CLUSTAL format seed alignment for MF_00412

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

K9R0D6_NOSS7      -----------------------MTVPPLDDSP-EPMKSAKRAYQASLKLGTTKGTDRSR
B7JWV9_RIPO1      --------------------------MALENSPNLMLTSVQRAYNAFLALATRDSQERSQ
B1XPW2_SYNP2      ----------------------MASTPPLESSD-PITAALQRAHQASLELELLKGSERHL
B8HLF7_CYAP4      -----------------------MTAELPGFDHFDLATALERANAAALILTRTKSQERNT
PROA_CAMJE        -----------------------------------MRNLLENIKKNSQKLLNLTPKDKEK
PROA1_SYNY3       --------------------------MVISPSLSALHTLAHNARQAALHLGSLNTAERNQ
PROA_THEEB        ----------------------MSLELTTPMTNSPLVQRVKEVHEQARLLATLDAAARNG
PROA_PROMA        ----------------------MEKQILVPSPTDELVNRALEVKSASVSLSQCSNDQRQS
PROA_SCHPO        ---------------------------------MSLEENVKEAKNAFNILQTLSVEDRDD
PROA_YEAST        --------------------------------MSSSQQIAKNARKAGNILKTISNEGRSD
G2PIL7_MURRD      -------------------------------------------------MKLLKTDLKNK
E6X4I4_CELAD      ------------------------------------------------MSLLLSIEQRNK
PROA_AQUAE        --------------------------------MNYIEEKVNRARSVLRELTSLKTSVKNE
PROA_THEYD        -----------------------------MEIKQLVLNKAKEAKESSRFIAKASTDLKNK
PROA_DICTD        --------------------------------MENLIEKLKKAKVSSYTLALLNTNEKNE
PROA_GLOVI        ---------------------------MESSLYETLKVTAQRAQRSTMALAQVPSGIKNK
PROA_THEMA        --------------------------------MDELLEKAKKVREAWDVLRNATTREKNK
PROA_BACAN        --------------------------------MNEVLAKGKKAKEIARELVLKSTEQKNE
PROA_BACSU        --------------------------------MSEVSVKAKLAKEAAAEMIMKTTAEKDE
PROA_ENTFA        ------------------------------MKVTDLKQLGQQAKEASYTLGLMDTRQKNT
PROA_LACPL        --------------------------------MVDLEQLGQQAQQASYTLGLLSTAQKNQ
PROA_LISMO        --------------------------------MTELIKKGSAAKEAAQFLAQASTKQKNA
PROA_LACLA        ----------------------------------MIEELGLKVKKASKEVAKLSTADKNV
PROA_CLOAB        -----------------------------MDIKDYVINIAKNSKLAAKKLSYADTNTKNK
PROA_MOOTA        -----------------------------MNVALEVQTKGQRAREAARILAGLGTSKKNE
PROA_BACTN        -------------------------------MTTNLNGTFAAVQAASRELALLSDDTINQ
PROA_CHLTE        -----------------------------MTEHEAIVKQLQAVQNASRKIVPLNEETING
PROA_NEIG1        --------------------------------MSNTQKQLALAKAAKKSVNTADAEEKNR
PROA_NEIMB        --------------------------------MSNTQKQLALAKAAKKSVNTADTEEKNR
PROA_STRR6        --------------------------------MVSRQEQFEQVQAVKKSINTASEEVKNQ
PROA_MYCS2        ------------MSVEAQSRSGAVDTQEPADLREQVHSAARRARVAARTLATLSAEAKNR
PROA_MYCTU        ------------MTVPAPSQ---------LDLRQEVHDAARRARVAARRLASLPTTVKDR
PROA_CORGL        ------------MSSTTLTDDQIRD-----NERTEVLAKATAAKNIVPDIAVLGTGPKNA
PROA_STRCO        ------------MTTLSPYD-----------SMSPVTRAAYRAKSAAADLAPLPRAAKDD
PROA_BIFLO        ------------MSDELSPE-----------VFDAVCRQADQAARAQERLAQANTEAKNE
PROA_KORVE        ---------------------------------MTTREKLEAARRAAPVVAELSTESKNA
PROA_CHLAA        --------------------------------MVDLEAIGRRAKTAARALAKLSTEQKNA
PROA_DEIRA        ----------------------MTQTDSLPGVQATVQDMGERARRAARVLRSLPTGRKVQ
PROA_ECOLI        ----------------------------------MLEQMGIAAKQASYKLAQLSSREKNR
PROA_SHIDS        ----------------------------------MLEQMGIAAKQASYKLAQLSSREKNR
PROA_SALTY        ----------------------------------MLEQMGIAAKAASYKLALLSSGEKNR
PROA_YERPE        --------------------------------MNLLEHMGKAAKQASWQLAMLSTAKKNQ
PROA_HAEIN        ----------------------------------MLEQMGKQAKDAAFILAQLTTAEKNC
PROA_ALIF1        ---------------------------------MNLTTMGQAAKAAAFDLAVAPTAQKNK
PROA_VIBCH        ---------------------------------MDLTVLGKAAKAASFQLATASTAQKNQ
PROA_SHEON        --------------------------MSQINQAQYLQQLGHNAKQASYALANLTASQKAD
PROA_AGRFC        --------------------MPEQAVKQSHDIDALMMTIGAQAKAASRPLSIAGTDQKNR
PROA_BRADU        --------------MAAPLKAVDGNADRTGDLQALMSDLAARARAAARVLALAPPEQKNR
PROA_RHORT        --------------------MNDAARLTTDDIPGLMIDIGRRARAAGRILALAPAAARNA
PROA_CAUVC        -----------------------------------MAGMGRTAREGARALRLATPEQRTA
PROA_RHOS4        --------------------------MDGTDVTMLMREIGVRARAAAAELAFAEPSRKEE
PROA_BURPS        -----------------------------MDIDQYMTDVGRRARRASREIARASTAAKNA
PROA_PSEAE        ---------------------------MTESVLDYMSRLGRDARAASRLLARAATAQKNR
PROA_BORPE        ----------------------------MSSIETYMQSVGEQARTASRAMMRATGAAKNQ
PROA_RHOBA        -------------MSTASTTHTQTDALQSDDLAAQCVDIARRAKAASRLLGTLDTNIKDQ
PROA_SALRD        ---------------MNKQINSVAPMSDTTSEALSVDALAADCKAAARELSTLSTETKNR
PROA_XANCP        ---------------------------------MTIKSLALQCRDAAQVLSQLSADAKQA
PROA_GEOSL        -----------------------------MSIAEKIRNIAADARQAAIAMAKLSASAKNE
PROA_DESVH        -----------------------------MNIASQIEDMGRRARAAGRRLAAASPAAKAG
PROA_THET8        ---------------------------------MTATSLWELAERARKRLSEIAKGNRDR
PROA_LEPIN        -----------------------------MKEIEYVQDLCSRAKKASKVLKQLSSSKKNK
Q2JWY6_SYNJA      --------------------------MTDFGSAFDLSTTLRQVRRLLPQLQRLSGETKRQ
F4CQV9_PSEUX      MATIATHGGRPASRVRFPTVSTSPAADQQAPEFAAVRAAAQRAAAAAPGVRAAGGPAIDA
                                                                              

K9R0D6_NOSS7      AVLAMAQALEQSFDDILEANTLDLEAS----REMAVPELILDWLKLTP-TRLETTVEILQ
B7JWV9_RIPO1      GIRAMARGIGNAFDDILEANTLDLEMS----REMAVPDLLIDWLKLTP-ERLNALVDLLN
B1XPW2_SYNP2      GIEAIATALEANISVILEANTKDLEAS----REMAVPKLILDWLKLTP-ERLQKTVRLLR
B8HLF7_CYAP4      AIQFLLEQLKAKQNEILEANTLDLEAS----REMAVSETILGWLRLTP-ERLQTIARLLQ
PROA_CAMJE        IILKLAQILRENFKIILEANKKDMANFT-------KSGAMKDRLLLDE-KRILALCEGLE
PROA1_SYNY3       AIAAIADGLTAAMPEILAANQEDCAAAE---AMG-IAKPLYNRLLLGE-SKLKSTIAGVK
