CLUSTAL format seed alignment for MF_00414

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

UBIB_BURPS      ----MRIFRFVKIVFTVIRFGLDEVMLSRIE----NPRVKLLLRITTIGRRFAD-PPAVR
UBIB_BURMA      ----MRIFRFVKIVFTVIRFGLDEVMLSRIE----NPRVKLLLRITTIGRRFAD-PPAVR
UBIB_RALSO      ---MTRLFRLCKIIFVILYHGLDQLALSGFK----SRRIRALVWVLTLGRRQTR-PRGER
UBIB_NEIMB      ---MKWLKRLTVIVGTFYRYRLAGLCASLMG----SGWICALLKMMPQSSKLKNEPPAVR
UBIB_NEIMA      ---MKWLKRLTVIVGTFYRYRLAGLCASLMG----SGWICALLKMMPQSSKLKNEPPAVR
UBIB_CHRVO      ----MSISRSLKIVATLYRYGLDDFLEGHSR----LAFLHKLFGLCP-VRRDTSAPLPQR
UBIB_PROST      -MTPGEIKRLYFIIRVFLSYGLDELIPKVKL---TLPLRIGRFGFFWIKNQHKGKELGER
UBIB_PHOLL      -MTPGELRRLYLIIRVFLSYGLDELIPRIRL---TWPLRFGRYLLFWIPNRHKDKSLGER
UBIB_YERPP      -MTPGELRRLYLIIRVFLSYGLDELIPNIRL---TLPLRVGRHLFFWLSNRHKDKSLGER
UBIB_YERPA      -MTPGELRRLYLIIRVFLSYGLDELIPNIRL---TLPLRVGRHLFFWLSNRHKDKSLGER
UBIB_YERPN      -MTPGELRRLYLIIRVFLSYGLDELIPNIRL---TLPLRVGRHLFFWLSNRHKDKSLGER
UBIB_YERPE      -MTPGELRRLYLIIRVFLSYGLDELIPNIRL---TLPLRVGRHLFFWLSNRHKDKSLGER
UBIB_YERP3      -MTPGELRRLYLIIRVFLSYGLDELIPNIRL---TLPLRVGRHLFFWLSNRHKDKSLGER
UBIB_YERPS      -MTPGELRRLYLIIRVFLSYGLDELIPNIRL---TLPLRVGRHLFFWLSNRHKDKSLGER
UBIB_YERE8      -MTPGELRRLYLIIRVFLSYGLDELIPNIRL---TLPLRVGRHLFFWLPNRHKDKPLGER
UBIB_SERP5      -MTPGELRRLYLIVRVFLSYGLDELIPQMRL---TLPLRVGRRLLFWMPNRHADKPLGER
UBIB_SHIBS      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SHIDS      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SHIF8      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_ECO24      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SHIFL      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_ECOHS      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_ECOLI      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_ECO57      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_ECOLC      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_ECOL5      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKPLGER
UBIB_ECOK1      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKPLGER
UBIB_ECOUT      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKPLGER
UBIB_ECOL6      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKPLGER
UBIB_SHISS      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SALTI      -MTPGEVRRLYFIIRTFLSYGLDELIPRMRL---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SALPA      -MTPGEVRRLYFIIRTFLSYGLDELIPRMRL---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SALCH      -MTPGEVRRLYFIIRTFLSYGLDELIPRMRL---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SALPB      -MTPGEVRRLYFIIRTFLSYGLDELIPRMRL---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_SALTY      -MTPGEVRRLYFIIRTFLSYGLDELIPRMRL---TLPLRLWRYSLFWMPNRHKDKLLGER
UBIB_CITK8      -MTPGEVRRLYFIIRTFLSYGLDELIPKMRI---TLPLRLWRYSLFWMPNRHKDKPLGER
UBIB_ENT38      -MTPGEIRRLYFIVRTFLSYGLDELIPKMRI---TLPLRIWRRMLFWMPNRHKDKLLGER
UBIB_KLEP7      -MTPGELRRLYFIIHTFLSYGLDELIPKMRI---TLPLRIWRRMLFWMPNRHQDQPLGAR
UBIB_CROS8      -MTPGEIRRLYFIIKTFLSYGLDELIPRMRL---TLPLRIWRRGLFWMPNRHKDLELGTR
UBIB_PECAS      -MTPSELRRLYSIVRVLLSYGLDELIPKMRL---TFPLRVGRRLLFWLPNRHRNMPLGER
UBIB_SODGM      -MIFGELRRLYLIIGVMLSYGLDELIPKTRL---TLPLRLGRNLLFWMPNNHAQRMLGER
UBIB_VIBCH      -MKPAELKRLYRIVKVQLEYGLDELLPEHHL---TRAPLLARKSLFWLRNQHADKALGDR
UBIB_VIBC3      -MKPAELKRLYRIVKVQLEYGLDELLPEHHL---TRAPLLARKSLFWLRNQHADKALGDR
UBIB_VIBVU      -MTPTELKRLYRIIKVQLEYGLDDLLPDHQL---AKAPRWMRKSLFWLKNQHPEKPLGDR
UBIB_VIBVY      -MTPTELKRLYRIIKVQLEYGLDDLLPDHQL---AKAPRWMRKSLFWLKNQHPEKPLGDR
UBIB_VIBPA      -MTPAELKRLYHIIKVQLEYGLDELLPDHQL---TKAPLLMRKSLFWIKNQHPEKPLGER
UBIB_VIBCB      -MTPAEIKRLYQIIKVQLEYGLDELLPDHQL---TKAPLLMRKSLFWIKNKHPEKPLGER
UBIB_ALIF1      -MTPSELKRLYHITKVQLEYGLDELLPEHAL---TQLPKRLRKGLFWIKNKYPEKTLGER
UBIB_PHOPR      MITPSEFKRLYKIIEVQLRYGLDDFLPEDPR---TKMPKMARKSLFWIKNQHPDKSLGER
UBIB_AERHH      -MTPKEFKRLYRIISILLEQGIDELVPARYQ---PWPGRLARRSLFWLKNKRQGLNRGAR
UBIB_AERS4      -MTPKEFKRLYRIITILLEQGIDELVPARYQ---PWPGRLARRSLFWLKKKQPDLSRGAR
UBIB_PASMU      -MQIKDISHLYNIIKTFLLYGIDEALPQHRY---TRAIRCWRKTLFWLRNQHKDKTFGLR
UBIB_HAES1      -MKLNDIKRLYKIVRVFLSYGIDEILPHNKY---TRSIRCWRMLFFWLKNKHKNKAFGLC
UBIB_ACTP2      -MTCKNTRRLYQIITTFLRYGIDEIIPDIPL---TRHARLGRKALFWVRNQHKDQPFGVR
