---------VQPMDGKRAQPLSMLAGQR----------VHAVAGIAHPERFFAMLRARGI
LPXK_XANC5      ---------VQPMDGKRAQPLSMLAGQR----------VHAVAGIAHPERFFAMLRARGI
LPXK_XANOR      ---------VQPMDGKRAQPLSMLAGQR----------VHAVAGIAYPERFFAMLRARGI
LPXK_XANOM      ---------VQPMDGKRAQPLSMLAGQR----------VHAVAGIAYPERFFAMLRARGI
LPXK_XANCP      ---------VQPMDGKRARPLASLAGQR----------VHAVAGIAHPERFFAMLRARGI
LPXK_XANC8      ---------VQPMDGKRARPLASLAGQR----------VHAVAGIAHPERFFAMLRARGI
LPXK_XYLFA      ---------VQSLQGSRRRSLDAFSGQR----------VHAVAGIAHPERFFAMLRQRGI
LPXK_XYLFT      ---------AQSLQGSRRRSLDAFSGQR----------VHAVAGIAHPERFFSMLRQRGI
LPXK_METCA      ---------AVRLADGERRPLAAFAGQR----------IVAMAGIGHPARFFSHLAALGL
LPXK_ALKEH      ---------LRPLAADAAPEGGPEPGTT----------VHAVAGIGHPARFFATLEGLGY
LPXK_HALHL      ---------PRAVDGSQRP----WPGGE----------AHAVAGIGHPERFFASLQEVGI
LPXK_NITEC      -------HFFNLSRPELTASAAELANKR----------IHAVTCDPDIQNFLDNLKFLRL
LPXK_NITEU      -------HFFNLSWPELTADAAGLAGKR----------IHAIVCDPDTQNFLDNLEFLKL
LPXK_RHIEC      ---------KPYFTASLKVRGDD--RLSGI-------KVLAFAGIADPAKFFRTVESRGA
LPXK_RHIL3      ---------KPYFTASLRVRGDN--TLAGT-------KVLAFAGIADPAKFFRTVESRGA
LPXK_RHIME      ---------KPVYVAETVRTDAG--SLDGV-------KVLAWAGIADPEKFFKTVRETGA
LPXK_AGRFC      ---------KPVFVAAIMPQEPE--DFRGK-------RVLAFAGIADPAKFYRTVEALGG
LPXK_CHESB      ---------RPVYSARIRPRSRN--GLKGK-------RVLAFAGIGNPRKFYATLKACGA
LPXK_BRUAB      ---------RPIYHAQLRPSSSA--TVAGR-------RWLAFAGIGNPDKFYESVRQAGG
LPXK_BRUA2      ---------RPIYHAQLRPSSSA--TVAGR-------RWLAFAGIGNPDKFYESVRQAGG
LPXK_BRUME      ---------RPIYHAQLRPSSSA--TVAGR-------RWLAFAGIGNPDKFYESVRQAGG
LPXK_BRUSU      ---------RPIYHAQLRPSSSA--TVAGR-------RWLAFAGIGNPDKFYESVRQAGG
LPXK_RHILO      ---------RPIFEARAEPISKA--GLAGK-------RFLAFAGIGHPDKFFDTVREAGG
LPXK_BARHE      ---------KSLHHAHLESLASD--KVAGK-------SFLAFAGIGNPDKFLKSIKELSG
LPXK_BARQU      ---------KALHHAHLKSLASD--EVMGK-------SFLAFAGIGNPNKFFKSIKELSG
LPXK_BARBK      ---------KSLHYAHLKPLASD--EVSGK-------SFLAFAGIGNPDKFFESIEEISG
LPXK_NITWN      ---------GPVLRARVVPDEASVAALRGR-------RVLAFAGIGDPSRFFRGLRACGV
LPXK_NITHX      ---------GLVLPARLIPDDASVVALRGR-------RVYAFAGIGDPQRFFRSLRACGI
LPXK_RHOPB      ---------GLLLRARFLPAEASLAALCDR-------PVLAFAGIGDPARFFATLRTAGI
LPXK_RHOP2      ---------GVVLRARLRPDAASVERLKGQ-------RVLAFAGIGDPARYFATLRASGI
LPXK_RHOPS      ---------GPVLRARLAPDETSLERLKGR-------RVLAFAGIGDPARFFATLRASGV
LPXK_RHOPA      ---------GVVLRARLVPEPASVEALRGR-------RVLAFAGIGDPARFVATLRDSGV
LPXK_BRADU      ---------KPELRARLKPDAASVAQLFGK-------RVFAFAGIGDPERFFRTLRASGI
LPXK_RHOP5      ---------VPTLRGHLAPDPACVEALRGR-------AVLAFAGIGDPERFFATLRASGI
LPXK_CAUVC      ---------DMPVLVARLEAAAPVPKG----------PQVGFAGIAKPWKVEKALTAAGC
LPXK_HYPNA      ---------SLPVLRARLAPLAAPPPG----------PLVAFAGIGRPQKFFDSLAQAGG
LPXK_RHOS4      ---------PVPRLTGRLATLQMGMDWQGA-------RVLAFAGIGRPEKFFASLRAEGA
LPXK_RHOS1      ---------PVPRLTGRLATLQMGMDWQGA-------RVLAFAGIGRPEKFFASLRAEGA
LPXK_PARDP      ---------PLPHLTGRLAPLQTGMDWQGQ-------RVLAFAGIGHPEKFFATLRGLGA
LPXK_RUEPO      ---------SVPLVTAELKPLRTGMDWAAT-------PVLAFAGIGNPAKFFRTLRAEGA
LPXK_RUEST      ---------PVPHLTGHVEPLPTGMPWQGT-------KVLAFAGIGHPEKFFATLRGLGA
LPXK_ROSDO      ---------DLPHIRGALTPLQTGMDWSDM-------RAIAFAGIAHPEKFFATLRALGA
LPXK_JANSC      ---------AVPHLTGTLQPLPTGLPLDGL-------PVLAFAGIGHPEKFFQTLRSLGA
LPXK_RHORT      ---------GVPLLTARLEPGPEAARLVGR-------KVVAFAGIGRPEKFFATLTALGA
LPXK_MAGSA      ---------GIPLLAARLVPGPEGADLKGR-------KVVAFAGIGRPEKFFASLKQCGA
LPXK_GLUOX      ---------HLLTAQARLVPGPEIRTLQGR-------RIVAFAGIGRPEKFFDMLRDAGV
LPXK_RICCN      ---------NKLINAQIVPSNNID---KTK-------NYFAFSGIGNPERFFATLKNYGL
LPXK_RICRI      ---------NKLINAQIVPSNNID---KTK-------NYFAFSGIGNPERFFATLKNYGL
LPXK_RICMO      ---------NKLINAQIVPANNID---KTK-------NYFAFSGIGNPERFFATLKNYGL
LPXK_RICFE      ---------DKLINAQIIPSSDVD---KTK-------NYFAFSGIGNPERFFSTLKNYGL
LPXK_RICPR      ---------DKLINAQIVPSNNID---KNK-------NYFAFSGIGNPQRFFLTLENYRL
LPXK_RICTY      ---------DKVINAQIVPSNNID---KTK-------NYFAFSGIGNPQRFFLTLENYRL
LPXK_RICBR      ---------NKLIQAQIVASSDID---KNK-------NYFAFSGIGNPERFFLTLKNYGL
LPXK_CHLMU      ---------KILVEPQISEIVWLNKSANMPRDHWEGLGVGVFCGLGFPKGFLTMLRNAGI
LPXK_CHLTR      ---------KIVIEPQISEIVWLNQSVNMPRDHWEGLGVGVFCGLGFPKGFLAMLRDAGI
LPXK_CHLPN      ---------QIFVKPTIASVVWTHNGERIPKEALRELRVGVFCGLGFPQGFLNMLREEGI
LPXK_CHLAB      ---------KIFVEPRISQVLWDSRGEKLPLDSLSGLAAGVFCGLGFPQGFLDMLKRAGV
LPXK_GEOMG      -------IPSCRAGHVLAGVELLPGGERQPFTALYGRRGVAFAGIADPDAFFASLREEGV
LPXK_GEOSL      -------IPSCRAGHALTGAALLPDGEVQPLAALRGLRGVACAGIAEPEGFFDALRREGL
LPXK_PELPD      -------IPSCTARHSLGNVIPLGNGAAFPMESLRGRRVLAFAGIADPYGFFEELREQGL
LPXK_SYNAS      ---LLRSSPIFRGIHQPCALISLDGGRKMDLQYLAGERICAFAGIGVPEQFRKTLESLGA
LPXK_DESPS      ---LQHELPQCPLFSVYRTEGVFYSAKQEKVVTHLPKKVFAFCGIANPERFHHDLEKQGF
LPXK_ANADE      -----TGRAPVESRHAPTALLDGALREAGALEALRGRRVAALSGLARPAGFLRTLEALGA
LPXK_HELPH      --------------------------------------MLLVTAIANPSRLDAFLPK---
LPXK_HELPJ      --------------------------------------MLLVTAIANPSRLDAFLPK---
LPXK_HELPY      --------------------------------------MLLVTAIANPSRLDAFLPK---
LPXK_HELAH      --------------------------------------MLLVTAIANPSRLNAFLPK---
LPXK_CAMJE      --------------------------------------AVLVTAIAKPFRLYEHFIK---
LPXK_CAMJR      --------------------------------------AVLATAIAKPFRLYEHFIK---
LPXK_CAMJJ      --------------------------------------AVLVTAIAKPFRLYEHFIK---
LPXK_AQUAE      ---------CLLNSDFEEVPFDILKERE----------VIAFSGLGDNGQFRKVLKNLGI
                                                                      .     