PROA_THEEB        ALEQVACALEEAREEILAANAADCEQAK---ANQ-LNASLYARLELSP-SKLAAAIAGVR
PROA_PROMA        ALILMTEALSLRSSEILKANSDDVHRAE---QEG-LNQALLSRLKLTE-EKLRISIEGIR
PROA_SCHPO        ALDKIVEELRIKKSEVLAANAEDMKAAKLLAESGKLSSSMVKRLDLSSSDKYDSMVQGVL
PROA_YEAST        ILYKIHDALKANAHAIEEANKIDLAVAK---ETG-LADSLLKRLDLFKGDKFEVMLQGIK
G2PIL7_MURRD      VLQDMERILDQNREELLQANKKDLDAFN------RDDQALYDRLVVDQ-KKVDQMIQAVK
E6X4I4_CELAD      VLNTMAEYIALEKEAILEANKKDLAAYT------GDDLAMGDRLKVDD-AKIEGMIISLQ
PROA_AQUAE        TLLKVAELIDKNRDYIKEENRKDVEKA----KEMGLRPAVVDRLVLND-KRIDGMVKVLK
PROA_THEYD        IIVRMADYLKQNKDELIKANRIDVENA----QKKGISKALIDRLTLTE-KRIDEMIKGLQ
PROA_DICTD        ALRAIANNIEKNIDKIIKENEKDLKRG----EEKGLSKAVLDRILLNE-KRLRDIIKSID
PROA_GLOVI        ALRAMARSLRTAHSEILESNTTDLEFG----RQMGLSETLLDRLKLTP-QRLEGMALSLE
PROA_THEMA        AIKKIAEKLDERRKEILEANRIDVEKA----RERGVKESLVDRLALND-KRIDEMIKACE
PROA_BACAN        ALSAIADQLILETAYILEENKKDIEEG----KAKGFSDSLLDRLMLNE-QRIVDMTEGIK
PROA_BACSU        ALSLIANGLRKELDFLLAENAKDIVNG----KENGLTPDIIDRLSLDE-KRIRDIADAVE
PROA_ENTFA        LLNKMAAAIEANAPRILQANALDLEQA----ATHGISETMQDRLRLTE-ERITAMAEGIR
PROA_LACPL        VLTAMATALTSHQDEILAANAQDLENP----Q---VPVKFVDRLRLTA-DRIQDMAIGLK
PROA_LISMO        ALLNLSNDLLTHTASLLEENNKDIIRA----REKGTPETMIDRLRLTE-ERIKEISEAVK
PROA_LACLA        FLQNLADSLIENTDRIISENEKDLANA----LEHGISEIMDDRLRLNA-QRISDMATGLR
PROA_CLOAB        ALIEMSKALLENKDYILSQNKIDIENA----EKIGTSKALIDRLTLND-KRITDMAEALI
PROA_MOOTA        ALLAMARALEEEQEAILAANARDMVAG----KEKGLSRALLDRLLLNE-KRIRDMAAGLR
PROA_BACTN        ILNAVADATIAETSFILSENEKD-LAR----MDK--SNPKYDRLKLTE-ERLKGIAADTR
PROA_CHLTE        LLVELADRIPAAADAILEANRKD-LER----MDP--ADPRYDRLLLNE-ARLNSIATDLR
PROA_NEIG1        ALLAMADSLEAAAEDILAANRLD-LKA----AAGKIPDSMTDRLLLDG-KRICAMADGIR
PROA_NEIMB        ALLAMADSLEAATADILAANRQD-LEA----AAGNIPESMTDRLLLDG-KRICAMADGIR
PROA_STRR6        ALLAMADHLVAATEEILAANALD-MAA----AKGKISDVMLDRLYLDA-DRIEAMARGIR
PROA_MYCS2        ALHAAADSVLANVDAVLAANAADVDAA----RQGGTPEAMIDRLALNP-QRVDGIAAGLR
PROA_MYCTU        ALHAAADELLAHRDQILAANAEDLNAA----READTPAAMLDRLSLNP-QRVDGIAAGLR
PROA_CORGL        ILRAAADELVARSAEIIEANASDIEAG----RANGMEESMIDRLALDE-SRIEGIAGGLR
PROA_STRCO        ALLAVADALEVRTSEIVEANAQDVAKA----RAAGTSEAIVDRLTLTP-ERVRAIASDVR
PROA_BIFLO        LLLAIADALDEHAADIEAANALDMLES----KENGMDAGKLDRLLFDV-PRVAAAAQGVR
PROA_KORVE        LLLALARTIDERTEEILAANRADLEAS-------GLDGSLRDRLLLTP-ERIATMAEGLR
PROA_CHLAA        ALCAIADGLLARQDKILAANAADVADA----EKGGTPPAIVDRMLLTP-ARLAAIAGDCR
PROA_DEIRA        ALRALAAELRAREAGILAANAQDVQAA----EAAGLPAPLVDRLRLSA-GALAAIARDVE
PROA_ECOLI        VLEKIADELEAQSEIILNANAQDVADA----RANGLSEAMLDRLALTP-ARLKGIADDVR
PROA_SHIDS        VLEKIADELEAQSEIILNANAQDVADA----RANGLGEAMLDRLALTP-ARLKGIADDVR
PROA_SALTY        VLEKIADELEAQMESILSANVQDVEQA----RANGLSEAMLDRLALTP-ARLKAIADDVR
PROA_YERPE        ALAVIANLLESESQTILQANERDMAAA----RESGMSEALLDRLLLTP-ARLAAIANDVR
PROA_HAEIN        ALSIIAEQLEQQAPLILAENAKDIELA----KQNGLSDALIDRLLLTQ-ERLQGIANDVR
PROA_ALIF1        ALAIIADELEANKDAILAANEKDIKAA----VEAGISEAMQDRLLLTE-ERLVGIANDVR
PROA_VIBCH        ALASMADQLEAQSASILAANAKDIALG----REAGLSDAMLDRLLLNE-SRLQAIANDVR
PROA_SHEON        LLDAIADALTENTLAILAANAKDVAAA----KAEGLNDAMIDRLLLNE-SRLAGIIGDIS
PROA_AGRFC        ALLAMASAIEASKEAILAANRKDLAAA----ESAGLAASFVDRLTLND-ARIAGIAEGIR
PROA_BRADU        ALEAMERAIRSNAAAILAANAEDVAEAR---ASSNMTASFIDRLTLTP-ARVESMAEGIG
PROA_RHORT        ALLAGAAALRAEAGAIALENAKDMSAG----RAKGLTDALLDRLELTP-ARIEAMAKGLE
PROA_CAUVC        AIQAMAVAIREDADAILTANAKDLARA----EANGVSGPMLDRLALDA-ARLEGVAAGVE
PROA_RHOS4        ALNAAAEAMLARSDEILEANGRDLAFG----AEKGLTPAMMDRLKLDA-ARIDGIVEGLR
PROA_BURPS        ALEAVARAIGRDADALKAANARDVARA----KDKGHDAAFVDRLTLSD-KALKTMIEGLR
PROA_PSEAE        ALLAAADALDAARAELSHANEQDLAAG----RANGLEPAMLDRLALTP-ARIDDMIEGLR
PROA_BORPE        ALLAMAEAILAQRAELQAANAKDVAAA----RANGLEAALLDRLTLSD-RSIELMAEGLR
PROA_RHOBA        WLIESADALIEASDAIIAANQLDLENA----PKYGLTDAGIDRLRLDE-ARIAGIATGLR
PROA_SALRD        TLRRMADALEADEEAILAANGKDVSAA----REEGLDDALIDRLVLNP-DRITKMADALR
PROA_XANCP        LLLAMANALDTDATQILQANQRDVDAA----REKGTGAAMLDRLTLTP-ARLSAVGAALR
PROA_GEOSL        LLLAMAGSLVRNTVQLIEENRKDLEAG----EAKGLSTAMLDRLMLNE-ARIKAMADGLR
PROA_DESVH        ALDHLATLLEQRQDAILAANAADLAAA----AEAGMDAPRMDRLRLTP-ATIAEMAAACR
PROA_THET8        ALLAMADLLEARWEEVLRANREDLEEA----ERTGLPKAKLDRLALKE-KDLKTLTEGLR
PROA_LEPIN        VLLSLADLLEKRKAEILLANELDLKDG----KEKKLSSALMDRLLLNE-KRIFSMASAVR
Q2JWY6_SYNJA      ALLALSRRLLERSDLLLEANTLDLESC----REQTLPEWILNGLKLTP-ERLQRSAQLLA
F4CQV9_PSEUX      ALRTAARLLRERAERVLAANAADVDTA----RAGGMASGLLDRLTLTP-ERLADMAVQLE
                   :             :   *  *                    : .              

K9R0D6_NOSS7      RLGELSDPLRRVRNADYQPEDSQSYSQLMPLGVIGFIYEAFPDLGAIAAALCIKTGNSII
B7JWV9_RIPO1      RLAEVPDPIQRVFHAPYPLSTSQTYCQLMPLGVIALIYETFPELGAIAAGFCLKTGNSLI
B1XPW2_SYNP2      QLPKLPDPLQRVKNATYQISGYQTYSQRMPLGVICLIHEALPELGAIAAGLCLKTANSLV
B8HLF7_CYAP4      QLIALPDPQERMAVSAYRTEQYQSYAQPIPLGVIAFIYEAFPALAIIVAAMCIKTGNSLL
PROA_CAMJE        KIAYIEDPIGKISKGWKNYAGLSIQKMSIPLGLICVIYEARPSLSAEIAALMIKSSNACV
PROA1_SYNY3       DVEHLPDPLGQVTLHRQLDEGLVLKRVGCPLGVLGVIFEARPEALIQISSLAIKSGNAVI
PROA_THEEB        QVAALPDPLGQRQLHRELDTGLILSRVTCPLGVLGVIFEARPDAVVQIASLAIKSGNGAI
PROA_PROMA        QVASLSDPIGIRQLHRELNTNLYLQRVTVPLGVIGVIFESRPDAVMQIASLAIRSGNGAI
PROA_SCHPO        DVKSLPDPLGRVTYARSLDDGLDLYKVSCPVGLLLVIFEARPEVIINITSLAIKSGNAVV
PROA_YEAST        DVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLVIFESRPEVIANITALSIKSGNAAI
G2PIL7_MURRD      EVRLQDDPVNKEISTRELDNGLKIINRTAPFGTIMIIYESRPDVTVEAAVLAFKANNKIL
E6X4I4_CELAD      QLAEQEDPLGVERFGFTHENGIKVSNKTAPFGTICIIYESRPDVTIEAAGIAFKSGNKIL