UBIB_HAEDU      -MIFKNTRRSYQIIATFLRYGIDEIIPDIPF---TYSARLTRKAFFWLQNEHKDQPFGVR
UBIB_SHESM      -MTLASIRRGYHVIKTLLQYGLDDVLPPKMT---PWYFKLARNSLFWIRNKHKGKSGGER
UBIB_SHESR      -MTLASIRRGYHVIKTLLQYGLDDVLPPKMT---PWYFKLARNSLFWIRNKHKGKSGGER
UBIB_SHESA      -MTLASIRRGYHVIKTLLQYGLDDVLPPKMT---PWYFKLARNSLFWIRNKHKGKSGGER
UBIB_SHEB8      -MTLASIRRGYHVIKTLLQYGLDDVLPPKMT---PWYFKLARNSLFWIRNKHKNKPGGER
UBIB_SHEB9      -MTLASIRRGYHVIKTLLQYGLDDVLPPKMT---PWYFKLARNSLFWIRNKHKNKPGGER
UBIB_SHEB5      -MTLASIRRGYHVIKTLLQYGLDDVLPPKMT---PWYFKLARNSLFWIRNKHKNKPGGER
UBIB_SHEPC      -MTLTSIRRGYHVIKTLLQYGLDEVLPPKMT---PWYFTLARSSLFWIRNKHKSKPGGER
UBIB_SHESW      -MTLTSIRRGYHVIKTLLQYGLDEVLPPKMT---PWYFTLARSSLFWIRNKHKSKPGGER
UBIB_SHEAM      -MTFASLRRGYQVIRTLLHYGLDDVLPPTLL---PGYFKLLRLCLFWVRNRHKDKCGGER
UBIB_SHEPA      -MTVKSIRRAYHVIRTALHYGLDDLLPPKLT---PWYFKLLRYCFFWLRNQHKDKVGGER
UBIB_SHEHH      -MTAKNIRRAYHVIRTALHYGLDDLIPSKLT---PWYFKLFRYSFFWLRNQHKDKVGGER
UBIB_SHELP      -MTIKSMRRAYQVVKTVLQYGLDDLIPAKLK---PWYFRLLRWSFFWLTNQHKDKVGGER
UBIB_PSEAE      -MKLLAVRRLLRIQRVVIRYRLDDLILELPMLPWWLRLLGATLPWRWLPRRKLELTRGAR
UBIB_PSEAB      -MKLLAFRRLLRIQRVVIRYRLDDLILELPMLPWWLRLLGATLPWRWLPRRKLELTRGAR
UBIB_PSEA7      -MKLLAFRRLLRIQRVVVRYRLDDLILELPMLPWWLRLLGAALPWRWLPRRKLELTRGAR
UBIB_PSEMY      -MKLLAVRRLLRIQRVVIRYQLDELLLELP-LPFWLRALSWLLPWRWLPRRPLALSRGAR
UBIB_PSEPG      -MKLLAVRRLFRIQRVVIRYRLDDLLFEQPLLPWWLASLRLLMPWRWLPRKPTELSRGAR
UBIB_PSEP1      -MKLLAVRRLFRIQRVVIRYRLDDLLFDQPLLPWWLASLRLLMPWRWLPRKPTELSRGAR
UBIB_PSEE4      -MKLLAVRRLLRIQRVVIRYRLDDLLFEQPLLPWWLASLRLLMPWRWLPRKPLALSRGAR
UBIB_PSEPF      -MKLLAVRRLLRIQRVVIRYRLDDLLFDLPL-PWFLLALRYVLPWRWFPRKPLELSRGAR
UBIB_PSEF5      -MKLLAVRRLLRIQRVVIRYRLDDLLFDLPL-PWFLLALRFALPWRWFPRKPLDLSRGAR
UBIB_PSEU2      -MKLLAVRRLFRIQRVVIRYRLDDLLFALPL-PWWMLALRFVLPWRWLPRRKSELSRGVR
UBIB_PSESM      -MKLLAVRRLFRIQRVVIRYRLDDLLFALPL-PWWMLAVRFVLPWRWLPRRKSELSRGVR
UBIB_PSE14      -MKLLAVRRLFRIQRVVIRYRLDDLLFALPL-PWWMLAVRFVLPWRWLPRRKSELSRGVR
UBIB_MARHV      ---MTRLQRLFRIAWVFCRYRLDTFL-PLSELPTPLKIFFLLAPWHLFPQPK--LSRGDR
UBIB_HAHCH      ---MRRINRLFQIVWVICRYRLDEFA-PLTLLPLPLRLLFLLAPWRLFPKPQ--IPRGER
UBIB_XYLFA      ---MKALFRACRIGKVMLRYRLDTLLDGTAA---ERWLRLAKPFVPRISAEIVEQSRGRR
UBIB_XYLFT      ---MKALFRACRIGKVMLRYRLDTLLDGTAV---ERWLRLAKPFVPRISAEIVEQSRGRR
UBIB_XANC8      ---MKAILRASRIGRVILRYRLDALLEGTPA---ERWLRLAKPFVPRASAEIAAQSRGAR
UBIB_XANCP      ---MKAILRASRIGRVILRYRLDALLEGTPA---ERWLRLAKPFVPRASAEIAAQSRGAR
UBIB_XANOR      ---MKAILRASRIGRVILRYRLDALLEGTPA---ERWLRLAKPFVPRASAEIAVQSRGAR
UBIB_XANOM      ---MKAILRASRIGRVILRYRLDALLEGTPA---ERWLRLAKPFVPRASAEIAVQSRGAR
UBIB_XANC5      ---MKAILRASRIGRVILRYRLDALLEGTPA---ERWLRLAKPFVPRASAEIAAQSRGAR
UBIB_XANAC      ---MKAILRASRIGRVILRYRLDALLEGTPA---ERWLRLAKPFVPRASAEIAAQSRGAR
                        :   :        :                                      

UBIB_BURPS      LRRALESLGPIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIVEKSLGA-
UBIB_BURMA      LRRALESLGPIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIVEKSLGA-
UBIB_RALSO      LRLALEQLGPIFVKFGQVLSTRRDLLPPDVADELAKLQDRVPPFDPKIAAAIVERSLGK-
UBIB_NEIMB      LRLALESLGPIFIKFGQVLSTRPDLIPHDYAVELAKLQDKVPPFDARLSREQIEKSLGQ-
UBIB_NEIMA      LRLALESLGPIFIKFGQVLSTRPDLIPHDYAVELAKLQDKVPPFDARLSREQIEKSLGQ-
UBIB_CHRVO      VRLALESLGPIFVKFGQVLSTRRDLLPPEYADELALLQDRVPPFDGDIARQVVERSLGR-
UBIB_PROST      LRLALQELGPVWIKFGQMLSTRRDLFPLAIADQLSLLQDKVASFDGKLARRYIEESLGG-
UBIB_PHOLL      LRLALQELGPVWIKFGQMLSTRRDLFPPAIADQLALLQDRVASFDGALARQYIETALGG-
UBIB_YERPP      LRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGG-
UBIB_YERPA      LRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGG-
UBIB_YERPN      LRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGG-
UBIB_YERPE      LRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGG-
UBIB_YERP3      LRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGG-
UBIB_YERPS      LRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGG-
UBIB_YERE8      LRLALQELGPVWIKFGQMMSTRRDLFPPAIADQLALLQDRVAPFDGALARKHIEIAMGG-
UBIB_SERP5      LRLALQELGPVWIKFGQMMSTRRDLFPPQIADQLTLLQDRVAPFDGALARKHIELAMGG-