LPXK_BURPS      APA-TRALPDHYAFATNPFVDD-------HFDAILITEKDAVKLGT--SWR---------
LPXK_BURP1      APA-TRALPDHYAFATNPFVDD-------HFDAILITEKDAVKLGT--SWR---------
LPXK_BURTA      TPA-TRALPDHYAFATNPFVDD-------HFDAILITEKDAVKLGT--SWR---------
LPXK_BURCA      APA-TRALPDHYAFADNPFVDD-------AVDAILITEKDAVKLGA--SWR---------
LPXK_BURCM      APT-TRALPDHYAFADNPFVDD-------AVDAILITEKDAVKLGA--SWR---------
LPXK_BURL3      APA-TRALPDHYAFADNPFVDD-------AVDAILITEKDAVKLGA--SWR---------
LPXK_BURCH      APA-TRALPDHYAFADNPFVDD-------AVDAILITEKDAVKLGA--SWR---------
LPXK_PARXL      TPA-TRALPDHYAFERNPFTDV-------DADTILITEKDAVKLG---SWH---------
LPXK_CUPPJ      SPK-TLPLPDHYDFAEDPFAGNPDAL---DADVILITEKDAVKCE---RFD---------
LPXK_CUPNH      TPK-TLPLPDHYDFVADPFVDHPDAL---DADVILITEKDAVKCE---RFD---------
LPXK_CUPMC      SPA-TLPLPDHYDFVQDPFADNPAAL---EADVILITEKDAVKCE---RFD---------
LPXK_RALSO      QPA-TLPLPDHYDFADNPFADA-------GAETILITEKDAVKCG---HLD---------
LPXK_POLNA      TLQKTLALPDHHDFKTGDLNAL-------AGRTVLCTEKDAVKLFA--LPDHS-------
LPXK_POLSJ      VLEQTLSLPDHHDFGAGDLAAC-------AGKTVLCTEKDAVKLFG--KPGLA-------
LPXK_VEREI      TLAHTEALPDHYDLQRWERMTD-------PRLTLICTEKDAVKLWP--L-----------
LPXK_BORBR      RPAHTLALPDHYAYAQSPFTAL-------DADLILVTAKDAIKCAA--LDD---------
LPXK_BORPE      RPAHTLALPDHYAYAQSPFTAL-------DADLILVTAKDAIKCAA--LDD---------
LPXK_BORPA      RPAHTLALPDHYAYAQSPFTAL-------DADLILVTAKDAIKCAA--LDD---------
LPXK_BORA1      SPSPRLALPDHYDFSRSPFHDV-------RAEAIFITAKDAIKCAR--LKD---------
LPXK_AROAE      E-VVPHPFPDHHPFTAADLDFA-------PGEPKILTSKDAVKCA-----SFA-------
LPXK_AZOSB      D-VVPHPFPDHHRFVAADLDFA-------PGEPKLMTSKDAVKCA-----PFA-------
LPXK_DECAR      S-CETRPFPDHHRYVAADLAFA-------KDGILLMTEKDAVKCA-----GMT-------
LPXK_NEIMB      TVKRTVALPDHADISAADLP---------DADAVIITEKDAVKFS----DGIC-------
LPXK_NEIMF      TVKRTVALPDHADISAADLP---------DADAVIITEKDAVKFS----DGIC-------
LPXK_NEIMA      TVKRTVALPDHADISAADLP---------DADAVIITEKDAVKFS----DGIC-------
LPXK_NEIG1      RLDQTVALPDHADIFNRDLP---------PADVVLVTEKDAVKFS----DGIC-------
LPXK_CHRVO      AVEQRLSFPDHHAFVPGDIPA--------DADAVIVTSKDAVKLARVIHDAAQ-------
LPXK_THIDA      R-HRPRAFPDHHAFRPDDLP---------AGGAVLMTEKDAVKCA-----DFA-------
LPXK_PSEAE      RAIPHA-FPDHATYTAAELAFSPP-------LPLLMTEKDAVKCRAFAAAD---------
LPXK_PSEAB      RAIPHA-FPDHATYTAAELAFSPP-------LPLLMTEKDAVKCRAFAAAD---------
LPXK_PSEF5      RPVPHA-FADHAQYSAQALTFTPS-------LPLVMTEKDAVKCRAFAADD---------
LPXK_PSEPF      RPVPHA-FADHAEYSVQALSFTPS-------LPVVMTEKDAVKCRAFAADD---------
LPXK_PSE14      RPVAHA-FADHAVYSAQALTFTPA-------LPLVMTEKDAVKCRAFAADD---------
LPXK_PSEU2      RPVPHA-FADHAVYSAEALTFTPA-------LPLVMTEKDAVKCRAFAADD---------
LPXK_PSESM      RPVTHA-FADHALYSVQALTFTPA-------LPLVMTEKDAVKCRAFAADD---------
LPXK_PSEPK      QPVPHP-FADHAQFSARSLAFSPP-------LPLVMTEKDAVKCRAFAADD---------
LPXK_PSEE4      QPVPHP-FADHAPYSREVLSFSPP-------LPLVMTEKDAVKCRPFAADD---------
LPXK_ALCBS      SATPHV-FPDHHAYQPADLAFTDG-------LPVLMTEKDAVKCAPFAEPH---------
LPXK_HAHCH      ASIQHA-FPDHYSYAQKDIEFNDD-------LPVLMTEKDAVKCKSFNLEN---------
LPXK_SHESM      QLALSHGFDDHQAYDKEVLCELAA------SRPLMMTEKDAVKCRDFAQEN---------
LPXK_SHESR      QLALSHGFDDHQAYDKEVLCELAA------SRPLMMTEKDAVKCRDFAQEN---------
LPXK_SHESA      QLALSHGFDDHQAYDKHVLCELAA------SRPLMMTEKDAVKCRDFAQEN---------
LPXK_SHEON      QVALSHSFDDHQAYDKRQLCELAA------SRPLMMTEKDAVKCRDFAQEN---------
LPXK_SHESW      QVVLSHGFDDHQAYDKKQLCDLAK------DLPLMMTEKDAVKCRDFAQEN---------
LPXK_SHEFN      KVVKTVEFADHQAFDQKQLSDLSV------QHSLLMTEKDAVKCRDFAQSN---------
LPXK_SHEDO      QLKHTLAFDDHQAFDAQALIALAG------DLPLIMTEKDAIKCRDFAQDN---------
LPXK_SHEAM      VLEKAHEFADHMAFSETDIATIDD------GRPLLMTEKDAVKCREFAKQH---------
LPXK_SHELP      QPSGQHAFDDHQAYSLEAIETVAA------GRGVLMTEKDAVKCREFAKSN---------
LPXK_PSEA6      KLKSCLSFVDHHAFQASDLPKER----------VLMTEKDAVKCRAFAHDD---------
LPXK_BLOFL      FPIKTIEFSDHHMYSEIMLSSLTS-----GNEMLLMTEKDAIKCLDFAHEN---------
LPXK_BLOPB      IPIRSISFSDHHVYSEKMLTSLTK-----KDEILLMTEKDAVKCIDFAHDN---------
LPXK_WIGBR      IPIREISFPDHYIYDKNILTSLTK-----NNEHLLMTEKDSIKCKYFAKIN---------
LPXK_PECAS      SIAREVAFADHQSYQPEQLALLTQD----TMQPLLMTEKDAVKCKAFAQDN---------
LPXK_SODGM      TPVREVAFGDHQAYQQQMLDALVA-----LEERLLMTEKDAVKCRAFARAN---------
LPXK_SHIFL      QPEKCVPLADHQSLNHADVSALVS-----AGQTLVMTEKDAVKCRAFAEEN---------
LPXK_SHISS      QPEKCVPLADHQSLNHADVSALVS-----AGQTLVMTEKDAVKCRAFAEEN---------
LPXK_SHIF8      QPEKCVPLADHQSLNHADVSALVS-----AGQTLVMTEKDAVKCRAFAEEN---------
LPXK_ECOLI      QPEKCVPLADHQSLNHADVSALVS-----AGQTLVMTEKDAVKCRAFAEEN---------
LPXK_SHIBS      QPEKCVPLADHQSLNHADVSASVS-----AEQTLVMTEKDAVKCRAFAEEN---------