PROA_AQUAE        DVASLPDPVGEIIKMWNLPNGLKVGRMRVPLGVIFIVYESRPNVTIEASSLCMKSSNAVI
PROA_THEYD        EVVALPDPVGEITKMWLRPNGMQVGKMRVPIGVIGVIYEARPNVTVDVTGLCLKAGNSVV
PROA_DICTD        DVIKLPDPVGEIVSMQKRPNGILVGQMRVPIGVIAIIYEARPNVTVDATILALKSGNAIV
PROA_GLOVI        QIAALKDPVGEIVGGWRHPEGLEIVRVRVPLGLIGIIYEARPNVTADAIGLCLKSGNGVL
PROA_THEMA        TVIGLKDPVGEVIDSWVREDGLRIARVRVPIGPIGIIYESRPNVTVETTILALKSGNTIL
PROA_BACAN        QLIELRDPVGECVSAWERPNGLSIQEMRVPLGVVGMIYEARPNVTVDAATICLKTGNAVI
PROA_BACSU        LLIDLADPIGDSLETIEKENGLFIEKIRVPLGVVGMIYEARPNVTVDAATLCLKTGNAVV
PROA_ENTFA        QVATLPDPIGEVDKMWRNEAGLLIGQQRVPLGVIGIIYESRPNVTTDAASLCFKSGNAVI
PROA_LACPL        QVVSLPDPIGNVDRAWRNEAGLMIAKERVPLGVIGMIFEARPNVTVDASALCFKTGNAVI
PROA_LISMO        QVVALKDPIGEVTNMWKNEAELTIGKTRVPLGVIGIIYESRPNVTVDASVLCFKTGNAVI
PROA_LACLA        QVAELPDPIRQVLQGFTNLDGLKILQKRVPLGTVGMIFESRPNVTIDAFSLCFKTGNSVL
PROA_CLOAB        KTSSLQDPIGEVIKMWKTPDELQIGQMRVPLGVIGIIYEARPNVTVDAAALCIKSGNSVI
PROA_MOOTA        ELAALPDPVGEVTSMWTRPNGLQIGRVRVPLGVIGIIYEARPNVTVDAAGLCLKTGNAVI
PROA_BACTN        NVATLPSPLGRILKETSRPNGMKLTKVSVPFGVIGIIYEARPNVSFDVFSLCLKSGNACI
PROA_CHLTE        NVAALPSPLHRVLEERTLPNGLELKKVSVPLGVIGIIYESRPNVTFDVFALCLKSGNATV
PROA_NEIG1        AVAALPDPVGEILETSTLPNGLEIVKKRVAMGVIGIIYESRPNVTSDAAALALKSGSAVV
PROA_NEIMB        AVAALPNPVGEILETSTLPNGLEIVKKRVAMGVIGIIYESRPNVTSDAAALALKSGSAVV
PROA_STRR6        EVVALPDPIGEVLETSQLENGLVITKKRVAMGVIGIIYESRPNVTSDAAALTLKSGNAVV
PROA_MYCS2        QVAALPDPVGEVLRGKTLPNGLQLRQQRVPLGVVGMVYEGRPNVTVDAFGLTLKSGNAAL
PROA_MYCTU        QVAGLRDPVGEVLRGYTLPNGLQLRQQRVPLGVVGMIYEGRPNVTVDAFGLTLKSGNAAL
PROA_CORGL        QVAGLTDPVGEVLRGHVMENGIQMKQVRVPLGVMGMVYEARPNVTVDAFGLALKSGNVAL
PROA_STRCO        DVVALPDPVGEIVRGSTLPNGIDLRQVRVPLGVVGIIYEGRPNVTVDAAALCLKSGNAVL
PROA_BIFLO        HVATLPDPVGEIVRGYNLPNGLRLTQTRVPMGVIGMIYEARPNVTVDVASLCLKSGNAAL
PROA_KORVE        EVAALADPVGETLAEWERPNGLRIRKVRVPLGVVAIIYEARPNVTIDVIGLALKSGNAVV
PROA_CHLAA        QVASLPDPVGEIFDRRELPSGLRLYKRRVPIGVIGAIYEARPNVTVDIASLCLKAGNAVI
PROA_DEIRA        AVAALPDPVGEQTDEKTLPSGIRVSQRRVPLGVLGVIYESRPNVTVDVAALALMSGNAAI
PROA_ECOLI        QVCNLADPVGQVIDGGVLDSGLRLERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVI
PROA_SHIDS        QVCNLADPVGQVIDGGILDSGLRLERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVI
PROA_SALTY        QVCNLADPVGQVIDGGLLDSGLRLERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVI
PROA_YERPE        QVCRLNDPVGRVIDGSLLDSGLKLERRRVPLGVIGVIYEARPNVTIDVASLCLKTGNAVI
PROA_HAEIN        HVISLADPVGKIIDGGTLDSGLKIERVRTPLGVIGTIYEARPNVTIDVASLCLKTGNAVI
PROA_ALIF1        NVINLNDPVGSEIDSKVLENGMSLSRRRVPIGVIGVIYEARPNVTIDIASLCLKTGNASI
PROA_VIBCH        NVIKLNDPVGSEIDSRVLENGMSLARRRVPLGVVGVIYEARPNVTIDIAALCLKTGNAAI
PROA_SHEON        DVVRLADPVGEEFGSRVLDNGLRLTRRRVPLGVIGVIYEARPNVTVDIAVLALKTGNAVI
PROA_AGRFC        SVAALADPVGEVIAAWDRPNGLKIERVRTPLGVIGVIYESRPNVTADAGALCLKAGNAVI
PROA_BRADU        IVRGIADPVGIVTESWQRPNGMTIERVRVPLGVVGVIFESRPNVAADAGVLCLKSGNAVI
PROA_RHORT        DIAALPDPVGTVLAGWQRPNGLRIERVRVPIGVIGVIYESRPNVTADAGALCLKAGNAAI
PROA_CAUVC        AVAAVPDPVGVATSRWTRPNGLDIARVRTPIGVIAMIYESRPNVTADAAALCVRSGNAVI
PROA_RHOS4        AVAGQPDPVGQVIAEWDRPSGLHIRRVRTPLGVVGVIYESRPNVTADAGALCLKSGNAVI
PROA_BURPS        QVATLADPIGEMSNLKYRPSGIQVGQMRVPLGVIGIIYESRPNVTIDAAALCLKSGNATI
PROA_PSEAE        QVATLPDPIGEIRDMRYVPSGIQIGKMRVPLGVVGIIYESRPNVTIDAASLCLKSGNATI
PROA_BORPE        QIAALPDPGGSITATSVRPNGMRVAQMRVPLGVIGIIYESRPNVTIDAAALCLKSGNATI
PROA_RHOBA        EIASLNDPIGEVLDGFARPGGMRIEKRRVPLGVVFFIYESRPNVTADAAGICVKSGNAVI
PROA_SALRD        DVASFADPVGEMGGTTKRPSGIEVGKMRIPLGVIGMIYEARPNVTADAAGLCFKAGNAVL
PROA_XANCP        EVAVLPDPVGQVTRDDVRPNGIRVQKVRVPLGVIAMIYEARPNVTADAAALCIKAGNGVI
PROA_GEOSL        EVAALSDPVGEVTRMWTRPNGLRVGKMRIPLGVIGIIYEARPNVTADAAALCLKSGNSVI
PROA_DESVH        HVAALPDPVGAIETQWQRPNGLLVGKMRIPLGVIAMIYESRPNVTIDSAILCLKAGNAVI
PROA_THET8        QIARLPDPLGRIEGLAKRPNGLRVGRMRVPLGLIGFIYEARPGATVEAVSVALKAGNAML
PROA_LEPIN        EIAALPDPIGEVTRGITLPNGLELVTRRVPLGVVMVIYESRPNVTIDVGALSFKSGNACI
Q2JWY6_SYNJA      LLAQQPDPIGSLERGCRQDNGLFIGRYRVPLGLIALVYEIYPEFALNGIGMCLKTSNGVI
F4CQV9_PSEUX      VLADTPEP-PTEREVRTLPGGERVLERRIPVGVIGAVFEARPNVTVDVASQVLKARSAAV
                        .*                     ..* :  :.*  *          . : .  :

K9R0D6_NOSS7      LKGSTEASHSNAAISEVLQHALAE----VGLPAGCIELITAEHGASIRDLVT-------Q
B7JWV9_RIPO1      LRGCGSSTHSNAVIANILQAALEE----VKLPKGCLEVLSGEEGNSIQDLVT-------Q
B1XPW2_SYNP2      IRGCGDASHTNHLIAEIMQTALAD----QGLPAGCLESLSSEEGCTVQQLVA-------Q
B8HLF7_CYAP4      LKGGSEASHSNQVIAELLESACAM----TGLPQGCIEALPSDRSVLIKDLIT-------Q
PROA_CAMJE        FKGGSEAKFTNEAIFTLVNKVLKE-----FDLQDCFAMFTQ--RDEILQILA-------F
PROA1_SYNY3       LKGGREATRSCQVLTEVIQTALAK----TVVSPEAINLLTT--REEIRELLG-------L
PROA_THEEB        LKGGQEASRSCQTIMQTIHRGLEK----SAVPAGAIALLTQ--RSEISELLQ-------L
PROA_PROMA        LKGGSEASLTNIEIVKAMKEGLSK----SDIQPESICLLKT--RQESLGLLG-------L
PROA_SCHPO        LKGGTESAKSFAALSNVVRSALGK----SKVPQAAVQLVQS--REEVSQLLK-------L
PROA_YEAST        LKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQLIET--RQDVSDLLD-------Q
G2PIL7_MURRD      LKGGKEAYHSNKALVKFWHQALSE----NGLLEDFIQFLEMD-RTQTQDFLRN------P
E6X4I4_CELAD      LKGGKESIQSNLALVALWHKALEH----NECTTDWVTYLQFN-REETQAFLQN------P
PROA_AQUAE        LRGGKEAINSNKALVNLIKEACRE----TGFPEDAVQFIDRSEREIVWEILK-------M
PROA_THEYD        LRGGSEAINSNIALVKILKEALKD----EGMHEGVVTYIDISQREAVLEMIK-------L
PROA_DICTD        LRGSSDALNSNIIITEIMKEALSN----TKVPPDTVQIIESPEHSVVEELLQ-------M
PROA_GLOVI        LKGGKEAENSNQAISSVLKAAAYE----QGIPEGCIEQLPG-ERAVVEALIR-------L
PROA_THEMA        LRGGSDALNSNKAIVSAIREALKE----TEIPESSVEFIENTDRSLVLEMIR-------L
PROA_BACAN        LRGSSSAIHSNKAIVAVIHRALKQ----TSLPQESVQLIEDTTRDSAKQLFT-------M