UBIB_SHIBS      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_SHIDS      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_SHIF8      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECO24      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_SHIFL      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECOHS      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECOLI      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECO57      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECOLC      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECOL5      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECOK1      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECOUT      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_ECOL6      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_SHISS      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGL
UBIB_SALTI      LRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGL
UBIB_SALPA      LRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGL
UBIB_SALCH      LRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGL
UBIB_SALPB      LRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGL
UBIB_SALTY      LRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGL
UBIB_CITK8      LRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGALAKAQIEEAMGGL
UBIB_ENT38      LRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDRVAPFDGARAKQQIEEAMGNI
UBIB_KLEP7      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDRVAPFEGKLAQQQIEKAMGGL
UBIB_CROS8      LRLALQELGPVWIKFGQMLSTRRDLFPPVIADQLALLQDRVAPFDGKLAKQQIEKAMGDR
UBIB_PECAS      LRLALQELGPVWIKFGQMMSTRRDLFPPAIADQLAMLQDKVEPFDGKLAREQIELAMEGI
UBIB_SODGM      LRLALQELGPVWIKFGQMLSTRRDLFPPAIADQLAMLQDRVQPFDGALARAHIERSMGQ-
UBIB_VIBCH      LRLALQELGPVWIKFGQMMSTRRDLFPPHIADPLAMLQDKVAPFDGLQAKQLIEEELGA-
UBIB_VIBC3      LRLALQELGPVWIKFGQMMSTRRDLFPPYIADPLAMLQDKVAPFDGLQAKQLIEEELGA-
UBIB_VIBVU      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADPLALLQDQVSPFDGALAKAQMEQALGG-
UBIB_VIBVY      LRLALQELGPVWIKFGQMLSTRRDLFPPHIADPLALLQDQVSPFDGALAKAQMEQALGG-
UBIB_VIBPA      LRLALQELGPVWIKFGQMMSTRRDLFPPHIADPLALLQDQVAPFDGELAKQQMEKALGG-
UBIB_VIBCB      LRLALQELGPVWIKFGQMMSTRRDLFPPHIADPLALLQDQVAPFDGQLAKEQMELALGG-
UBIB_ALIF1      LRLALQELGPVWIKFGQMMSTRRDLFPPHLADQLALLQDQVAPFDGQLAKDQMEMELGG-
UBIB_PHOPR      LRLALQELGPVWIKFGQMMSTRRDLFPPHIADQLALLQDQVEPFDGNLAKEHMELSLGG-
UBIB_AERHH      IRLAFEALGPIFIKFGQMLSTRRDLLPPDIAEELALLQDRVPPFCGQAARRQIEASLGC-
UBIB_AERS4      IRLAFEALGPIFIKFGQMLSTRRDLLPPDIAEELAMLQDRVPPFCGQAARLKIEESLGC-
UBIB_PASMU      LRLALQELGPVWIKLGQMLSTRRDLFPPDIADELALLQDQVDPFDGKIARAQIEKALGA-
UBIB_HAES1      LRLALQELGPVWIKLGQMLSTRRDLFPAEIADELALLQDNVEAFSGKIARQQIEQALGS-
UBIB_ACTP2      LRLALQELGPVWIKLGQMLSTRRDLFEPELAEQLALLQDSVEPFDGKSARQIIEQALGG-
UBIB_HAEDU      LRLALQELGPVWIKLGQMLATRRDLFEPALADQLALLQDSVAPFDGKLARKIIEQALGN-
UBIB_SHESM      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWANELAMLQDKVPPFDGALARQAIETELKA-
UBIB_SHESR      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWANELAMLQDKVPPFDGALARQAIEAELKA-
UBIB_SHESA      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWANELAMLQDKVPPFDGALARQAIEAELKA-
UBIB_SHEB8      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWASELAMLQDKVPPFDGALARQAIEAELKA-
UBIB_SHEB9      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWASELAMLQDKVPPFDGALARQAIEAELKA-
UBIB_SHEB5      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWASELAMLQDKVPPFDGALARQAIEAELKA-
UBIB_SHEPC      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWAIELAMLQDKVPPFDGVLARKAIEAELKA-
UBIB_SHESW      LKLAMQELGPVYIKLGQMLSTRRDLLSDEWAIELAMLQDKVPPFDGVLARKAIEAELKA-
UBIB_SHEAM      LKLAMQELGPVYIKFGQMLSTRRDLLSDEWAQELSMLQDRVPAFDSALAREAIEAELKA-
UBIB_SHEPA      LKLAMQELGPVYIKFGQMLSTRRDLLSDEWAEELAMLQDRVPPFDSAIARESIEKELNA-
UBIB_SHEHH      LKLAMQELGPVYIKFGQMLSTRRDLLSDEWAEELAMLQDRVPPFDSAIARASIETELNA-
UBIB_SHELP      LKLAMQELGPVYIKFGQMLSTRRDLLSDEWAEELAMLQDRVPPFDSAIARAQIEAELGA-
UBIB_PSEAE      LRLALQDLGPIFIKFGQILSTRRDLLPDDIANELAWLQDKVPPFPPELAVKRIEEQLGA-
UBIB_PSEAB      LRLALQDLGPIFIKFGQILSTRRDLLPDDIANELAWLQDKVPPFPPELAVKRIEEQLGA-
UBIB_PSEA7      LRLALQDLGPIFIKFGQILSTRRDLLPDDIANELAWLQDKVPPFPPELAVKRIEEQLGA-
UBIB_PSEMY      LRLALEDLGPIFIKFGQLLSTRRDLLPPDIADELARLQDQVPPFPEDQAIALIERQLGA-
UBIB_PSEPG      LRLALQDLGPIFIKFGQLLSTRRDLLPTDIADELMLLQDRVPPFDPQKAVALIEEQLGA-
UBIB_PSEP1      LRLALQDLGPIFIKFGQLLSTRRDLLPPDIADELMLLQDRVPPFDPKKAVALIEEQLGA-
UBIB_PSEE4      LRLALQDLGPIFIKFGQLLSTRRDLLPTDIADELMLLQDRVPPFDPQHAVALIEEQLGA-