LPXK_ECO57      QPEKCVPLADHQSLNHADVSALVS-----TGQTLVMTEKDAVKCRAFAEEN---------
LPXK_SHIDS      QPEKCVPLADHQSLNHADVSALVS-----TGQTLVMTEKDAVKCWAFAEEN---------
LPXK_ECOK1      QPEKCVPLADHQSLNHADVSALVS-----AGQTLVMTEKDAVKCRAFAEEN---------
LPXK_ECOUT      QPEKCVPLADHQSLNHADVSALVS-----AGQTLVMTEKDAVKCRAFAEEN---------
LPXK_ECOL5      QPEKCVPLADHQSLNHADVSALVS-----AGQTLVMTEKDAVKCRAFAEEN---------
LPXK_SALCH      HPQKCVPLADHQTLAPADVQALVG-----EGQTLVMTEKDAVKCRAFAEDN---------
LPXK_SALTY      HPQKCVPLADHQTLAPADVQALVG-----EGQTLVMTEKDAVKCRAFAEDN---------
LPXK_SALPA      HPQKCVPLADHQTLAPADVQALVG-----EGQTLVMTEKDAVKCRAFAEDN---------
LPXK_SALTI      HPQKCVPLADHQTLAPADVQALVG-----EGQTLVMTEKDAVKCRAFAEDN---------
LPXK_YERPE      KPENEHAFADHQDYSLAQLSRLTS-----GPQILLMTEKDAVKCRAFALPN---------
LPXK_YERPS      KPENEHAFADHQDYSLAQLSRLTS-----GPQILLMTEKDAVKCRAFALPN---------
LPXK_YERPA      KPENEHAFADHQDYSLAQLSRLTS-----GPQILLMTEKDAVKCRAFALPN---------
LPXK_YERPN      KPENEHAFADHQDYSLAQLSRLTS-----GPQILLMTEKDAVKCRAFALPN---------
LPXK_YERE8      APKKEYAFADHQDYSLAQLSSLTS-----GPQNLLMTEKDAVKCRVFAQPN---------
LPXK_PHOLL      DLKKEYAFADHQLYTEDQLCHLAD-----TNQNLLMTEKDAVKCFNFAQPN---------
LPXK_PHOPR      TPVHCQPFTDHQAFSETELKHLAQ-----QGQHLVMTEKDAVKCHAFAQSN---------
LPXK_ALIF1      NVVHTQGFEDHKAFEPTEIEQLMQ-----YGEQLIMTEKDAVKCQSFAQSS---------
LPXK_VIBVU      DVVVSQGFADHQDFDPEAIAKLAH-----QGKNVIMTEKDAVKCRRFAQNN---------
LPXK_VIBVY      DVVVSQGFADHQDFDPEAIAKLAH-----QGKNVIMTEKDAVKCRRFAQNN---------
LPXK_VIBPA      DVKVTKGFADHQDFDQKELEALAL-----QGANVIMTEKDAVKCSDYAQDN---------
LPXK_VIBCH      DLVHCQGFADHQAFDAAQLNQLAQ-----QGAHLIMTEKDAVKCAEFAQPN---------
LPXK_HAEIN      QLKQTQAFQDHQHFEASQLEKLAE-----NQ-PLFMTEKDAVKCQSFAKDN---------
LPXK_HAEI8      QLERTQAFQDHQHFEASQLEKLAE-----NQ-PLFMTEKDAVKCQSFANDN---------
LPXK_MANSM      QLKQTYEFQDHQKFSAELFAKFSK-----NE-PHFMTEKDAVKCFPFAREN---------
LPXK_PASMU      QLIQTKAFQDHQTFEAAQFVDFDQ-----TQ-PLLMTEKDAVKCLSFAQKN---------
LPXK_HAES1      TLEKTQSFQDHQDFDAAHFAYFSS-----NQ-PLFMTEKDAVKCRPFAQAN---------
LPXK_HAEDU      QLTQTYSFADHQAFNAVQLATLAS-----HETPLLMTEKDAVKCRHFAQAN---------
LPXK_AERHH      QLDQRVAYGDHHPFDRDELVGRFA------GKPLLMTEKDAVKCRSFALDN---------
LPXK_PSYIN      EILKAVGFNDHHAFSKDDFTQFEA------SIPLLMTEKDAVKCTDFAQPN---------
LPXK_COLP3      KVINQQSFVDHHAFVLADFNEFDDN----I--PLLMTEKDAVKCHDFCKEN---------
LPXK_PSEHT      TLVSTHHYRDHYAYTADDFTQFGDE-------NVLMTEKDAVKCSAFAKQN---------
LPXK_SACD2      TGFDTFSYPDHHKFTSADFRQFDN-------KAIVMTEKDAVKCTPFATDA---------
LPXK_FRANO      NITAKKVFKDHHKFTQSDFEGIDSD----I--TVVMTYKDAIKCKNFAKAN---------
LPXK_IDILO      ELENSQSFADHHAFSQQDFSNLASN-------PILMTEKDAGKCQSFAQAD---------
LPXK_HYDCU      D-ADVTPFADHKAFQSSDFDTFES------TKPLLMTEKDAVKCRAFAQPN---------
LPXK_LEGPA      KFNPYS-YPDHHQFKPH---DLN-D----IDLPVIMTEKDAVKCYSFSSDK---------
LPXK_LEGPH      KFNPYS-YPDHHQFKPH---DLN-D----IDLPVIMTEKDAVKCYSFSSDK---------
LPXK_LEGPL      KFNPYS-YPDHHQFKPH---DLN-D----IDLPVIMTEKDAVKCYSFSSDK---------
LPXK_RUTMC      NLEHHI-FADHYIYQQS---DLVFE----DNHPILMTAKDCVKCTQFENDQ---------
LPXK_PSYA2      QVSPHP-YPDHHDFSLTELLRYTE-------HPIIVTSKDAVKIRALLMQETINQTNQTN
LPXK_PSYCK      EVIPHP-YPDHYDFSLDELLQYAD-------HPIIVTSKDAVKIRALIMQAIINQA----
LPXK_COXBU      NVIAHP-FRDHYFYRSEDFNFDDD-------HLIILTEKDAIKCKQFDDER---------
LPXK_NITOC      TIQPHP-FPDHYGFQSEDLAFADQ-------QPVLMTEKDAVKCIRFARDN---------
LPXK_METFK      VVEAHP-FPDHHAYTEDDFEFAKD-------DIVLMTEKDAVKCIAFAREN---------
LPXK_XANAC      GVVP-HAFADHHVYRAADF-SFGS------RLPVLMTEKDAVKCRPFADE----------
LPXK_XANC5      GVVP-HAFPDHHVYRAADF-SFGS------RLPVLMTEKDAVKCRPFADE----------
LPXK_XANOR      GVVP-HAFPDHHVYRAADF-SFGS------RLPVLMTEKDAVKCRPFADE----------
LPXK_XANOM      GVVP-HAFPDHHVYRAADF-SFGS------RLPVLMTEKDAVKCRPFADE----------
LPXK_XANCP      GVVP-HAFPDHHVYRAQDF-SFGS------RLPVLMTEKDAVKCRPFADE----------
LPXK_XANC8      GVVP-HAFPDHHVYRAQDF-SFGS------RLPVLMTEKDAVKCRPFADE----------
LPXK_XYLFA      GVVP-HAFPDHHFYRAEDF-TFGS------RLPVLMTDKDAVKCRAFADD----------
LPXK_XYLFT      GVVP-HAFPDHHFYRAEDF-TFGS------RLPVLMTEKDAVKCRAFADD----------
LPXK_METCA      NFEP-VAWPDHHAYSPDDFRSVPE------DTPVLITEKDAVKCRRLDDP----------
LPXK_ALKEH      RVIP-HPFPDHHPYRAGEL-RFGD------DRPVIMTEKDAVKCAGLAPA----------
LPXK_HALHL      GVAERHVFPDHHAYSSQDL-SFAD------ERPIIMTEKDAVKCRDLPQAD---------
LPXK_NITEC      TVTPYI-FSEDHHFVAEDFPFDEA-------EIILIPEEDAVKCFNLHDER---------
LPXK_NITEU      TVTPRV-FPENHHFIATDFQSDEA-------EIILIPEEDAVKCLSLHDDR---------
LPXK_RHIEC      EIAVAKTFGDHEHLTEEEIDDILTTAER-QDLLIVTTSKDFVRLSGHHGKAEQLAQK---
LPXK_RHIL3      EIVVAKSFGDHEHLTEEEIDDILTTAER-EGLLIVTTSKDFVRLSGHHGKAARLVEK---
LPXK_RHIME      VIEETRSFPDHHHFSEDEIADLIDRAAS-RGYTLVTTAKDMVRLEPGHGRAGELAAK---