PROA_BACSU        LRGSSSAIHSNKALVSVIYRALEQ----SALPIHAVQLIEDTSRETAKELFT-------L
PROA_ENTFA        LRGGKEAFHSNQILVTILQEALIQ----EAVSPHLIQFVDDTSRETAQQLMR-------L
PROA_LACPL        LRGGKEALHSNQALVQVLRGALRA----EAVDENAIQLITDTSHATAAKFMQ-------L
PROA_LISMO        LRGGSDAIDSNKALMSVIQDSLEA----SGFPRSSVQLIEDTSRETARDMMR-------L
PROA_LACLA        LRGGSDAIYSNMVLVEIIKENLLS----AKITDGAVELLSDTSHAEAEKMMQ-------A
PROA_CLOAB        LRGGKEAINSNTAIAKIIKNAVVT----AGLPDGSIEFIDITDRETVNVMMR-------L
PROA_MOOTA        LRGGSEAFYSNQALTRVISRAATA----AGAPEGAIQLIETTDREAVNLLLR-------A
PROA_BACTN        LKGGSDADDSNRAIISVIHKVLEK----FHVNPHIVELLPAD-REATAALLN-------A
PROA_CHLTE        LKGGSDAAYSNIAIVNLIQTVIRD----RGLDPDMIYLLPAE-REAAHILLN-------A
PROA_NEIG1        LRSGKDAFQSARAIVAALKTGLAQ----TRIDPEAVQLIEDTGREGSYEMMR-------A
PROA_NEIMB        LRSGKDAFQSARAIVAALKTGLAQ----TRIDPDALQLIEDTGRESSYEMMR-------A
PROA_STRR6        LRSGKDAYQTTHAIVTALKKGLET----TTIHPNVIQLVEDTSRESSYAMMK-------A
PROA_MYCS2        LRGSSSAARSNQALVDALRSALAE----EGLPLDAVQLLPSQDRASVTHLIQ-------A
PROA_MYCTU        LRGSSSAAKSNEALVAVLRTALVG----LELPADAVQLLSAADRATVTHLIQ-------A
PROA_CORGL        LRGSSTAVHSNTKLVEILQDVLER----FELPRETVQLLPCQTRGSVQDLIT-------A
PROA_STRCO        LRGSSSAYRSNTALVRVVRDAVGG----AGLPADAVQLVPGESRESVRELMR-------A
PROA_BIFLO        LRGGHAAERTNAATLGVIAPVLEA----HGFESALVQSVDQYGRAGATAMME-------A
PROA_KORVE        LRGGKEAVRSNECLVKIAGAT-------PGMPDGAIQLLDASNRESVQQLMK-------A
PROA_CHLAA        LRGGSDIARSVAATTEVIALALEQ----AGLPAFAVQSIIDPDRELVRQLLR-------L
PROA_DEIRA        LRGGKETVNSNAALEDAIHAALNR----EGLPADAVQVIRDPDRARMLELLR-------L
PROA_ECOLI        LRGGKETCRTNAATVAVIQDALKS----CGLPAGAVQAIDNPDRALVSEMLR-------M
PROA_SHIDS        LRGGKETCRTNAATVAVIQDALNS----CGLPAGAVQAIDNPDRALVSEMLR-------M
PROA_SALTY        LRGGKETYRTNAATVRVIQKALKA----CGLPEAAVQAIDNPDRSLVNEMLR-------M
PROA_YERPE        LRGGKETHYTNQATVNVIQRALEQ----CGLPAAAVQAIESPDRQLVNELLR-------L
PROA_HAEIN        LRGGKETQFSNKILIEVVQNALEQ----AGLPKFAVQAITDPNRELVMQLLK-------L
PROA_ALIF1        LRGGKETFFSNMELVKVIQVALEK----AGLPAASVQYIEKPDRELVSQLLT-------M
PROA_VIBCH        LRGGKETFFSNMELVKVIQSALDK----AGLPAASVQYIEKPDRELVTQLLK-------M
PROA_SHEON        LRGGKETLESNKLISEVIRGAIAS----QGLPVDAVQLIDSSDRALVTGLLK-------L
PROA_AGRFC        LRGGSDSQHSSRAIHACLVQGLRI----AGLPENAIQLVPVTDRAAVGALLSG------L
PROA_BRADU        LRGGSDSFRSCRAIHECLVQGLRE----AGLPEAAITLVPTRDRAAVGMMLSG------L
PROA_RHORT        LRGGSESFNSSRAIHRCLAAGLRA----AGLPEDAIQSVPTPDRAAVGMLLT-------M
PROA_CAUVC        LRGGSECIHSNLAIHAAIARGLQK----AGLPTAAVQAVKTPDRAAVGMILAG------L
PROA_RHOS4        LRGGSESFHSSGAIHAALQDGLRQ----AGLPVDAIQRVPTRDRAAVAEMLR-------M
PROA_BURPS        LRGGSEALESNTALAKLIGEGLAA----AGLSQDAVQVVGTADRAAVGKLIT-------M
PROA_PSEAE        LRGGSEAIHSNQAIARCIQQGLAE----AGLPAAAVQVVETTDRAAVGALIS-------M
PROA_BORPE        LRGGSEALHSNVALGRIVQAGLQA----AGLPTAAVQVIDTTDRAAVGKLVT-------M
PROA_RHOBA        LRGGKEAAHSSRAIIEVLHEVGRR----VGIPDDAVQLVGTTDRAAVGHFLK-------Q
PROA_SALRD        LRGGSNAFHSNQAVAAALHTALEA----EGVPPAAVTLIPTTDRAAVQEMLT-------L
PROA_XANCP        LRGGSEAIHSNTAIARALQGALRE----ANVPEAALTLVEDLRRETMLELLQ-------L
PROA_GEOSL        LRGGSEAIHSNLAIARILGEELKR----AGIPAAALSVVPFPEREGVLEMLK-------Q
PROA_DESVH        LRGGSEAIHSNLALAALITEALSS----VGLPAEAVQVVSTTDRAVIAELCK-------L
PROA_THET8        LRGGKEAFRSNRALVALWHEALGE----AGLPEEAVTLVPTTDREAVLEMCR-------L
PROA_LEPIN        LRGGSEAFYSNEILIKLFHEILIK----EEIDIGSVVFVDKTDRSFMIPFFQ-------Q
Q2JWY6_SYNJA      LAGSGPIQKTHQALVNLLAETAYE----HGIPEGAIQTLPAQDQATDPQADSPLLLLLQQ
F4CQV9_PSEUX      LRTGAAALGSATTLVEQVIAPALDA---NGVPPAAVQLVPTPGHAGADALVG-------L
                  :        :                         .  .                     

K9R0D6_NOSS7      DQYVNLAIPYGR---SSLVQQVMRQATCPVLKSAMGNCYLY-----WSLNGSLEMVRWMI
B7JWV9_RIPO1      HQYLSLVIPYGR---PSLVDQVTQLATAPVLKSAMGNCYLY-----WSPTVDLDLVRWVI
B1XPW2_SYNP2      DRYLNLIIPYGR---PNMIQQVVQHATTPVLRTTVGNCYLY-----LAPSGDLELASWVI
B8HLF7_CYAP4      EQWIDLVIPYGR---PSLVQQVIRQATVPVLKSVIGNCYLY-----WSVSGSAELVRLLI
PROA_CAMJE        DDLIDVIIPRGS---SNMIQEIANNTKIPLIKQNKGLCHAF-----VDQSANLDMALKII
PROA1_SYNY3       NQYVDLIIPRGS---NEFVQYIQQNTQIPVLGHADGICHLY-----LDAQADLSKAIPIT
PROA_THEEB        DQWVDLIIPRGS---NEFVRYIQNNTRIPVLGHADGLCHLY-----VDRAADLEKAIAIT
PROA_PROMA        DGIVDLIIPRGS---NELVRFIQDNTRIPVLGHADGICHLY-----IDSAVNLNQALDIA
PROA_SCHPO        DEYIDLVIPRGS---TNLVRHIKDNTKIPVLGHAAGLCSMY-----VHEDADMELASKLV
PROA_YEAST        DEYIDLVVPRGS---NALVRKIKDTTKIPVLGHADGICSIY-----LDEDADLIKAKRIS
G2PIL7_MURRD      DQDLDLIVPRGG---ERLIAFVKEHAKCAVLISGRGNNFLY-----VHKEADWEKSLKVI
E6X4I4_CELAD      TQKIDLIVPRGG---EKLIAFVKKHATCPVIISGRGNNFAY-----VATDADLEMAIDII
PROA_AQUAE        EGKIDVAIPRGG---ESLIRAVVEHAKVPVIKHYKGVCNIY-----VDDEADLEKAYHIV
PROA_THEYD        EGIIDLIIPRGG---EGLIRTVTENSRIPVLKHYKGVCHVF-----VDRDADLAMAEEIC
PROA_DICTD        VDYIDVAIPRGS---AKFIKHVMNISKVPVIETGAGNNHIY-----VEEDADFEMARKII
PROA_GLOVI        NPYLALVIPRGG---HSLIDFVVRNATVPVLETGVGNCHIY-----VAASADLEMARRIV
PROA_THEMA        REYLSLVIPRGG---YGLISFVRDNATVPVLETGVGNCHIF-----VDESADLKKAVPVI
PROA_BACAN        NDYLDVLIPRGG---KQLIDTVVREASVPVLETGAGNCHVF-----IDETADKQMAFDII
PROA_BACSU        NDGLDVLIPRGG---KKLIDLVVRESTVPVLETGAGNCHIF-----IDETAKPQMAEKVV
PROA_ENTFA        NDYLDVLIPRGG---ANLIKTVLTTATVPVIETGTGNCHIY-----VDKDAQLTMATEII
PROA_LACPL        TDYVDVLIPRGS---ARLIQTVLAKATVPVIETGAGNCHVY-----VDKDAQLQMATDIV
PROA_LISMO        NRFLDVLIPRGG---AKLIQTVLENATVPVIETGTGNCHIY-----VDKAAEKQMAIDIL
PROA_LACLA        DKFLDVLIPRGS---ARLINRVKEKATVPVIETGVGNCTIF-----VDESADLEMATKIV
PROA_CLOAB        NGLIDVLIPRGG---AGLIKSVVENSSVPVIETGTGNCHVY-----VDKYADFDKAERII
PROA_MOOTA        NDYLDVLIPRGG---AGLIRTVVENATVPVIETGVGNCHVY-----VDAEADLDMAQRIV