UBIB_PSEPF      LRLALQDLGPIFIKFGQILSTRRDLLPEDIADELMRLQDRVPPFDSQLSVKLIEEQLGK-
UBIB_PSEF5      LRLALQDLGPIFIKFGQILSTRRDLLPEDIADELMLLQDRVPPFDSQKSVALIEAQLGK-
UBIB_PSEU2      FRLALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQQLAIKLIEEQLGA-
UBIB_PSESM      FRLALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQQVAIKLIEEQLGA-
UBIB_PSE14      FRLALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQQVAINLIEEQLGA-
UBIB_MARHV      LRLALEELGPVFVKFGQILSTRRDLLPDDMAESLKQLQDRVPPFPSEQARGIIEKSLGA-
UBIB_HAHCH      LRRALEELGPIFVKFGQILSTRKDLLPEDLADELKRLQDKVPPFASDMAVRIIEESLKS-
UBIB_XYLFA      LRLALQELGPIFVKFGQILSTRRDLVPQDIGDELVMLQDRVEPFEGQTARIIIETALGK-
UBIB_XYLFT      LRLALQELGPIFVKFGQILSTRRDLVPQDIGDELVMLQDRVEPFEGQTARSIIETALGK-
UBIB_XANC8      LRLALQELGPIFVKFGQILSTRRDLIPPDVAEELTLLQDRVKPFDGEAARLIVERALGL-
UBIB_XANCP      LRLALQELGPIFVKFGQILSTRRDLIPPDVAEELTLLQDRVKPFDGEAARLIVERALGL-
UBIB_XANOR      LRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGEAARLIVERALGL-
UBIB_XANOM      LRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGEAARLIVERALGL-
UBIB_XANC5      LRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGQAARLIVEAALGL-
UBIB_XANAC      LRLALQELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGQAARLIVEAALGL-
                .: *:: ***:::*:**:::** **.    .  *  *** * .*    :   :*  :   

UBIB_BURPS      RIDVLFDEFERVPVASASIAQVHFAKLKQGEH------KGKAVAVKVLRPNMLPVIDSDL
UBIB_BURMA      RIDVLFDEFERVPVASASIAQVHFAKLKQGEH------KGKAVAVKVLRPNMLPVIDSDL
UBIB_RALSO      PLSALFHRFDHHPVASASIAQVHFATLRGGPD------DGREVAVKVLRPGMLPVIDSDL
UBIB_NEIMB      SIEKLYAEFETEPIASASIAQVHKARLHS----------GEQVAVKVLRPNLLPVIEQDL
UBIB_NEIMA      SIEKLYAEFETEPIASASIAQVHKARLHS----------GERVAVKVLRPNLLPLIEQDL
UBIB_CHRVO      KVEELFVDFDLKPVASASVAQVHKAWLRQPDGG-----RGREVAVKVLRPGILPVIEQDL
UBIB_PROST      PLEQWFDDFDEKALASASIAQVHTAKLKE---------NGKEVVLKVIRPDILPVIKADV
UBIB_PHOLL      ALETWFDDFEPIALASASIAQVHTARLKE---------NGQEIVIKVIRPDILPIIKADI
UBIB_YERPP      ALETWFDDFDSQALASASIAQVHTARLKE---------NGKEVVLKVIRPDILPIIKADV
UBIB_YERPA      ALETWFDDFDSQALASASIAQVHTARLKE---------NGKEVVLKVIRPDILPIIKADV
UBIB_YERPN      ALETWFDDFDSQALASASIAQVHTARLKE---------NGKEVVLKVIRPDILPIIKADV
UBIB_YERPE      ALETWFDDFDSQALASASIAQVHTARLKE---------NGKEVVLKVIRPDILPIIKADV
UBIB_YERP3      ALETWFDDFDSQALASASIAQVHTARLKE---------NGKEVVLKVIRPDILPIIKADV
UBIB_YERPS      ALETWFDDFDSQALASASIAQVHTARLKE---------NGKEVVLKVIRPDILPIIKADV
UBIB_YERE8      PLETWFDDFEQEALASASIAQVHTARLKE---------NGQEVVLKVIRPDILPIIKADV
UBIB_SERP5      PLETWFDDFDQQALASASIAQVHTARLKT---------TGQEVVLKVIRPDIRPIIKADV
UBIB_SHIBS      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_SHIDS      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_SHIF8      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECO24      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_SHIFL      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECOHS      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECOLI      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECO57      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECOLC      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECOL5      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECOK1      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECOUT      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ECOL6      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_SHISS      PVEAWFDDFEIKPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_SALTI      PVEAWFDDFDIQPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIQADL
UBIB_SALPA      PVEAWFDDFDIQPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIQADL
UBIB_SALCH      PVEAWFDDFDIQPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIQADL
UBIB_SALPB      PVEAWFDDFDIQPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIQADL
UBIB_SALTY      PVEAWFDDFDIQPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIQADL
UBIB_CITK8      PVEEWFDDFDIQPLASASIAQVHTARLKS---------NGKEVVIKVIRPDILPVIKADL
UBIB_ENT38      PVETWFDDFDIKPLASASIAQVHTARLKE---------NGKEIVIKVIRPDILPVIRADM
UBIB_KLEP7      PVETWFDDFSVEPLASASIAQVHTARLKE---------NGKEVVIKVIRPDILPIIKADM
UBIB_CROS8      PVEEWFDDFDITPLASASIAQVHTARLKE---------NGKEVVIKVIRPDILPVIKADM