LPXK_AGRFC      DIVLSRSFPDHHHFSDDEIDDLLKDARK-ENLQLVTTAKDAVRLNGHHGRAEELLWN---
LPXK_CHESB      DIVLERSFPDHHLFTEEDVSELSREAAK-ESLLLVTTEKDFVRLQNSMQPMRDFAAS---
LPXK_BRUAB      EVVETHSFADHYSFEPDDIRGLVDMARR-QGLGLITTAKDHVRLATMPGVPPEFLSK---
LPXK_BRUA2      EVVETHSFADHYSFEPDDIRGLVDMARR-QGLGLITTAKDHVRLATMPGVPPEFLSK---
LPXK_BRUME      EVVETHSFADHYSFEPDDIRGLVDMARR-QGLGLITTAKDHVRLATMPGVPPEFLSK---
LPXK_BRUSU      EVVETHSFADHYSFEPDDIRGLVDMARR-QGLGLITTAKDHVRLATMPGVPPEFLSK---
LPXK_RHILO      EVVLSKPFPDHHFYAEDELAELAAVARA-EGLGLITTAKDAARLRH--GASQDFLNR---
LPXK_BARHE      HVVQTYFYPDHYFFTNTDLKNLVQRAKM-HNLWLATTAKDYIRIQT--SKMQEDLKN---
LPXK_BARQU      RVVQTYSYPDHYFFTDTDLKNLIQQAKM-NNLWLATTAKDYTRIQT--SHVQKDLKN---
LPXK_BARBK      HVIETCSYPDHYFFTDADLKNLKQKAKI-QNLWLATTAKDYTRIQA--KALQKDIEN---
LPXK_NITWN      DVAAERAFADHHPFSQRDVAALQSAAEK-DGLTLVTTEKDLARLRN-NENIAAFAQA---
LPXK_NITHX      DVAAERAFPDHHPFSQRDVADLQTAAER-DGLTLVTTEKDLARLRN-SEDLAAFAQA---
LPXK_RHOPB      NVAAERVFADHHPYAKQDLAGLTEIAGR-DGFTLVTTEKDLARLRS-DPAHAAFARS---
LPXK_RHOP2      DVADQRAFADHHPFTVAELESLAETARR-EGLTLVTTEKDLARI---GAAAATLGSA---
LPXK_RHOPS      EIAEQRAFPDHHPFTADELASLADSARR-GGLTLVTTEKDLARI---GPDAASLGSD---
LPXK_RHOPA      EVVEQRAFADHHPFTAEELAELAAAAKR-DGLTLVTTEKDLARI---GGAQQALGVE---
LPXK_BRADU      DVARTRRFDDHHMFSPEEIAALAAEAQR-EQLTLVTTEKDLARLR----GSEGVPNG---
LPXK_RHOP5      EVAAERPFPDHHPYSGDDVAALLDRARR-DGLTLVTTEKDLARLG---DQPQLAEAG---
LPXK_CAUVC      QLVDFAPFPDHGAYSESTLKMLADRAEV-YEAGLVTTEKDWVRLP------PAWRER---
LPXK_HYPNA      NVSDAVPFGDHHPYTKGDVQFLRSLAHD-HGARLITTTKDHVRLP------LDAQSE---
LPXK_RHOS4      ELLRAEALDDHQPLGEALMKRLEIEAMA-LGAQLVTTEKDAVRLP------PSFRQK---
LPXK_RHOS1      ELLRAEALDDHQPLGEALMKRLEIEAMA-LGAQLVTTEKDAVRLP------PSFRQK---
LPXK_PARDP      DVVRAEALEDHQPFTPQLLIRLETESRL-TGAQMVTTEKDAVRLP------RSFRPK---
LPXK_RUEPO      DLRRAEALDDHQPLTPALMTRLENEARL-LGAQLVTTEKDAVRLP------PAFRSK---
LPXK_RUEST      ELCRAEALEDHQTLAPALLTRLEQEARL-LGAQLVTTEKDAVRLP------LSFRPK---
LPXK_ROSDO      NVVHSEPLDDHQPLSTALMSRLEADAKR-QNAQLVTTEKDAARLP------NSFRTK---
LPXK_JANSC      DLHATHALADHQPLTDTLMIRLLRDASM-RGAQVVTTEKDAVRLS------PEFRAQ---
LPXK_RHORT      RVVARHPFADHYPYAEADIQPILDEAYG-LGAVPVTTSKDAVRLP------PDQRPQ---
LPXK_MAGSA      RLTADHSFPDHHPFTRADIEALLAEAEA-NEALLITTAKDRVRLP------ADLRAR---
LPXK_GLUOX      APIRSLPFPDHHFYTPRDIQRLEALSRE-SGTTLVTTAKDAVKLP------FPFRTQ---
LPXK_RICCN      NITGYKIFPDHYNYLQADLENLYSLAKE-HNATLVTTRKDHVKFN-------DLNNN---
LPXK_RICRI      NITGYKIFPDHYNYLQADLENLYSLAKE-HNAILVTTRKDHVKFN-------DLNNN---
LPXK_RICMO      NITGYKIFPDHYNYLQADLENLYSLAKE-HNATLVTTRKDHVKFN-------DLNNN---
LPXK_RICFE      NITGYKIFPDHYNYLQADLENLYSLAKE-HNATLITTRKDHIKFN-------DLNNN---
LPXK_RICPR      NIVGYKIFPDHYNYLQADLENLYSLAKE-HNAILITTRKDYVKFN-------YLNDE---
LPXK_RICTY      NIVGHKTFPDHYNYLQADLENLYSLAKE-HNAILITTRKDYVKFN-------YLNNK---
LPXK_RICBR      NIVGYKIFPDHYNYLQEDLENLSLLAKT-NNATLITTRKDYVKIG-------DSSDI---
LPXK_CHLMU      HVLGTHLLPDHSGITKQELELFCKKIILRQGVGILCTEKDSVKIEAFAEEMS--------
LPXK_CHLTR      HVLGTYLLPDHVGITKQELELFCKKIILRQGVGILCTEKDSVKIGALAEEIS--------
LPXK_CHLPN      HILGKYLLPDHAAITKKELNYFCQQMAMRQGQGLLCTEKDSVKLPRLSGEVSL-------
LPXK_CHLAB      KIVGTYLLPDHAGITKKELHYFSSMTAMRQGEGILCTEKDGIKLGNLIHEPGI-------
LPXK_GEOMG      DLAATVSFGDHCPYGEEEVARLMAARRTAGADFLITTGKDAVKL----------------
LPXK_GEOSL      DIVAAIPFADHASYGEREVSTLREA--AAGADYLITTGKDGVKL----------------
LPXK_PELPD      NLVAELAMPDHVAYDDNRIAEIGRRLHGSGAEFAVTTEKDGVKLL---------------
LPXK_SYNAS      EIVEFLAYPDHHRYDSSDLAFIERTAKEARAEMIVTTEKDEIKL----------------
LPXK_DESPS      SLVGFKAFSDHQQYTGQCIEEIVKEAKKGGAQAIITTDKDLVKID---------------
LPXK_ANADE      EVALARAFPDHHRFTAGELDAVLREAAASGCAWVVTTEKDAVRLDP--------------
LPXK_HELPH      EVVKKLYFKDHALFDLKLLEKEFYQN---SATSLLVTSKDLVKLQDCSLPL---------
LPXK_HELPJ      EVVKKLYFRDHAPFDLKLLEKEFYQN---NATSLLVTSKDLVKLQDCKLPL---------
LPXK_HELPY      EVVKKLYFKDHAPFNLELLEKEFYQN---NATSLLVTSKDLVKLQDCNLPL---------
LPXK_HELAH      EVVKKIYFKDHAPFNLKLLEKEFHKN---NATSLLVTSKDLVKLQDCKLPL---------
LPXK_CAMJE      ARAC-YFFKDHYEFKKEELENLLKKH---NCDTLMLTFKDFVKVKDFGFKC---------
LPXK_CAMJR      ARAC-YFFKDHYEFKKEELENLLKKH---NCDTLMLTFKDFVKVKDFGFKC---------
LPXK_CAMJJ      ARAC-YFFKDHYEFKKEELENLLKKH---NCDTLMLTFKDFVKVKDFGFKC---------
LPXK_AQUAE      KVKEFMSFPDHYDYSDFTPEE---------GEIYLTTPKDLIKLQGYEN-----------
                         :.                         . :*  :                 

LPXK_BURPS      ----------DARIWVVPVEAAL-DPRLIALVVEKLRGRTSA------------------
LPXK_BURP1      ----------DARIWVVPVEAAL-DPRLIALVVEKLRGRTSA------------------
LPXK_BURTA      ----------DARIWVVPVEAAL-DPRLIALVVEKLRGRTSA------------------