PROA_BACTN        TGYVDLIIPRGS---SNLINFVRENARIPVIETGAGICHTY-----FDEFGDTRKGADII
PROA_CHLTE        VGYIDVIIPRGS---QALIDFARKHSTVPVIETGAGIVHTY-----FDQSGDLAMGRDIV
PROA_NEIG1        KDYLDLLIPRGG---AGLIRAVVENAVVPVIETGTGIVHIY-----IDKDADWDKALRIV
PROA_NEIMB        KDYLDLLIPRGG---AGLIRAVVENAVVPVIETGTGIVHIY-----IDKDADWDKALRIV
PROA_STRR6        KGYLDLLIPRGG---AGLINAVVENAIVPVIETGTGIVHVY-----VDKDADEDKALSII
PROA_MYCS2        RGLVDVVIPRGG---AGLIDAVVRDAQVPTIETGVGNCHVY-----VHSSADIDMAEKIL
PROA_MYCTU        RGLVDVVIPRGG---AGLIEAVVRDAQVPTIETGVGNCHVY-----VHQAADLDVAERIL
PROA_CORGL        RGLVDVVIPRGG---AGLINAVVTGATVPTIETGTGNCHFY-----IDAEAKLDQAIAMV
PROA_STRCO        RGLVDVLIPRGG---ASLISTVVQESTVPVIETGTGNCHVY-----VDAHADLDMAVDIL
PROA_BIFLO        RGHIDVLVPRGG---AGLIQAVVRNSKVPVIETGAGNVHIY-----IDKSGDLAKAIPII
PROA_KORVE        RGLVDVIVPRGG---AGLIQFVVENSTVPVIETGAGNCHIF-----VDESANLDMADRIV
PROA_CHLAA        DRYVDMIIPRGG---AGLHRFCVENATVPVIVGGMGVSHIY-----VEPSADFARAVPVI
PROA_DEIRA        DESVDAIIPRGG---AGLHRFCVENATVPVIVGGIGVVHIYLDGSFVQTPQDVQIAAALI
PROA_ECOLI        DKYIDMLIPRGG---AGLHKLCREQSTIPVITGGIGVCHIY-----VDESVEIAEALKVI
PROA_SHIDS        DKYIDMLIPRGG---AGLHKLCREQSTIPVITGGIGVCHIY-----VDESAEIAEALKVI
PROA_SALTY        DKYIDMLIPRGG---AGLHKLCREQSTIPVITGGIGVCHIF-----VDSSADIAPALKII
PROA_YERPE        DRYVDMLIPRGG---ASLHKLCREQSTIPVITGGIGVCHTF-----VDENADFEKALLVI
PROA_HAEIN        DRYVDMIIPRGG---SGLHELCKQHSTIPVIVGGVGVCHTF-----VEKSADQNKAIFVI
PROA_ALIF1        DDYVDMIIPRGG---AGLHKMCKENSSIPVIIGGFGISHAF-----VDESADLERALVVV
PROA_VIBCH        DDYVDMIIPRGG---AGLHKMCKENSTVPVIIGGFGISHIF-----VDESADLDKSVAVI
PROA_SHEON        DQYVDMIVPRGG---QALQRLCAEQATIPVILGGIGICHLY-----VDKAANLERALEVI
PROA_AGRFC        KGTVDVIVPRGG---KSLVARVQSEARVPVFAHLEGICHIY-----VDKSADLDMAKAIV
PROA_BRADU        NGAIDVIVPRGG---KSLVARVEQEARVPVFAHLEGVNHVY-----VDASADLAMAKSIV
PROA_RHORT        TDFIDVIVPRGG---KSLIERVSAESKVPLFKHLEGLCHTY-----IHAKADPQKALSVT
PROA_CAUVC        DRTIDLIIPRGG---KSLVARVQAEARAPVLGHLEGLNHVF-----VHAAADLKKAVEVV
PROA_RHOS4        VEHIDVIVPRGG---KGLVGLVQAEARVPVFAHLEGICHVY-----ADGEADLEKARRVV
PROA_BURPS        TEYVDVIVPRGG---KSLIERLINEARVPMIKHLDGICHVY-----VDDRASVAKALAVC
PROA_PSEAE        PEYVDVIVPRGG---KGLIERISREAKVPVIKHLDGICHVY-----IDVAADLDKAIRVA
PROA_BORPE        TEHVDVIVPRGG---KGLISRLAQEARVPLIKHLDGNCHVY-----VDAAADLAKAHDIA
PROA_RHOBA        SDNIDVTIPRGG---ENLIRRVAAEATMPVIKHYDGNCHVY-----VDESADIEMAVDII
PROA_SALRD        NQHLDLIIPRGG---EGLIRFVDETSQIPVIKHYKGVCHLY-----VDEDADLEVAEDLL
PROA_XANCP        SDIVDLAIPRGG---EGLIRFVAEHARVPVIKHYKGVCHLF-----VDASADVDLAVRLL
PROA_GEOSL        EEFIDLIIPRGG---ESLIRFVVENSRIPVIKHYKGVCHVF-----VDADADFDMAEKII
PROA_DESVH        EEHIDVIIPRGG---ETLIRAVVDMARMPVLKHYKGVCHAY-----IDSGADLAQAVEII
PROA_THET8        -ELLDLLIPRGG---EELIRLVQREARVPVLAHAKGVNHLY-----VDKKADLSMALRLA
PROA_LEPIN        TSLIDIVVPRGG---EGLIRFVSENSKIPVVKHDKGVCNLY-----IDQDADPEKVIPIV
Q2JWY6_SYNJA      TRYVDLVIPCGR---PGWVEFLLQASKVPTLVTHLGYGHIY-----VDRTAPWPLVKSVL
F4CQV9_PSEUX      PDLVPLVVVRGSGEVTRRLSALGATAGTRILAHADGGGVLY-----LDASAEPE-AVAGL
                     :   :  *              :    .    *    :                   

K9R0D6_NOSS7      IDSHDSEPD---PVNAIEKVLIHRQA--MPSSLAVLWNSLKEKG-FELKGDAELVEAFPQ
B7JWV9_RIPO1      VDSHASEPD---PVNAIEKVLISPLQ--NPSILVRLFNILREKG-FQLRGDAELSAEFPD
B1XPW2_SYNP2      QDSHNYEPD---AVNAIEKVLVCPEQ--KTSHLISLFKSLQEQD-FELRGDASLVEEFPE
B8HLF7_CYAP4      LDSHQGEPD---AVNAIEKVLLHANL--NRSLLVVLFNALKQKG-FELRGDQALVEEFAD
PROA_CAMJE        LNAKCQRVS---VCNALETLLIHEKI--AKNFISLLIPEFEKFK-VKIHAHENALAYFNN
PROA1_SYNY3       VDAKTQYPA---ACNAIETLLVHQAI--AAEFLPPLAQALGEKG-VSLRG-----DSGTQ
PROA_THEEB        LDAKTQYPA---ACNAIETLLVHRDI--AEAFLPKVAAALQQAG-VELRG-----DAIAC
PROA_PROMA        IDSKCQYPA---ACNAIETLLLHKDI--AASFLKLAIPAFEKLG-VTLLG-----DELSQ
PROA_SCHPO        LDGKTDYPA---ACNAIETLLINEAV--LSSHLPKIAETLTEAK-VTLKC----DPASLK
PROA_YEAST        LDAKTNYPA---GCNAMETLLINPK---FSKWWEVLENLTLEGG-VTIHATKDLKTAYFD
G2PIL7_MURRD      LNAKTHKIS---ACNALDKVLMDTQIDGYEDKLKELKQVLTANN-VSILV----DDQVKK
E6X4I4_CELAD      INAKTTKIS---ACNALDKVLIAADMPRKFEFLQHLIQELKKRD-VEILT----DQTLSD
PROA_AQUAE        YNAKVQRPS---VCNAVENLVINRKI--LKEFFPKMAYYLGKAG-VELRCDEESLQVIK-
PROA_THEYD        FNAKVQRPA---TCNAMETMLVDENI--AKKFLPNMLKKFEDAG-VELKG---CLKTKK-
PROA_DICTD        INAKVQRPS---VCNAIEKLLIHKNI--AEEFLPIIAKDLREYN-VEIRG---CKRTLK-
PROA_GLOVI        INAKVQRPS---VCNAAEKLLVHRDT--VVTHLAPLLEDLHAHG-IEVRG---CPRTVA-
PROA_THEMA        INAKTQRPG---TCNAAEKLLVHEKI--AKEFLPVIVEELRKHG-VEVRG---CEKTRE-
PROA_BACAN        -NAKTQRPS---VCNAIETIVLHEKW--AEQYGSELFSSLKKRG-VELRG---DQKALA-
PROA_BACSU        VNAKTQRPS---VCNAIESLLIHKAW--ARQHGKELLDQLENAG-VEIRG---DELVCE-
PROA_ENTFA        VNAKCQRPS---VCNAAETLLIHQEV--AEAFLPTIEKALKEFH-VELRA---DERALA-
PROA_LACPL        INGKVQRPS---VCNATEKLLIHREV--AADYLPSMIQALREQG-VEVRG---DAATQA-
PROA_LISMO        VNAKCSRPS---VCNAAETLLIHRDV--ADAFLPEIETALKEYN-VELRA---DERARE-
PROA_LACLA        INAKTQRPS---VCNAAESLVVHAKI--ADEFLPKLENEINKVHEIEFRA---DERALK-
PROA_CLOAB        INAKLQRPA---VCNAMESLLVHKDV--AHEFLPRISSKLKELK-VQIRG---CAATQK-
PROA_MOOTA        INAKTQRPG---VCNAMETLLVHEKV--ADSFLPSLAAALKEKG-VTIRG---CERTRA-
PROA_BACTN        HNAKTRRVS---VCNALDCTIIHEKR--LGD-LPALCDQLKESK-VTIYADTQAYQALEG
PROA_CHLTE        FNAKTRRPS---VCNALDTLIVHESR--IDD-LPVLVVPLEEKN-VQIFADEPAYYKLLG
PROA_NEIG1        YNAKTGRPS---VCNSMEVLLVHEGI--AAD-FLPKLERLLVRG-RIEAGLPPVRFRLDP
PROA_NEIMB        YNAKTSRPS---VCNSMEVLLVHEDI--AAD-FLPKLERLLVRD-RIEAGLPPIRFRLDP
PROA_STRR6        NNAKTSRPS---VCNAMEVLLVHENK--AAS-ILPRLDQMLVAE-RKEAGLEPIQFRLDS
PROA_MYCS2        LNAKTRRPS---VCNAAETLLVDRAL--TDTALPRLVKALQDAG-VTVH-----------
PROA_MYCTU        LNSKTRRPS---VCNAAETLLVDAAI--AETALPRLLAALQHAG-VTVH-----------