UBIB_PECAS      PLEEWFDDFDIKPLASASIAQVHTARLKS---------TGKEIVIKVIRPDILPVIKADM
UBIB_SODGM      PLETWFDDFQQEPLASASIAQVHTARLK----------NGQEVVIKVIRPDILPMIKADM
UBIB_VIBCH      PLETWFDDFDIKPLASASIAQVHTAKLKS---------NGRDVVLKVIRPDIRPQIDADI
UBIB_VIBC3      PLETWFDDFDIKPLASASIAQVHTAKLKS---------NGRDVVLKVIRPDIRPQIDADI
UBIB_VIBVU      PLETWFSDFDLVPLASASIAQVHTAKLKT---------TNQEVVLKVIRPDIRPIIDADL
UBIB_VIBVY      PLETWFSDFDLVPLASASIAQVHTAKLKT---------TNQEVVLKVIRPDIRPIIDADL
UBIB_VIBPA      PLENWFTEFDIKPLASASIAQVHTARLKD---------TNQEVVLKVIRPDIRPVIDSDL
UBIB_VIBCB      PLQNWFTEFDIKPLASASIAQVHTARLKD---------TNQEVVLKVIRPDIRPVIDSDL
UBIB_ALIF1      PLDNWFTDFDIKPLASASIAQVHTAKLKD---------SGREIVLKVIRPDIRPVIESDI
UBIB_PHOPR      PIETWFDDFDETPLASASIAQVHTATLKE---------NGREVVLKVIRPDILPVIQADI
UBIB_AERHH      TIETLFDDFDETPLASASIAQVHTARLKE---------NGREIVIKVIRPDIEPVIEADL
UBIB_AERS4      PVETLFDDFDETPLASASIAQVHTGRLKE---------NGREIVIKVIRPDIEPVIEADL
UBIB_PASMU      PLETWFDEFNETALASASIAQVHTAKFKQNAPHLENRLAGKEVVLKVLRPNIQQMINADL
UBIB_HAES1      SLENWFTDFDENALASASIAQVHTAKLKLGEEQ------EKEVVIKVLRPNIQPQIEADL
UBIB_ACTP2      SLETWFDEFDEQALASASIAQVHTAKFNQNQPL-----AGKDVVLKVIRPDIEPIIKADI
UBIB_HAEDU      TLETWFDDFDEQALASASIAQVHTATFNKNQPL-----AGQNVVLKVIRPDIEHIIKADI
UBIB_SHESM      PIESFFDDFNETPLASASISQVHTATLKS---------NGKAVVLKVLRPNVEAKIQADL
UBIB_SHESR      PIESFFDDFNETPLASASISQVHTATLKS---------NGKAVVLKVLRPNVEAKIQADL
UBIB_SHESA      PIESYFDDFDETPLASASISQVHTATLKS---------NGKAVVLKVLRPNVETKIQADL
UBIB_SHEB8      PIESLFDDFNETPLASASISQVHTATLKS---------NGKDVVLKVLRPNVETKIQADL
UBIB_SHEB9      PIESLFDDFNETPLASASISQVHTATLKS---------NGKDVVLKVLRPNVETKIQADL
UBIB_SHEB5      PIESLFDDFNEIPLASASISQVHTATLKS---------NGKDVVLKVLRPNVETKIQADL
UBIB_SHEPC      SIESLFDDFDETPLASASISQVHTATLKS---------NGKAVVLKVLRPNVEAKILADL
UBIB_SHESW      SIESLFDDFDETPLASASISQVHTATLKS---------NGKAVVLKVLRPNVEAKILADL
UBIB_SHEAM      PIDSLFDDFDDTPLASASISQVHTATLKS---------NGQQVVLKVLRPNVEANIKADL
UBIB_SHEPA      PIERYFNDFDDTPLASASISQVHTATLKS---------NGAAVVLKVLRPDVEKKVHADL
UBIB_SHEHH      PIESYFNDFDDIPLASASISQVHTATLKS---------NGAAVVLKILRPDVEQKVHADL
UBIB_SHELP      PIETYFDNFDDTPLASASISQVHTATLKS---------NGEEVVLKVLRPNVEEKVHADL
UBIB_PSEAE      KIEQVFARFEREPLASASVAQVHAARLKS----------GEEVVVKVIRPNLEPVIRSDI
UBIB_PSEAB      KIEQVFARFEREPLASASVAQVHAARLKS----------GEEVVVKVIRPNLEPVIRSDI
UBIB_PSEA7      KIEQVFARFEREPLASASVAQVHAARLKS----------GEEVVVKVIRPNLEPVIRSDI
UBIB_PSEMY      PVSQLFARFDSQPLASASVAQVHAAQLKS----------GEEVVVKVVRPGLKPVIRQDL
UBIB_PSEPG      KVGEVFSRFDVEPLASASVAQVHAARLKT----------GEEVVVKVVRPGLKPVIAQDL
UBIB_PSEP1      KVGEVFSRFDVEPLASASVAQVHAARLKT----------GEEVVVKVVRPGLKPVIAQDL
UBIB_PSEE4      KVGEVFSRFDVEPLASASVAQVHAARLKS----------GEEVVVKVVRPGLKPVIAQDL
UBIB_PSEPF      KISEVFSRFDVEPLASASVAQVHAAQLKT----------GEEVVVKVIRPGLKPIIAQDL
UBIB_PSEF5      KISDVFSRFDIEPLASASVAQVHAAKLKT----------GEEVVVKVIRPGLKPIIAQDL
UBIB_PSEU2      RICDVFSRFDEKPLASASVAQVHAACLKT----------GEEVVVKVVRPGLKPIIGQDL
UBIB_PSESM      RICDVFSRFDETPLASASVAQVHAACLKT----------GEEVVVKVVRPGLKPIIGQDL
UBIB_PSE14      RICDVFSRFDETPLASASVAQVHAACLKT----------GEEVVVKVVRPGLKPVIGQDL
UBIB_MARHV      PVSELFAEFSPDPMASASVAQVHAATLPN----------GQKVVVKVLRPGIEKVIRQDL
UBIB_HAHCH      PVSELFADFQTYPMASASIAQVHAATLKN----------GKEVVVKVIRPGIEKTIRLDI
UBIB_XYLFA      SVESAFAHFDTVPLASASISQVHAATLHD----------GREVVVKVLRPDIEHQISDDI
UBIB_XYLFT      SVESAFAHFDTVPLASASISQVHAATLHD----------RRAVVVKVLRPDIEHQISDDI
UBIB_XANC8      PVSVAFAAFDTTPLASASIAQVHAATLPPDANG-----LRREVVVKVLRPDIERQIDADI
UBIB_XANCP      PVSVAFAAFDTTPLASASIAQVHAATLPPDANG-----LRREVVVKVLRPDIERQIDADI
UBIB_XANOR      PVSVAFASFDTVPLASASIAQVHAATLPPDANG-----VRREVVVKVLRPEIERQIDADI
UBIB_XANOM      PVSVAFASFDTVPLASASIAQVHAATLPPDANG-----VRREVVVKVLRPEIERQIDADI
UBIB_XANC5      PVSVAFASFDTVPLASASIAQVHAATLPPDANG-----VRREVVVKVLRPDIERQIDADI
UBIB_XANAC      PVSVAFASFDTVPLASASIAQVHAATLPPDANG-----VRREVVVKVLRPEIERQIDADI
                 :   :  *.  .:****::*** . :               :.:*::** :   :  *:

UBIB_BURPS      ALMRDIATWAERLWADGRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLL
UBIB_BURMA      ALMRDIATWAERLWADGRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLL
UBIB_RALSO      ALMRDVATWMEKLWADGKRLKPREVVAEFDKYLHDELDLMREAANASQLRRNFAKSELLL
UBIB_NEIMB      SLMRFGAGWVERLFADGKRLKPREVVAEFDKYLHDELDLMREAANASQLGRNFQNSDMLI