LPXK_BURCA      ----------DARLWVVPVEAAL-DPRLIALVVEKLRGRSPA------------------
LPXK_BURCM      ----------DARLWVVPVEAAL-DPRLIALVVEKLRGRSPA------------------
LPXK_BURL3      ----------DARLWVVPVEAAL-DPRLIALVVEKLRGRSPA------------------
LPXK_BURCH      ----------DARLWVVPVEAAL-DPRLIALVVEKLRGRSPA------------------
LPXK_PARXL      ----------DARIWVVPVEAAL-DHRLIALVVEKVRGRSPA------------------
LPXK_CUPPJ      ----------DPRIWVVPTTPVI-DAGLIDKIRRAVLARVPAAKSTPASG------GATG
LPXK_CUPNH      ----------DPRIWVVPTRPVI-DAGLIEKIRRAVLAQIKPAPTAPATTP-----GAAG
LPXK_CUPMC      ----------DPRIWVVPTTPVI-DAGLIDKIRRVVQARNPAIATPVTVGQSTATGMADG
LPXK_RALSO      ----------DPRIWVVPTTPVV-DAALVEQVCRRVRALADRSTSQAGAQ----------
LPXK_POLNA      ----------KIKLLAVPLEFSP-EPAFFTALDGLLTPLLSQLPSSHGHQTT--------
LPXK_POLSJ      ----------SLQLLAVPLVFSP-EPAFFAALDALLAPLLSQLPSGHGYQTA--------
LPXK_VEREI      ----------HPDALAVPLVLHI-DPGFFAALDAWLPARRAMPEIAPGSDAAAIIAGTEP
LPXK_BORBR      -----------PRLWAVQVGTRLSDPDFGDWLSATLRARQP-------------------
LPXK_BORPE      -----------PRLWAVQVGTRLSDPDFGDWLSATLRARQP-------------------
LPXK_BORPA      -----------PRLWAVQVGTRLSDPDFGDWLSATLRARQP-------------------
LPXK_BORA1      -----------TRLWSVQVRACFSDPDFLDWLDARLRNLP--------------------
LPXK_AROAE      ----------SADTWEFPVKAHI-AAGAAERILEKLTHGRPTA-----------------
LPXK_AZOSB      ----------PADAWEFPVTAEI-GSGAAERILERLQHGRPPA-----------------
LPXK_DECAR      ----------AGETWVLPVQAEL-SPALIDLIVEKLR-GRQVA-----------------
LPXK_NEIMB      ----------TDNVWVLPVCAII-EPDLAAFVLERLEDVPKAV-----------------
LPXK_NEIMF      ----------TDNVWVLPVCAII-EPDLAAFVLERLEDVPKAV-----------------
LPXK_NEIMA      ----------TDNVWVLPVCAII-EPDLAAFVLERLEDVPKAV-----------------
LPXK_NEIG1      ----------TDNVWVLPVCAII-EPDLAEFVLERLEGVPKAV-----------------
LPXK_CHRVO      ----------RARLWVLPVQATL-APDLCEWILARLKTKHGR------------------
LPXK_THIDA      ----------GPDWWAVDLEVVP-EAGFVEWLRTRLGS----------------------
LPXK_PSEAE      -------------WWYLAVDAVPSPA-----FVAWFDARLEHLLAR--------------
LPXK_PSEAB      -------------WWYLAVDAVPSPA-----FVAWFDARLEHLLAR--------------
LPXK_PSEF5      -------------WWYLAVDAQPSPA-----FVAWFDTQLMRLLPDRLLP----------
LPXK_PSEPF      -------------WWYLTVDAVPSPA-----FVAWFDTQLMRLLPDRLLP----------
LPXK_PSE14      -------------WWYLAVDAVPSDA-----FVDWFDEQLLRLSP---------------
LPXK_PSEU2      -------------WWYLAVDAVPSDA-----FVGWFDQQLLRLSP---------------
LPXK_PSESM      -------------WWYLAVDAVPSDA-----FVGWFDEQLLRLSP---------------
LPXK_PSEPK      -------------WWYLAVEAQPTPA-----FSAWFDNQLQRLLRKP-------------
LPXK_PSEE4      -------------WWYLAVDAVPSAA-----FSAWFDGQLDRLLPGRPRP----------
LPXK_ALCBS      -------------WWFVPVTASLP--------EGLLDQMLDRALGKE-------------
LPXK_HAHCH      -------------AWYLEVGAELNSA-----FYERVDARLNELRSHKKDG----------
LPXK_SHESM      -------------WWYLAVDAKLSPQ-----FDQQLLSRVRSVAAAKQGKSHGV------
LPXK_SHESR      -------------WWYLAVDAKLSPQ-----FDQQLLSRVRSVAAAKQGKSHGV------
LPXK_SHESA      -------------WWYLAVDAKLSPQ-----FDQQLLSRVRSVAAAKQGKSHGV------
LPXK_SHEON      -------------WWYLAVDAKLSPQ-----FDQQLLSRLRSVAAAKKGKSHGV------
LPXK_SHESW      -------------WWYLAVNAKLSPQ-----FDEQLLSRLHEVVAAKQGNSHGIR-----
LPXK_SHEFN      -------------WWYLPVNAKLNSE-----FDHALLSQLQQVAQTKKGLSHGI------
LPXK_SHEDO      -------------WWYLPVNARLNAD-----FDKALLARLAPLVQIKP------------
LPXK_SHEAM      -------------WWYLAVDANLPPT-----FSTRLLDALNRAATAKQGNTHGL------
LPXK_SHELP      -------------WWYLPVDAKIAPE-----FEQQLLTLLKRRENVQQGN----------
LPXK_PSEA6      -------------WWYLPVDANLDSE-----FEQQLLMKLRNVK----------------
LPXK_BLOFL      -------------WWYVHIDVNIHQE-----DTKKLLSKIESTIQYYKNN----------
LPXK_BLOPB      -------------WWYVHTEVKINKI-----DTHNLLSMVENKIRYYKGSRYNVQ-----
LPXK_WIGBR      -------------WWYLPIYVFFSKK-----CKEVLLSSVEKKIIIFKFKNKKNNIFNKI
LPXK_PECAS      -------------WWYLPVDAVLAEP-----QGTQLLDKLEDMLNRNVGSRT--------
LPXK_SODGM      -------------WWYLPVDAQLPAG-----AEEALLTPILQAIRRCRPTADGEAKL---
LPXK_SHIFL      -------------WWYLPVDAQLSGD-----EPAKLLTQLTSLASGN-------------
LPXK_SHISS      -------------WWYLPVDAQLSGD-----EPAKLLTQLTSLASGN-------------
LPXK_SHIF8      -------------WWYLPVDAQLSGD-----EPAKLLTQLTSLASGN-------------
LPXK_ECOLI      -------------WWYLPVDAQLSGD-----EPAKLLTQLTLLASGN-------------
LPXK_SHIBS      -------------WWYLPVDAQLSGD-----EPAKLLTQLTSLASGN-------------
LPXK_ECO57      -------------WWYLPVDAQLSGD-----EPAKLLAQLTSLASGN-------------
LPXK_SHIDS      -------------WWYLPVDAQLSGD-----EPAKLLAQLTSLASGN-------------
LPXK_ECOK1      -------------WWYLPVDAQLSGD-----EPAKLLAQLTSLASGH-------------