PROA_CORGL        INGKTRRCS---VCNATETALLDAAL--SDSDKLAVVQALQEAG-VTIHGRVAELEAF--
PROA_STRCO        INSKAQRVG---VCNAAETLLVHQDV--AAEFLPRALAALAEAG-VTVHADERVMAHAKD
PROA_BIFLO        INAKTQRVG---VCNAAEKLLVHKDV--AAEFLPQIAAALAEAN-VVLQTDTTSYGIISG
PROA_KORVE        INAKTQRPS---VCNAAEKLLVHRAI--AKEYVPRIVKLLLDHG-VEVRGDAETLALA--
PROA_CHLAA        VNAKVQRPG---ACNALDTLLVHRAA--ASTFLPLVAAALAQHG-VELRCDLEALAILAD
PROA_DEIRA        RNAKTQKPS---ACNALDTLLIDRAA--LAA-LPDVVRPLLESG-VEVRADAEAQAALAG
PROA_ECOLI        VNAKTQRPS---TCNTVETLLVNKNI--ADSFLPALSKQMAESG-VTLHADAAALAQLQA
PROA_SHIDS        VNAKTQRPS---TCNTVETLLVNKNI--ADSFLPALSKQMAESG-VTLHADAAALAQLQT
PROA_SALTY        VNAKTQRPS---TCNTVETLLVHQDI--AERFLPALSKQMAESG-VTLHGDETVM-QVLH
PROA_YERPE        ENAKIQRPS---ACNSLETLLVHQAV--AKTFLPLLSARMHAFG-VTLHASPLAMPYLAD
PROA_HAEIN        DNAKTQRPS---TCNTLETLLVQHSI--AEEFLPKLVSHLSAKN-VKYHAKSTALNILKQ
PROA_ALIF1        DNSKAQRPS---ACNALDTLLVHEAV--APQFLALLANNMAGR--VELVAEPKAYGLLKE
PROA_VIBCH        ENAKVQRPS---ACNALDTLLVHQAI--AKPLLDKLIAKLNGK--VAFVAEPKAKALMSS
PROA_SHEON        ANAKVQRPT---VCNALDTLLVDKTI--AANFVPQIVEYLHCLG-VRFSVCEQSHALLDG
PROA_AGRFC        VNAKMRRTG---ICGAAETLLVDASA--VSSHLEPVVKALLDAG-CEVRGSQPVRNVVEG
PROA_BRADU        LNAKMRRTG---VCGAAETLLVDRAA--AATSLKPLVEMLIEAG-CEVRGDDVVQKTDAR
PROA_RHORT        VNAKMRRTG---VCGSTETILVDRAI--AATILPPLLDALAKAG-CALRGDEETRAFSER
PROA_CAUVC        VNAKLRRVS---VCGSAETLLIDQAA--ADKLLPPIADALIKAG-CELRGDAAARAIEPT
PROA_RHOS4        LNAKTRRTG---ICGSAECLLIDRAF--LAKHGPVLIEDLLKAG-VEVRAEGELAQVPGT
PROA_BURPS        DNAKTHRYG---TCNTMETLLVARGI--APAVLTPLGRLYREKG-VELRVDADARAVLEA
PROA_PSEAE        DNAKTQRYA---PCNTMETLLVHAGI--AERVLPPLATIYREKG-VELRGDAATRALLGA
PROA_BORPE        FNAKTYRYG---VCGAMETLLVHADV--AQRLLPALGQALREHG-VELRGCARALQWLPE
PROA_RHOBA        ENAKCQRMG---VCNACESLLIHQSI--AADALPAIAKRLASRG-VEMRVDERASAYVPD
PROA_SALRD        LDGKVSRPS---VCNALETLLVHADV--ADDFLPRARALLDDAG-VELRGDDRTRQLLPG
PROA_XANCP        VDGKASRPS---ACNSLETLLVHADI--AERFLPAAAAALRARN-VELRGDAATRAVLPE
PROA_GEOSL        VNGKVQRPG---VCNALETLLVHKDI--AETFIPRIAETLIELK-VELRGDDCVRQFVPQ
PROA_DESVH        HNAKVQRPG---VCNALEGLLVHRDE--AAAFLPAIAERLGNDG-VEFRACPASLPLLGD
PROA_THET8        LNGKTQRPA---VCNALETVLVHEKV--AEAFLPRLEKAMREKG-VELRACPRALPLLKE
PROA_LEPIN        INSKVQRPG---VCNSTENLILHNG----YPFRKELLEALAKEG-VELLLDPSSLALYPN
Q2JWY6_SYNJA      LDPLARYGPEGIPIYQPLTLWLLIHTDWAAHHLTALIEDLLGQG-IDIQAAAPILERFPQ
F4CQV9_PSEUX      IDAGTDRLG---VCNRLNLLLIDRPV--YDALLPVAEKVLTGKG-IALSLPPHAHRLGHE
                   :                   :                                      

K9R0D6_NOSS7      L-------QLAKD---------NEWGCAYLTKTVAFKLVDSLEGAIAWINQYSSGHADSI
B7JWV9_RIPO1      Y-------LVPVKP--------SEWGHPYLDKIIAFKVVNDLSEGITWINQYSNGHADCL
B1XPW2_SYNP2      H-------LAPIGTE-------EEWQQAYLEKIVAFKRVPDLAAAITEINCNSGGHADCI
B8HLF7_CYAP4      L-------KLAAE---------EEWRQPYLKKVVAFKLVENLEAAIGWINRHSSCHADCI
PROA_CAMJE        SNLKIFKANEN------------TFDTEWLDFALSVKLVKDCDEAIEHINKHSSLHSETI
PROA1_SYNY3       KLIDCEPATEA------------DWCTEYSDLILSIKIVDSLEAAIDHINQYGSKHTDGI
PROA_THEEB        DLVPMSLASEA------------DWATEYCDLILAIKVVPDLDAALDHIATYGSGHTEAI
PROA_PROMA        SFGIITKAEES------------DWSTEYLDLKLSVKVVSSVDEAMLHIRRYGSRHTDAI
PROA_SCHPO        VLKDMPKVSAL-----VEPSVDQDYNTEFSDLILAIKTVPSLQSAMQHINTHGSKHTDCI
PROA_YEAST        KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI
G2PIL7_MURRD      VLKDEEIIPDP-----------SVWQEEFLAMKCVIGAVNNIDEAVEKINKNSGGHSASI
E6X4I4_CELAD      -LEGSTTFEDE-----------AIWYEEFLDYKIVIGQVADINEAVAKINTYGGGHSAVI
PROA_AQUAE        ----ENPKLSFVNAK---PATEEDYYEEFLDLILAVKVVDDVDEAIAFIEKYGSKHSDAI
PROA_THEYD        ----IYPKVKDVK--------EEDFYQEYLDLVLNVKVVKNIDEAIEHITKYGSAHSDSI
PROA_DICTD        ----ILTDAIPAT--------EEDWYTEYLDYIIAIKIVESIDEAIEHINKYNTKHSEAI
PROA_GLOVI        ----FDPKVKSAG--------EEDWGKEYLDKIIAIKVVDSTREAIDWINHYGTRHSEAI
PROA_THEMA        ----IVPDVVPAT--------EDDWPTEYLDLIIAIKVVKNVDEAIEHIKKYSTGHSESI
PROA_BACAN        ----MDSTIVLAS--------EEDWGTEFLSLTPAVKLVSSIEEAIHHINTYGSMHSEAI
PROA_BACSU        ----LHPSSKQAS--------KEDWETEFLAPVLSVKTVENVQEAVKHIQQYGTNHSEAI
PROA_ENTFA        ----IFEEAIPAT--------EQDWETEFLDFILAVKVVDSLDEAIQHINRYNTKHSESI
PROA_LACPL        ----IVPDVVPAT--------DADWGTEYNDLIIAVKVVDSEAAAITHINRYNTQHSEAI
PROA_LISMO        ----ILKDSKAAT--------ESDWEDEFLDFILAIKVVDSVDEAINHINKYGTKHSEAI
PROA_LACLA        ----VLSAGIPAT--------DDDFGTEFLDYILSVKTVDNLDEAIEHINTYSSRHSESI
PROA_CLOAB        ----IVKDIVPAT--------DEDFGKEFLDLILSVKVVDSLEEAIDHIFKYSTKHSEAI
PROA_MOOTA        ----IIPWAEVAT--------ETDWATEYLDLILAIRVVDSLESALEHIHRYGTKHSEAI
PROA_BACTN        YYP-AELL-QPAT--------PESFGTEFLDYKMAVKTVKSFEDALGHIQENSSRHSECI
PROA_CHLTE        RYP-DELL-EMAS--------PEHFGTEFLSLKMSIKTVGSLEEALNHIARHSSKHSEAI
PROA_NEIG1        QAA-RYIGGEAAG--------ADDFDTEFLDYILAVKTVASVEEAVGHIEARGTHHSDGI
PROA_NEIMB        QAA-RHIGGEAAG--------ADDFDTEFLDYILAVKTVASVEEAVWHIETHSTHHSDGI
PROA_STRR6        KAS-QFVSGQAAE--------TQDFDTEFLDYVLAVKVVSSLEEAVAHIESHSTHHSDAI
PROA_MYCS2        ---------ADPT--------EDELRAEFLSMDIALAVVDGLDAAIDHINTYGTGHTEAI
PROA_MYCTU        ---------LDPD--------EADLRREYLSLDIAVAVVDGVDAAIAHINEYGTGHTEAI
PROA_CORGL        ----GATDVVEAT--------ETDWDSEYLSFDIAVAVVDGVDGALAHIAKYSTKHTEAI
PROA_STRCO        ----SGANVVEAT--------PEDWETEYLSYDIAAAVVDSLDRAVEHIRLWTSGHTEAI
PROA_BIFLO        AAI-EGLDLNHAA--------EEDWDTEYLALKMGIKVVSDLDAAIDHINTHSTGHTESI
PROA_KORVE        ----QGMQVAEAT--------SADWDEEYLRLCMAVKVVADVDEAIAHINQHSTKHSESI
PROA_CHLAA        APGHEAWNLKPAS--------PTDFGCEFLALIVAIKIVGSIDEALDHIALYG-GHSEAI
PROA_DEIRA        A----GLNVTSAQ--------LGDYGTEFLALVASLRTVSGLDEALDFIAERG-GHTDVI
PROA_ECOLI        G----PAKVVAVK--------AEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQHSDAI
PROA_SHIDS        G----PAKVVAVK--------AEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQHSDAI
PROA_SALTY        G----PAKLVPLK--------PEELDNEFLSLDLNVVVVENMDGAIAHIREHGTQHSDAI
PROA_YERPE        G----KAKVVAVE--------AADYDDEWLSLDLNVDIVTDIDAAIDHIREHGTSHSDAI
PROA_HAEIN        A----GANVCEVT--------EKELRKEWGSLDLNVVVVEDIHAAIEHIRQYGTQHSESI
PROA_ALIF1        FE---GVSLREAQ--------EGDFDTEWLSYTLGVKVVADVNEAAAHMQKHNASHSDTI
PROA_VIBCH        -----AAELRDAQ--------AGDFDTEWLSYTLGVKVVQDVQEAIEHMREHNASHSDAI
PROA_SHEON        L----GFDIELAT--------EQSFATEWLSLTLGIKVVSDIDAAIAHIRRHSSGHSEAI
PROA_AGRFC        L--------EAATE--------EDWRTEYLDAIISVAVVDGISGAIEHIGTYSSNHTEAV
PROA_BRADU        V--------KPAND--------DDWDTEYLDAIIAAKVVDGVDGAIAHIQNHGSHHTDAI
PROA_RHORT        V--------GPATA--------EDWDTEYLDAIVSIRVVADLDEALAHIAAHSSDHTDCI
PROA_CAUVC        M--------KKATV--------EDWTTEYLAPILSVAVVDGVAGAARHIASYGSGHTDAI
PROA_RHOS4        V--------PAQP---------EDFGREFLDMIIAAKVVDGVDEAIAHIRRYGSSHTESI
PROA_BURPS        AGV---GPLVDATD--------EDWRTEYLAPVLAIKIVDGIDAAIEHINEYGSHHTDAI
PROA_PSEAE        D-------VLEATE--------EDWRTEYNAPILSIRIVDGLDAAIEHINTYGSQHTDAI
PROA_BORPE        G--------KPADD--------ADWATEYLGPILAVRVVDTIDEAMDHISRWGSGHTDAI
PROA_RHOBA        G--------VPATD--------ADFAAEFLGPQISIAVVDSLAAATDHINHYGSGHTDAI
PROA_SALRD        V-------GAATED---------DYAAEYLDLTLAARVVESDDEALNHIAEYGSNHTEVI
PROA_XANCP        I-------AAASDD---------DYAAEFLDLILAIRVVPDLDTALAHIRQYGSDHTEVI
PROA_GEOSL        A-------TKATED---------DWHAEYLELILAVRVVDDLDEAVAHINRYGSLHTEAI
PROA_DESVH        S-------AIPMKD--------EDNGQEFHDLILLVRIVDDMDEALAHIAAYGSNHTEII
PROA_THET8        A-------VPARED---------EWDREYLDLVLRVKVVSGLEEALAHIARYGSRHTEAI
PROA_LEPIN        G--------KPVK--------EQDYLEEFLDLRLSVKTVSSLEEALAFIEKTSSGHTEAI
Q2JWY6_SYNJA      LQP------------------LGEGFDSTERPHLRLQPVADLTEAIAWINKNGCRQSETI
F4CQV9_PSEUX      W-----------------------ALDSGSEAHVTVQPVDGAVDAALTASRETSGLAATV
                                                        *     .           :  :

K9R0D6_NOSS7      ATESYQESRQFALGVHSASTYINTSPRFSR-----NPSR-GDSVFLGMSNQKGH-RRGFI
B7JWV9_RIPO1      VTDSYPESRQFAMEVDSALVYINASSRFSR-----NPKQ-GESLFLGVSNQKGH-HRGLI
B1XPW2_SYNP2      VTESYHESRQFSMGLDSALIYINASPCFSR-----HPLG-SDSVFLGVSNQKGN-RRGLI
B8HLF7_CYAP4      VTESYRESRTFIREVDSASTYVNASPRFSR-----QVGNLPGSISLGMSNQKGL-NRGVI
PROA_CAMJE        ISNDASNIAKFQRLINSSCIYANASTRFS------DGGEFGFGGEVGISTSKLH-ARGPM
PROA1_SYNY3       ISEDLTAAEQFCQRVDSAGVYHNCSTRFA------DGFRYGFGAEVGISTQKMP-PRGPV
PROA_THEEB        VTEDAAAAARFLQEVDAAGVFHNCSTRFA------DGFRYGFGAEVGISTHKLP-PRGPV
PROA_PROMA        ATTNKEIARRFLRTVDSSGVYHNCSTRFA------DGFRYGFGAEVGISTQTLP-PRGPV
PROA_SCHPO        ITSSEAAANRFMAGIDASGVYWNASTRFA------DGFRYGYGTEVGISTNKIH-ARGPM
PROA_YEAST        VTENKANAEKFMKGVDSSGVYWNASTRFA------DGFRYGFGAEVGISTSKIH-ARGPV
G2PIL7_MURRD      MTENNDVAKTFMENVDCAAVYQNASTRFT------DGGQMGVGAELAISTDKLH-HRGPL
E6X4I4_CELAD      ITSNEEKAQLFMESVDSAAVYHNASTRFT------DGFQFGLGGELAISTDKLH-QRGPI
PROA_AQUAE        ITENYTKAMKFLREVDSAAVYVNASTRFT------DGNEFGLGAEMGISTDKIH-ARGPM
PROA_THEYD        VTKDYNKAMKFLKEVDSSAVFVNASTRLN------DGYQFGLGAEIGISTDKIH-ARGPM
PROA_DICTD        ITKDYYKALKFLRMVDAAAVYVNASTRFT------DGGEFGLGAEIGISTQKLH-ARGPM
PROA_GLOVI        VTANYEEARRFTAAIDAAAVYVNASTRFT------DGGEFGFGAEIGISTQKLH-ARGPV
PROA_THEMA        LTENYSNAKKFVSEIDAAAVYVNASTRFT------DGGQFGFGAEIGISTQRFH-ARGPV
PROA_BACAN        ISENEEKVSKFFVSVDAAALYHNASTRFT------DGSEFGSGAEIGISTQKLH-VRGPM
PROA_BACSU        LTENDKNAVYFQTAVDAAAVYHNASTRFT------DGFEFGYGAEIGISTQKLH-ARGPM
PROA_ENTFA        ISDNYFATQQFLQQVDAAAVYANASTRFT------DGFEFGFGAEIGISTQKLH-ARGPM
PROA_LACPL        VTDNYQAGKLFQQRVNAACVYINASTRFT------DGFEFGFGAEIGISTQKLH-ARGPM
PROA_LISMO        ISNDYATGQAFHQKVDAAAVYINASTRFT------DGFAMGFGAEIGISTQKLH-ARGPM
PROA_LACLA        VTHDYFNAQKFQDEIDAAAVYVNASTRFT------DGFVFGLGAEIGISTQKLH-ARGPM
PROA_CLOAB        ITENYTNAQRFLKEVDAAAVYVNASTRFT------DGEQFGFGGEIGISTQKLH-ARGPM
PROA_MOOTA        VTTNYQTAREFLARVDAAAVYVNASTRFT------DGYEFGFGAEIGISTQKLH-ARGPM
PROA_BACTN        VTENKERATLFTKIVDAACVYTNVSTAFT------DGAQFGLGAEIGISTQKLH-ARGPM
PROA_CHLTE        IASDQTTIDAFMKQVDAAAVYANTSTAFT------DGAQFGLGAEIGISTQKLH-ARGPM
PROA_NEIG1        VTENRHAADYFTTHIDSAAVYINASTRFT------DGGEFGLGCEMGISTQKLH-ARGPM
PROA_NEIMB        VTENRHAADYFTTHIDSAAVYVNASTRFT------DGGEFGLGCEMGISTQKLH-ARGPM
PROA_STRR6        VTENAEAAAYFTDQVDSAAVYVNASTRFT------DGGQFGLGCEMGISTQKLH-ARGPM
PROA_MYCS2        VTTDLAAAQRFTERVDAAAVMVNASTSFT------DGEQFGFGAEIGISTQKLH-ARGPM
PROA_MYCTU        VTTNLDAAQRFTEQIDAAAVMVNASTAFT------DGEQFGFGAEIGISTQKLH-ARGPM
PROA_CORGL        ATQNIETAQRFADRVDAAAVMINASTAYT------DGEQYGMGAEIGISTQKLH-ARGPM
PROA_STRCO        VTTSQQAARRFTQLVDSTTVAVNTSTRFT------DGGQFGFGAEIGISTQKLH-ARGPM
PROA_BIFLO        IAEDYAAIEEFTKRIDSAVVMVNASTRFT------DGGVFGFGAELGISTQKMH-ARGPM
PROA_KORVE        ITANDAHARRFLRAADSAAVYWNASTRFT------DGAEFGFGAEMGISTQKLH-CRGPF
PROA_CHLAA        LTGDPISAERFTREVDATAVFVNASTRFN------DGGQFGLGAEVAISTNRLH-ARGPM
PROA_DEIRA        LTRDPAQAERFVQDVDSAAVMVNVSPRFN------DGGQLGLGAEVAISTQKLH-ARGPM
PROA_ECOLI        LTRDMRNAQRFVNEVDSSAVYVNASTRFT------DGGQFGLGAEVAVSTQKLH-ARGPM
PROA_SHIDS        LTRDMRNAQRFVNEVDSSAVYVNASTRFT------DGGQFGLGAEVAVSTQKLH-ARGPM
PROA_SALTY        LTCDMHNAARFVNEVDSAAVYVNASTRFT------DGGQFGLGAEVAVSTQKLH-ARGPM
PROA_YERPE        LTRSLSHAEYFVRAVDSSAVYVNASTRFT------DGGQFGLGAEVAVSTQKLH-ARGPM
PROA_HAEIN        LTSSQSLARQFINQVDAAAVYVNASTRFT------DGGQFGLGAEVAVSTQKLH-ARGPM
PROA_ALIF1        LTNNIESAEKFINTAGSAAVYVNASTRFT------DGAQFGLGAEVAVSTQKLH-ARGPM
PROA_VIBCH        MTNDLYNAELFVNTAGSAAVYVNASTRFT------DGAQFGLGAEVAVSTQKLH-ARGPM
PROA_SHEON        LTDDIHAATHFMNEVNSAAVYVNASTRFT------DGGQFGLGAEVAVSTQKLH-ARGPM