UBIB_NEIMA      SLMRFGAAWVERLFSDGRRLKPLEVVAEFDKYLHDELDLMREAANAGQLGRNFHNSNMLI
UBIB_CHRVO      SLMRTLAGWVEKLFADGKRLKPREVVAEFDKYLHDELDMMHEAANASQLRRNFKGSDMLI
UBIB_PROST      KLMYRIANWVP-LLPDGRRLRPKEVVREYEKTLIDELNLLRESANAIQLRRNFENSSMLY
UBIB_PHOLL      RLMYRLANWVPMLLPDGRRLRPREVVREYEKTLIDELNLLREAANAIQLRRNFENSSTLY
UBIB_YERPP      RLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLY
UBIB_YERPA      RLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLY
UBIB_YERPN      RLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLY
UBIB_YERPE      RLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLY
UBIB_YERP3      RLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLY
UBIB_YERPS      RLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLY
UBIB_YERE8      RLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLY
UBIB_SERP5      RLMYRLAAWVPKLMPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFDGSPMLY
UBIB_SHIBS      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_SHIDS      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_SHIF8      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECO24      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_SHIFL      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECOHS      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECOLI      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECO57      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECOLC      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECOL5      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECOK1      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECOUT      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_ECOL6      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_SHISS      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLY
UBIB_SALTI      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLY
UBIB_SALPA      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLY
UBIB_SALCH      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLY
UBIB_SALPB      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLY
UBIB_SALTY      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLY
UBIB_CITK8      KLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLY
UBIB_ENT38      KLIYRLARWVPRLLPDGRRLRPMEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLY
UBIB_KLEP7      KLIYRLARWVPRLLPDGRRLRPQEVVREYEKTLLDELNLLRESANAIQLRRNFEDSPMLY
UBIB_CROS8      KLIYRLARWVPRLLPDGRRLRPMEVVREYEKTLLDELDLLREAANAIQLRRNFENSPMLY
UBIB_PECAS      RLMKRLAGWLPRLLPDGRRLRPREVVMEYEKTLLDELNLLREAANAIQLRRNFENSPMLY
UBIB_SODGM      RLMYRLASWVPHLLPDGRRLRPVEVVLEYEKTLLDELNLLREAANAIQLRRNFDGSPMLY
UBIB_VIBCH      KLMYRVARIVAKALPEARRLKPVEVVREYEKTLLDELDLRREAANAIQLRRNFENSEELY
UBIB_VIBC3      KLMYRVARIVAKALPEARRLKPVEVVREYEKTLLDELDLRREAANAIQLRRNFENSEELY
UBIB_VIBVU      KLMRRMARIVAKAMPEARRLKPIEVVREYEKTLLDELDLRREAANAIQLRRNFTDSEELY
UBIB_VIBVY      KLMRRMASIVAKAMPEARRLKPIEVVREYEKTLLDELDLRREAANAIQLRRNFTDSEELY
UBIB_VIBPA      KLMHRMARIVAGAMPEARRLKPVEVVREYEKTLLDELDLRREAANAIQLRRNFEGSEELY
UBIB_VIBCB      KLMHRMASIVAGAMPEARRLKPVEVVREYEKTLLDELDLRREAANAIQLRRNFEGSEELY
UBIB_ALIF1      RLMYRMARLVEQHIPEARRLKPVKVIEEYEKTLLDELDLRREASNAMQLRRNFEGSEELY
UBIB_PHOPR      KLMYRMAHIVARLLPEARLLRPVEVVREYEKTLLDELNMMREAANSIQLRRNFEDSDTLY
UBIB_AERHH      RLMQALARLVARFVPQSGRLRPIEVVEEYRKTILDELNLMREAANAIQLRRNFTGSEALY
UBIB_AERS4      RLMQTLARLVARFVPQSARLRPIEVVEEYRKTILDELNLMREAANAIQLRRNFTGSDALY
UBIB_PASMU      SLMYKVASWIPRIKAEGRRLRPVEVVREYEKNLRDELDLRREMANAIQLRANFENSPMLY
UBIB_HAES1      SWMYKLAGLLPKLFREGYRLRAVEVIQEYEKTLRDELDLRVEMANAIKLRENFLDSPMLY
UBIB_ACTP2      ALMYRLASWIPRLSNDAKRLRATEVVREYEKTLLDELDLTREMANAIRLRNNFENSEMLY
UBIB_HAEDU      ALMYQLAKLIPYLSDDAKRLRATEVVREYEKTLLDELDLTREMANAIRLRNNFENSEMLY
UBIB_SHESM      LLMSQTAKIIDYLLGEGNRLRPSEVIEDYRVTILGELNLKLEALNAIKLRNNFLDSDALY
UBIB_SHESR      LLMSQTAKVIDYLLGEGNRLRPSEVIEDYRVTILGELNLKLEALNAIKLRNNFLDSDALY
UBIB_SHESA      LLMSQTAKVIDYLLGEGNRLRPSEVIEDYRVTILGELNLKLEALNAIKLRNNFLDSDALY
UBIB_SHEB8      QLMSQTAKLIEYLLGEGNRLRPAEVIEDYRVTILGELNLKLEALNAVKLRNNFLDSDALY
UBIB_SHEB9      QLMSQTAKLIEYLLGEGNRLRPAEVIEDYRVTILGELNLKLEALNAVKLRNNFLDSDALY
UBIB_SHEB5      QLMSQTAKLIEYLLGEGNRLRPAEVIEDYRVTILGELNLKLEALNAVKLRNNFLDSDALY