LPXK_ECOUT      -------------WWYLPVDAQLSGD-----EPAKLLAQLTSLASGH-------------
LPXK_ECOL5      -------------WWYLPVDAQLSGD-----EPAKLLAQLTSLASGH-------------
LPXK_SALCH      -------------WWFLPVDARLSGE-----QPDKLLEHITSLVR---------------
LPXK_SALTY      -------------WWFLPVDARLSGE-----QPDKLLQHITSLVR---------------
LPXK_SALPA      -------------WWFLPVDARLSGE-----QPDKLLEHITSLVR---------------
LPXK_SALTI      -------------WWFLPVDARLSGE-----QPDKLLEHITSLVR---------------
LPXK_YERPE      -------------WWYLPVDAQLPSD-----RADKLLLNIQALSPDTK------------
LPXK_YERPS      -------------WWYLPVDAQLPSD-----RADKLLLNIQALSPDTK------------
LPXK_YERPA      -------------WWYLPVDAQLPSD-----RADKLLLNIQALSPDTK------------
LPXK_YERPN      -------------WWYLPVDAQLPSD-----RADKLLLNIQALSPDTK------------
LPXK_YERE8      -------------WWYLPVDAQLPPD-----QAEQLLLKIQALSRCST------------
LPXK_PHOLL      -------------WWYLPVDARLPQE-----KGEIMLNKICSLLETNNNSK---------
LPXK_PHOPR      -------------WWYVPVDAVIPTS-----NATAIINRIIKVKEEYGSPSA--------
LPXK_ALIF1      -------------WWYLPVDATFPKE-----KAQQILNKIIEVKE---------------
LPXK_VIBVU      -------------WWYLPVSAQFSSH-----DQQRILQRITEVVKEYGSSTA--------
LPXK_VIBVY      -------------WWYLPVSAQFSSH-----DQQRILQRITEVVKEYGSSTA--------
LPXK_VIBPA      -------------WWYLPVSAQLEPK-----DAERILNRIKEVKATYGSPSA--------
LPXK_VIBCH      -------------WWYLPVSAQFAPE-----AEQRIVDKIKEVMEPYGSPSA--------
LPXK_HAEIN      -------------WWYVPVDAEIIEAEKQRENLPHFWAKIDKLVEQYRNG----------
LPXK_HAEI8      -------------WWYVPVDAEIIEAEKQCENLPHFWDKIDKLVAQYRNG----------
LPXK_MANSM      -------------WWYVPVEAKITGQ-----SAVNFIENIVERVKNGQ------------
LPXK_PASMU      -------------WWYVPVEAEIKGE-----KVRSFLAKFDEIRKTV-------------
LPXK_HAES1      -------------WWYVPVEADIQGE-----EVERFMQVVSQQIKEKK------------
LPXK_HAEDU      -------------WWYVPVNATFSAE-----STTYLMTEILKYLGKSNE-----------
LPXK_AERHH      -------------WWYLPVSAELPAS-----LLDTLLHKLGAGGKGQGATQAQG------
LPXK_PSYIN      -------------WWYLPVSAEFSAG-----FEQQLLNRIKEIKC---------------
LPXK_COLP3      -------------WWYLPVDATFSDA-----DRQLIIDRTQIAVQSVIQ-----------
LPXK_PSEHT      -------------WYYLPVDAQPTDS-----VINKL--NSLLKDKGILNGL---------
LPXK_SACD2      -------------MWYVPVDLKLPQT-----FIADFCAQIRKVIALYN------------
LPXK_FRANO      -------------WWYLDIALDINV-----------------------------------
LPXK_IDILO      -------------WYYQTIEAKLPEV-----MKTNLLAELERKKNGHR------------
LPXK_HYDCU      -------------WWYLEVQPLCPAT-----FAHQLFHKLGHYDFTI-------------
LPXK_LEGPA      -------------LYYLPVEAKLNDS-----FWEAFWSHQQLQGYY--------------
LPXK_LEGPH      -------------LYYLPVEAKLNDS-----FWEAFWSHQQLQGYY--------------
LPXK_LEGPL      -------------LYYLPVEAKLNDS-----FWEAFWSHQQLQGYY--------------
LPXK_RUTMC      -------------MWYLQVEADLSDD-----FLKKLDAKL--------------------
LPXK_PSYA2      QTLSDEYNELGSRLWVLPVTAVLSDG-----CYEILQQQLQTLNIAISSKEHERVIT---
LPXK_PSYCK      --LSDEYKELVSRLWVLPVTAVLSDS-----CYESLQQQLQTLDIDISMRKQ--------
LPXK_COXBU      -------------LFCFSVDAVVPDQ-----FQNDFFRLISNIILRKQAQREGI------
LPXK_NITOC      -------------YWYVPMDVSLPAS-----FGAQVLSLLQQAAKKKLNIETTG------
LPXK_METFK      -------------WWFMPISAEIDRA-----LAEKILARLTRLMEKEI------------
LPXK_XANAC      ------------WLYSVPLKAELPAA-----FWVSLLDRLNKLASRQGV-----------
LPXK_XANC5      ------------WLYSVPLKAELPAA-----FWVSLLDRLNKLASRQGV-----------
LPXK_XANOR      ------------WLYSVPLKAELPAA-----FWVSLLDRLNKLASRQGV-----------
LPXK_XANOM      ------------WLYSVPLKAELPAA-----FWVSLLDRLNKLASRQGV-----------
LPXK_XANCP      ------------WLYSVPLKAELPAA-----FWVSLLDRLDKLASRHSDA----------
LPXK_XANC8      ------------WLYSVPLKAELPAA-----FWVSLLDRLDKLASRHSDA----------
LPXK_XYLFA      ------------WFFSVPLRVELPTA-----FWTALFDRLERLVSC--------------
LPXK_XYLFT      ------------WFFSVPLRVELPTV-----FWTALFDRLERLVSC--------------
LPXK_METCA      ------------RIWYIPVSARLDPA-----FAPRLLNILERFRHGQTTA----------
LPXK_ALKEH      ------------RSWFLPVEARPEPA-----TRERLEASLARLHSLTNR-----------
LPXK_HALHL      ------------RLWYLPVELEPGCE-----LTAAVSGLLTRLHAREGRV----------
LPXK_NITEC      -------------IWVLQQEYRVDLG-----LRTIILKKLREKF>---------------
LPXK_NITEU      -------------IWVLQQEYRVDPG-----LREIILKKLREKF>---------------
LPXK_RHIEC      -------------ARVIEVDIVFEDHLAPGLIIDRAIIACRDRRLKELKTS---------
LPXK_RHIL3      -------------SRVIEVDMVFEDHLAPSLIIDRAIVACRERRLREMKAGVKAIPAKAE
LPXK_RHIME      -------------SRVIEIEVRFDDPAAPGKIIDAALASARARRLRERKAG---------
LPXK_AGRFC      -------------SQVIEIDMVFDDPNAAGTVIETAVVNCRARLLRDNARSST-------
LPXK_CHESB      -------------VQALKVEAVFDEPGAPDAIINAAQQAWRERMLKR-------------
LPXK_BRUAB      -------------LAVLDVDLEFDRTDALDHILDTVVERFKSRLHG--------------