PROA_AGRFC        IAEDPDVVARFFNELDSAILLHNASTQFA------DGGEFGMGAEIGIATGKMH-ARGPV
PROA_BRADU        VSENEAAAKKFLSEVDSAIVLHNASTQFA------DGGEFGFGAEIGIATGRFH-ARGPV
PROA_RHORT        LTEDAAAAERFLTEVDSAIVMHNASTQFA------DGGEFGMGAEIGISTGRLH-ARGPV
PROA_CAUVC        ITEDAAAAEAFIAEVDSAIVLVNASTQFA------DGGEFGFGAEIGIATDKLH-ARGPV
PROA_RHOS4        LTENDATAERFFRRLDSAILMRNASTQFA------DGGEFGMGAEIGIATGKMH-ARGPV
PROA_BURPS        VTEDHDRAMRFLREVDSASVMVNASTRFA------DGFEFGLGAEIGISNDKLH-ARGPV
PROA_PSEAE        ITENFSDARRFLAEVDSASVMVNASTRFA------DGFEYGLGAEIGISTDKLH-ARGPV
PROA_BORPE        VTENLSAAQRFQREVDSSSVYVNLPTCFA------DGFEYGLGAEIGISTNRLH-ARGPV
PROA_RHOBA        VTSNIAASEQFTALVDSSAVMVNASTRFN------DGGMFGLGAEIGISTDKFH-ARGPC
PROA_SALRD        VTDRLPTARRFVRSVDASVVLVNASSRFS------DGGELGLGAEIGISTTKLH-AYGPM
PROA_XANCP        ATQTPANAETFVQSLRSAVVMVNASSRFS------DGGELGLGAEIGISTTRLH-SYGPM
PROA_GEOSL        VTRDYHNAQRFIREVNSSTVLVNASTRFA------DGNQLGLGAEIGISTTKLH-SFGPM
PROA_DESVH        CTRDHGNAMRFLREADASMVAVNASSRFN------DGGQLGLGAEIGISTSKLH-SYGPM
PROA_THET8        CTEDPKAAWRFLEEVDASLVLWNASTRFN------DGFELGLGAEIGISTSKLH-AYGPM
PROA_LEPIN        VTEDLNTARIFTNSLDSAALFINCSTRFH------DGGEFGLGAEVGISTGKLH-VRGPM
Q2JWY6_SYNJA      LTDSQSAAQRFLQEVDAALIHINTSPLSAGRGAGIPTLGAFRDLSLGISTQRLH-VRGPI
F4CQV9_PSEUX      CAQDEAVATAFIDAYTGTGVFWNTTTRLL------DGYKLLGLPETGINVDRSPGPRGPV
                   :        *      :    * ..                    .:         *  

K9R0D6_NOSS7      SLETLTTAKHIIQGNGRF-----------------------------
B7JWV9_RIPO1      SLETFTTLKQVVQGNGKF-----------------------------
B1XPW2_SYNP2      GLESFTTIKQVVQGDSTL-----------------------------
B8HLF7_CYAP4      GVQALMTSKTIIQGDEPFKPG--------------------------
PROA_CAMJE        GIEDICTYKYIINGEGQIRE---------------------------
PROA1_SYNY3       GLEGLVTYKYQLWGHGHIAATYTGQ-GAKAFTHLDL-----------
PROA_THEEB        GLEGLVTYKYQLVGNGHIVATYSGA-NARPFTHRDLDC---------
PROA_PROMA        GLDGLVTYRYFLEGDGHIAEDFSN--GKKTFSHIDL-----------
PROA_SCHPO        GLDGLTIYKYQLRGNGQVASSYGVGPGKRAFKHTPINIDNISQVSKK
PROA_YEAST        GLDGLVSYQYQIRGDGQVASDYLGAGGNKAFVHKDLDIKTVTL----
G2PIL7_MURRD      GLNQLVTNKYYVFGDGQIRV---------------------------
E6X4I4_CELAD      GLQHLVTNKWYVLGNGQVRS---------------------------
PROA_AQUAE        ALEELTIPKFVILGEGQVRDNFGVPEEWMKEF---------------
PROA_THEYD        GLEELTCTKFIVFGNGQIRQ---------------------------
PROA_DICTD        GLKELTTTKYVILGEGQIRE---------------------------
PROA_GLOVI        GLVELTTTKYVVSGSGQIRP---------------------------
PROA_THEMA        GLRELTTYKFVVLGEYHVRE---------------------------
PROA_BACAN        GLPALTSTKYVIRGNGQIRK---------------------------
PROA_BACSU        GLPALTSTKYIIKGTGQIRE---------------------------
PROA_ENTFA        GLAELTSTKYVIYGNGQARS---------------------------
PROA_LACPL        GLAELTSYKYVIDGNGQIRH---------------------------
PROA_LISMO        GLTELTSTKYIIFGDGQIRN---------------------------
PROA_LACLA        GLEALTSTKYLIDGTGQIR----------------------------
PROA_CLOAB        GLEQLTTTKYVIYGDGQIRK---------------------------
PROA_MOOTA        GPEQLTTFKYIIFGSGQIRQ---------------------------
PROA_BACTN        GLEEITSYKWVIEGDGQTRW---------------------------
PROA_CHLTE        ALKELCSYKWLVTGQGQVRTA--------------------------
PROA_NEIG1        GLKELTSYKYIVQGTGQVRE---------------------------
PROA_NEIMB        GLKELTSYKYIVQGTGQVRE---------------------------
PROA_STRR6        GLKELTSYKYVVAGDGQIRE---------------------------
PROA_MYCS2        GLPELTSTKWIVWGDGQIRPA--------------------------
PROA_MYCTU        GLPELTSTKWIAWGAGHTRPA--------------------------
PROA_CORGL        ALPELTSTKWILQGTGQIRP---------------------------
PROA_STRCO        GLPELTSTKYIVTGDGHVRR---------------------------
PROA_BIFLO        GLREMTTTKWIGYGTGQVRA---------------------------
PROA_KORVE        ALAELTSSKYEVIGSGQVR----------------------------
PROA_CHLAA        GLQELTTYTWIGEGDYLVRA---------------------------
PROA_DEIRA        GLRELTTSKWVVRGEGQVRD---------------------------
PROA_ECOLI        GLEALTTYKWIGIGDYTIRA---------------------------
PROA_SHIDS        GLEALTTYKWIGIGDYTIRA---------------------------
PROA_SALTY        GLEALTTYKWIGFGDGTIRA---------------------------
PROA_YERPE        GLDALTTYKWIGYGDDLVRS---------------------------
PROA_HAEIN        GLEALTSYKWVCEGEYTVRK---------------------------
PROA_ALIF1        GLEELTSYKWVGKADYLIRS---------------------------
PROA_VIBCH        GLEELTSYKWVGKANYLSRS---------------------------
PROA_SHEON        GLEALTTYKWLAWGDYTSRA---------------------------
PROA_AGRFC        GVEQLTSFKYRVHGTGQTRT---------------------------
PROA_BRADU        GAEQLTSFKYRVHGTGQTRP---------------------------
PROA_RHORT        GVEQLTIFKYKVRGTGQTRP---------------------------
PROA_CAUVC        GAEQLTTFKYVVRGTGQTRP---------------------------
PROA_RHOS4        GAEQLTSFKYLVTGDGTIRT---------------------------
PROA_BURPS        GLEGLTSLKYVVLGHGEGRE---------------------------
PROA_PSEAE        GLEGLTSEKYVVFGDGHVRT---------------------------
PROA_BORPE        GLEGLTTLKWVLNGEGQVRA---------------------------
PROA_RHOBA        GLRELTSYKYIVRGNGHIRG---------------------------
PROA_SALRD        GLEALTTEKFVVYGEGETRHPVEK-----------------------
PROA_XANCP        GLEALTVERFVVRGEGQVRH---------------------------
PROA_GEOSL        GLEDLTTTKFIVYGDGQVRP---------------------------
PROA_DESVH        GVQELTTTKFVVFGAGQIRQ---------------------------
PROA_THET8        GPMELTTLKWVALGEGQERT---------------------------
PROA_LEPIN        GLVHLTTTTTYVTGNGQIRG---------------------------
Q2JWY6_SYNJA      DLEALTTVKVVAQGDL-------------------------------
F4CQV9_PSEUX      TYPDLALRQFVVLPAR-------------------------------
                      :