LPXK_BRUA2      -------------LAVLDVDLEFDRTDALDHILDTVVERFKSRLHG--------------
LPXK_BRUME      -------------LAVLDVDLEFDRTDALDHILDTVVERFKSRLHG--------------
LPXK_BRUSU      -------------LAVLDVDLEFDRTDALDHILDTVVERFKSRLHG--------------
LPXK_RHILO      -------------LEVLEIDTVFELDHAPERIIEETLDAWRQRKLRS-------------
LPXK_BARHE      -------------LVVFDINVNFVQKNFCRVLLQEVMIRFRERKHSL-------------
LPXK_BARQU      -------------LIVFDVEVDFVQEDFCRMILEEVMSRFRERKTLFNLHF---------
LPXK_BARBK      -------------LIVFDVTLDFAQADFCYRLLEEVIARFKKRKHSL-------------
LPXK_NITWN      -------------VAPFAVTLAFDDETALRSFLMDGIAKVRRLD----------------
LPXK_NITHX      -------------VVAFAVTLAFDDEAVLRSFLTDRIGRARR------------------
LPXK_RHOPB      -------------VVPFAVTLEFDDAKALRDFVIEKLTQARDKHRRAGRS----------
LPXK_RHOP2      -------------IVPFAVTLAVEDEPSLRLFLLEQINRARTKPRAG-------------
LPXK_RHOPS      -------------LVALAVTLVVEEEARLRRFLLERINQARTKQFAR-------------
LPXK_RHOPA      -------------IVPFAVTLAFGDEAKLRLFLLDRLNGARAAKLAGRR-----------
LPXK_BRADU      -------------IVPFAVQLEFDDPAKLRQLISDHLYKARERRFGRR------------
LPXK_RHOP5      -------------LTALPVTLALEDEAGFRRFVIAQLGAARDRRFRGNRR----------
LPXK_CAUVC      -------------VTPWPVRARFEDPAALEALLKGIGL----------------------
LPXK_HYPNA      -------------ILAWPVTAVFEDTAALDAVLAPIFKRAGKP-----------------
LPXK_RHOS4      -------------VLTLPVRLEFDDATALDAALDRLGLAARS------------------
LPXK_RHOS1      -------------VLTLPVRLEFDDGAALDEALDRLGLAARS------------------
LPXK_PARDP      -------------VLALPVRLQLDDAAPLEERLASLGL----------------------
LPXK_RUEPO      -------------VITLPVRLEVAEEDRLRAILLAAAPPPP-------------------
LPXK_RUEST      -------------VITLPVRLRVAQGDTLLARLKDIAPPPD-------------------
LPXK_ROSDO      -------------VITLPVRLSFDGQENALADLLRPVVKS--------------------
LPXK_JANSC      -------------VMTVPVRLEVDDWGPLDSAVDKVLGR---------------------
LPXK_RHORT      -------------VDVVGVRVVFDEPLAFEALIDRLILGRLPS-----------------
LPXK_MAGSA      -------------VAVLSVSLDWDAPSLLTPLFDRIGVRA--------------------
LPXK_GLUOX      -------------VKVIGVELLWADPKSPERLLDLLFSAS--------------------
LPXK_RICCN      -------------IVCLDVELSINHPDLLNEKIFKKA-----------------------
LPXK_RICRI      -------------IVCLDVELSINHPDLLNEKIFKKA-----------------------
LPXK_RICMO      -------------IVCLDVELSINNPDLLNEKIFKKAQIFN-------------------
LPXK_RICFE      -------------IVCLDVELSINNPDLLNEKIFKKAQIFN-------------------
LPXK_RICPR      -------------IICLDVELSINNPDLLNEKIFKKAKILN-------------------
LPXK_RICTY      -------------IICLDVELSINNPDLLNEKIFKKA-----------------------
LPXK_RICBR      -------------IVCLDVKLSINNPNLLYEKIFKKD-----------------------
LPXK_CHLMU      -------------LPIGEVRMRFSCVCNEERMVAMLDAIEAIQKNKKVTT----------
LPXK_CHLTR      -------------FPVGEVRMRFSCVCNERRMVAMLDAIEAIQKNKRVTT----------
LPXK_CHLPN      -------------LPIAKVEMRLSVN--QDDTLSLLNMIEQIHKNRGN------------
LPXK_CHLAB      -------------LPIGKVQMEFDFTHQEDATAALLDKIDRIHNGKR-------------
LPXK_GEOMG      -----------GPVLSRLGIVYAAVLEMSLMDPKPLETAIDKVL----------------
LPXK_GEOSL      -----------SAHLARLLPVYATVLEMRPLDPAPLEAALDKVL----------------
LPXK_PELPD      -----------GLQRECAEKILLARLELIIADPAPLTDALRNLLQK--------------
LPXK_SYNAS      -----------APMEKLALPACFLSIEMRVKPQKSFEHLVLEMMKDG-------------
LPXK_DESPS      -----------SFATELPLYSARPRTTISTDFDELILKTCASFGE---------------
LPXK_ANADE      -----------ALAAAAGDRLRVVRVDAELLRGADVLEAALAAALAAAPQPRPAPRAPVA
LPXK_HELPH      --------------SVLDLKLEIDPK-----ILEKIDRYILSYPCNTKERL---------
LPXK_HELPJ      --------------SVLDLKLEICPK-----VLEEIDRYILSYPCNIKEHL---------
LPXK_HELPY      --------------SVLNLKLEICPK-----VLEEIDHYILSYPYNTKERL---------
LPXK_HELAH      --------------SVLDLRLEIDPK-----VLEKIDNYIFSYPYNTKEHL---------
LPXK_CAMJE      --------------QIIELNIELKDS-----LREKIKTYIKEFEQ---------------
LPXK_CAMJR      --------------QIIELNIELKDS-----LREKIKTYIKEFEQ---------------
LPXK_CAMJJ      --------------QIIELNIELKDS-----LREKIKTYIKEFEQ---------------
LPXK_AQUAE      -------------VFALNFKVKLERE-------EKLKKLIYRIFY---------------
                                                                            

LPXK_BURPS      ------------
LPXK_BURP1      ------------
LPXK_BURTA      ------------
LPXK_BURCA      ------------
LPXK_BURCM      ------------
LPXK_BURL3      ------------
LPXK_BURCH      ------------
LPXK_PARXL      ------------
LPXK_CUPPJ      LNKEHQDGQPAA
LPXK_CUPNH      RNEEHRDGQPAA
LPXK_CUPMC      LDKEHQDGQPAA
LPXK_RALSO      ------------
LPXK_POLNA      ------------
LPXK_POLSJ      ------------
LPXK_VEREI      TLPENHRP>---
LPXK_BORBR      ------------
LPXK_BORPE      ------------
LPXK_BORPA      ------------
LPXK_BORA1      ------------
LPXK_AROAE      ------------
LPXK_AZOSB      ------------
LPXK_DECAR      ------------
LPXK_NEIMB      ------------
LPXK_NEIMF      ------------
LPXK_NEIMA      ------------
LPXK_NEIG1      ------------
LPXK_CHRVO      ------------
LPXK_THIDA      ------------
LPXK_PSEAE      ------------
LPXK_PSEAB      ------------
LPXK_PSEF5      ------------
LPXK_PSEPF      ------------
LPXK_PSE14      ------------
LPXK_PSEU2      ------------
LPXK_PSESM      ------------
LPXK_PSEPK      ------------
LPXK_PSEE4      ------------
LPXK_ALCBS      ------------
LPXK_HAHCH      ------------
LPXK_SHESM      ------------
LPXK_SHESR      ------------
LPXK_SHESA      ------------
LPXK_SHEON      ------------
LPXK_SHESW      ------------
LPXK_SHEFN      ------------
LPXK_SHEDO      ------------
LPXK_SHEAM      ------------
LPXK_SHELP      ------------
LPXK_PSEA6      ------------
LPXK_BLOFL      ------------
LPXK_BLOPB      ------------
LPXK_WIGBR      ------------
LPXK_PECAS      ------------
LPXK_SODGM      ------------
LPXK_SHIFL      ------------
LPXK_SHISS      ------------
LPXK_SHIF8      ------------
LPXK_ECOLI      ------------
LPXK_SHIBS      ------------
LPXK_ECO57      ------------
LPXK_SHIDS      ------------
LPXK_ECOK1      ------------
LPXK_ECOUT      ------------
LPXK_ECOL5      ------------
LPXK_SALCH      ------------
LPXK_SALTY      ------------
LPXK_SALPA      ------------
LPXK_SALTI      ------------
LPXK_YERPE      ------------
LPXK_YERPS      ------------
LPXK_YERPA      ------------
LPXK_YERPN      ------------
LPXK_YERE8      ------------
LPXK_PHOLL      ------------
LPXK_PHOPR      ------------
LPXK_ALIF1      ------------
LPXK_VIBVU      ------------
LPXK_VIBVY      ------------
LPXK_VIBPA      ------------
LPXK_VIBCH      ------------
LPXK_HAEIN      ------------
LPXK_HAEI8      ------------
LPXK_MANSM      ------------
LPXK_PASMU      ------------
LPXK_HAES1      ------------
LPXK_HAEDU      ------------
LPXK_AERHH      ------------
LPXK_PSYIN      ------------
LPXK_COLP3      ------------
LPXK_PSEHT      ------------
LPXK_SACD2      ------------
LPXK_FRANO      ------------
LPXK_IDILO      ------------
LPXK_HYDCU      ------------
LPXK_LEGPA      ------------
LPXK_LEGPH      ------------
LPXK_LEGPL      ------------
LPXK_RUTMC      ------------
LPXK_PSYA2      ------------
LPXK_PSYCK      ------------
LPXK_COXBU      ------------
LPXK_NITOC      ------------
LPXK_METFK      ------------
LPXK_XANAC      ------------
LPXK_XANC5      ------------
LPXK_XANOR      ------------
LPXK_XANOM      ------------
LPXK_XANCP      ------------
LPXK_XANC8      ------------
LPXK_XYLFA      ------------
LPXK_XYLFT      ------------
LPXK_METCA      ------------
LPXK_ALKEH      ------------
LPXK_HALHL      ------------
LPXK_NITEC      ------------
LPXK_NITEU      ------------
LPXK_RHIEC      ------------
LPXK_RHIL3      PL----------
LPXK_RHIME      ------------
LPXK_AGRFC      ------------
LPXK_CHESB      ------------
LPXK_BRUAB      ------------
LPXK_BRUA2      ------------
LPXK_BRUME      ------------
LPXK_BRUSU      ------------
LPXK_RHILO      ------------
LPXK_BARHE      ------------
LPXK_BARQU      ------------
LPXK_BARBK      ------------
LPXK_NITWN      ------------
LPXK_NITHX      ------------
LPXK_RHOPB      ------------
LPXK_RHOP2      ------------
LPXK_RHOPS      ------------
LPXK_RHOPA      ------------
LPXK_BRADU      ------------
LPXK_RHOP5      ------------
LPXK_CAUVC      ------------
LPXK_HYPNA      ------------
LPXK_RHOS4      ------------
LPXK_RHOS1      ------------
LPXK_PARDP      ------------
LPXK_RUEPO      ------------
LPXK_RUEST      ------------
LPXK_ROSDO      ------------
LPXK_JANSC      ------------
LPXK_RHORT      ------------
LPXK_MAGSA      ------------
LPXK_GLUOX      ------------
LPXK_RICCN      ------------
LPXK_RICRI      ------------
LPXK_RICMO      ------------
LPXK_RICFE      ------------
LPXK_RICPR      ------------
LPXK_RICTY      ------------
LPXK_RICBR      ------------
LPXK_CHLMU      ------------
LPXK_CHLTR      ------------
LPXK_CHLPN      ------------
LPXK_CHLAB      ------------
LPXK_GEOMG      ------------
LPXK_GEOSL      ------------
LPXK_PELPD      ------------
LPXK_SYNAS      ------------
LPXK_DESPS      ------------
LPXK_ANADE      ------------
LPXK_HELPH      ------------
LPXK_HELPJ      ------------
LPXK_HELPY      ------------
LPXK_HELAH      ------------
LPXK_CAMJE      ------------
LPXK_CAMJR      ------------
LPXK_CAMJJ      ------------
LPXK_AQUAE      ------------