UBIB_SHEPC      QLMSQTANLLEYFLGEGNRLRPAEVIEDYRVTILGELNLKLEALNAIKLRNNFLNSDALY
UBIB_SHESW      QLMSQTANLLEYFLGEGNRLRPAEVIEDYRVTILGELNLKLEALNAIKLRNNFLNSDALY
UBIB_SHEAM      ELMLQVATWVNRLLGEGNRLRPVEVVEDYQNTILGELNLKLEALNATKLRNNFLDSDALY
UBIB_SHEPA      LLMSQAADFLERLLGANNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFIDSNALY
UBIB_SHEHH      LLMSQAADFLETLLGTNNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFIDSNALY
UBIB_SHELP      LLMTQSAQVLETLLGHGNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFIDSGALY
UBIB_PSEAE      AWLFILARLAERVSSEARRLHPVEVVSDYEKTIVDELDLLREAANASQLRRNFEGSPLLY
UBIB_PSEAB      AWLFILARLAERVSSEARRLHPVEVVSDYEKTIVDELDLLREAANASQLRRNFEGSPLLY
UBIB_PSEA7      AWLFILARLAERVSSEARRLHPVEVVSDYEKTIVDELDLLREAANASQLRRNFEGSPLLY
UBIB_PSEMY      AWLFLLARIAERASADARRLRPVEVVSDYEKTIFDELDLLREAANASQLRRNFEGSPLLY
UBIB_PSEPG      AWLFLIAKAAERASADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEGSELMY
UBIB_PSEP1      AWLFLIAKAAERASADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEDSELMY
UBIB_PSEE4      AWLFLIAKAAERASADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEGSELMY
UBIB_PSEPF      AWLFILARAAEKVSADARLLHPVDVVSDYEKTIYDELDLLREAANASQLKRNFEGSPLLY
UBIB_PSEF5      AWLFILARAAEKLSADARLLHPVDVVSDYEKTIYDELDLLREAANASQLKRNFEGSPLLY
UBIB_PSEU2      AWLFILARMAERVSADARLLHPVQVVMDYEKTIYDELDLLREAANASQLRRNFEGSDLLY
UBIB_PSESM      AWLFILARMAERVSADARLLHPVQVVMDYEKTIYDELDLLREAANSSQLRRNFEGSDLLY
UBIB_PSE14      AWLFILARMAERVSADARLLHPVQVVMDYEKTIYDELDLLREAANSSQLRRNFEGSDLLY
UBIB_MARHV      GLMYLMAGLLEKYWSEGKRLHPVEVVADYDSTIHDELDLQREAANASQLRRNFENSPLIY
UBIB_HAHCH      ALMLLVARLVENYWEDGKRLHPVEVVKDYEHTIIDELDLQREAANTSQLKRNFAGSELIY
UBIB_XYLFA      ALLKSLATLVEHTHPNADKIRPCEIVAEIETTLAAELDLQREGANASVLRRFWEASDDIY
UBIB_XYLFT      ALLKSLATLVEHTHPNADKIRPREIVAEIETTLAAELDLQREGANASVLRRFWEASDDIY
UBIB_XANC8      ALLHSLATLVERTHPRADKIRPREVVAEIEGTLSAELDLQREGANASVLRRFWEGSDDLY
UBIB_XANCP      ALLHSLATLVERTHPRADKIRPREVVAEIEGTLSAELDLQREGANASVLRRFWEGSDDLY
UBIB_XANOR      ALLHSLATLVERTHPRADKIRPREVVAEIEGTLSAELDLQREGANASVLRRFWEGSDDLY
UBIB_XANOM      ALLHSLATLVERTHPRADKIRPREVVAEIEGTLSAELDLQREGANASVLRRFWEGSDDLY
UBIB_XANC5      ALLHSLATLVERTHPRADKIRPREVVAEIEGTLAAELDLQREGANASVLRRFWEGSDDLY
UBIB_XANAC      ALLHSLATLVERTHPRADKIRPREVVAEIEGTLAAELDLQREGANASVLRRFWEGSDDLY
                  :   *            ::. .:: :    :  **::  *  *   *   :     : 

UBIB_BURPS      VPEMFWDYSTPAVLVMERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGFFHA
UBIB_BURMA      VPEMFWDYSTPAVLVMERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGFFHA
UBIB_RALSO      VPEVFWDWCTSEVFVMERMHGVRVSHADELRAAGVDTHKLARDGVEIFFTQVFRDGFFHA
UBIB_NEIMB      VPKVFYDYCTSDVLTIEWMDGTPVSDIAKLKADGIDLHKLADYGVEIFFTQVFRDGFFHA
UBIB_NEIMA      VPKVFYDYCTSDVLTIEWMDGTPVADIAKLKADGIDLHKLADYGVEIFFTQVFRDGFFHA
UBIB_CHRVO      VPEVFYDYSSREVLTLEWMHGIPVGQIERLREAGVDLQKLSRFGVEIFFTQVFRHGFFHA
UBIB_PROST      VPEVYADYCRENVMVMERIYGIPVSDIAALKAQGTNMKILAERGVKVFFTQVFRDSFFHA
UBIB_PHOLL      VPEIYSDYCRENVLVMERVYGIPVSDIEALEAQNTNMRLLAERGVQVFFTQVFRDSFFHA
UBIB_YERPP      IPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_YERPA      IPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_YERPN      IPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_YERPE      IPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_YERP3      IPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_YERPS      IPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_YERE8      IPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SERP5      VPEVYSDYCRESVLVMERIYGIPVSDIPTLEKQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SHIBS      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SHIDS      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SHIF8      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECO24      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SHIFL      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECOHS      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECOLI      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECO57      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECOLC      IPEVYPDYCSEGMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECOL5      IPEVYPDYCSEGMMVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECOK1      IPEVYPDYCSEGMMVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECOUT      IPEVYPDYCSEGMMVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ECOL6      IPEVYPDYCSEGMMVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SHISS      IPEVYPDYCSEGMMVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SALTI      IPEVYSDYCSQNMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHA
UBIB_SALPA      IPEVYSDYCSQNMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHA
UBIB_SALCH      IPEVYSDYCSQNMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHA
UBIB_SALPB      IPEVYSDYCSQNMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHA
UBIB_SALTY      IPEVYSDYCSQNMMVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHA
UBIB_CITK8      VPEVYSDYCSQDMMVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ENT38      VPEVYSDYCSQNMMVMERIYGIPVSDIVALENQGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_KLEP7      VPEVYPDYCSESMMVMERIYGIPVSDVEALEAQGTNMQLLAERGVQVFFTQVFRDSFFHA
UBIB_CROS8      VPEVYSDYCSPTMMVMERIYGIPVNDVAALEANGTDMKLLAERGVQVFFTQVFRDSFFHG
UBIB_PECAS      VPEIYSDYCRESMLVMERIYGIPVSDVDALKANGTDMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SODGM      IPEVYPDYCSETMMVMERIYGVPVNDVAALEKQGTNMKLLAERGVQVFFTQVFRDSFFHG
UBIB_VIBCH      VPEVLTDFCNETVMVSERIYGIQVSDLAGLHANGTNMKLLAERGVSVFFTQVFRDSFFHA
UBIB_VIBC3      VPEVLTDFCNETVMVSERIYGIQVSDLAGLHANGTNMKLLAERGVSVFFTQVFRDSFFHA
UBIB_VIBVU      VPEVYPDFSNETVMVSERIYGIQVSDIAGLKANGTNMKLLAERGVSVFFTQVFRDSFFHA
UBIB_VIBVY      VPEVYPDFSNETVMVSERIYGIQVSDITGLKANGTNMKLLAERGVSVFFTQVFRDSFFHA
UBIB_VIBPA      VPEVFPDFSNETVMVSERIYGIQVSDIEGLEANGTNMKLLAERGVSVFFTQVFRDSFFHA
UBIB_VIBCB      VPEVFPDFSNETVMVSERIYGIQVSDIEGLEANGTNMKLLAERGVSVFFTQVFRDSFFHA
UBIB_ALIF1      VPEVILDLSSEHLMVSERIYGIQVSDIEQLERNGTNMKLLAERGVSVFFTQVFRDSFFHA
UBIB_PHOPR      VPEMFTDYSSTNLLVMERIYGIQVSDIDALIANGTNMKLLSENAVNIFFTQVFRDSFFHA
UBIB_AERHH      VPEVFTEHCREQVLVMERIYGIPVSDIAALEANGTNMKLLAERGVEVFFTQVFRDSFFHA
UBIB_AERS4      VPEVFTEHCREHVLVMERIYGIPVSDIPALEANGTNMKLLAERGVEVFFTQVFRDSFFHA
UBIB_PASMU      IPEMYKQFCHQTVIVMERIYGIPVSNIEELHANGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_HAES1      IPKMYEAFCHKNVIVMERIYGIPVSDVETLQRNGTDMKLLAERGVQVFFTQVFRDSFFHA
UBIB_ACTP2      VPEMYQDFCHKNVIVMERIYGIPVSDVETLKANGTDMKLLAERGVQVFFTQVFRDSFFHA
UBIB_HAEDU      VPAMYPDFCHKNVIVMERIYGIPVSDIATLTENGTNMKLLAERGVQVFFTQVFRDSFFHA
UBIB_SHESM      IPYVYEEFCYPRLMVMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHESR      IPYVYEEFCYPRLMVMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHESA      IPYVYEEFCYPRLMVMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHEB8      VPYVYEEFCYPRLMVMERIYGISVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHEB9      VPYVYEEFCYPRLMVMERIYGISVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHEB5      VPYVYEEFCYPRLMVMERIYGISVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHEPC      VPYVYEEFCYPRLMVMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHESW      VPYVYEEFCYPRLMVMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHA
UBIB_SHEAM      IPYVYEELCHPRLMVMERIDGIPVSDIEALNAQGTNLKLLAERGVELFFTQVFRDNFFHA
UBIB_SHEPA      IPYMYEELCFTRLIVMERIDGIPVSDKVALEAQGTNLKLLAERGVELFFTQVFRDNFFHA
UBIB_SHEHH      IPYMYEELCFTRLIVMERIDGIPVSDKVALEAQGTNLKLLAERGVELFFTQVFRDNFFHA
UBIB_SHELP      IPKMYEEFCFTRLIVMERIYGVPVSDRAALEAQGTNLKLLAERGVELFFTQVFRDNFFHA
UBIB_PSEAE      VPQVYWDWCRPKVLVMERIYGIPVTDLETLRDQRTDFKALAERGVEIFFTQVFRDSFFHA
UBIB_PSEAB      VPQVYWDWCRPKVLVMERIYGIPVTDLETLRDQRTDFKALAERGVEIFFTQVFRDSFFHA
UBIB_PSEA7      VPQVYWDWCRPKVLVMERIYGIPVTDLETLRDQRTDFKALAERGVEIFFTQVFRDSFFHA
UBIB_PSEMY      VPQVYWDLCRHQVLVMERIYGVPVTDLATLADQRTDMKLLAERGVEIFFTQVFRDSFFHA
UBIB_PSEPG      VPQVYWDLCRPKVLVMERIYGVPVTDMVTLADQRTDMKLLAERGVEVFFTQVFRDSFFHA
UBIB_PSEP1      VPQVYWDLCRPKVLVMERIYGVPVTDMATLADQRTDMKLLAERGVEVFFTQVFRDSFFHA
UBIB_PSEE4      VPQVYWDLCRPKVLVMERIYGVPVTDMATLADQRTDMKMLAERGVEVFFTQVFRDSFFHA
UBIB_PSEPF      VPQVYWDWCRPKVLVMERIYGIQVTDLATLADQRTDMKMLAERGVEIFFTQVFRDSFFHA
UBIB_PSEF5      VPQVYWDWCRPKVLVMERIYGIQVTDLATLADQRTDMKMLAERGVEIFFTQVFRDSFFHA
UBIB_PSEU2      VPQVYWDWCRPKVLVMERIYGLQVTDMAGLADQRTDMKLLAERGVEIFFTQIFRDSFFHA
UBIB_PSESM      VPQVYWDWCRPKVLVMERIYGLQVTDMAGLADQRTDMKMLAERGVEIFFTQIFRDSFFHA
UBIB_PSE14      VPQVYWDWCRPKVLVMERIYGLQVTDMAGLADQRTDMKLLAERGVEIFFTQIFRDSFFHA
UBIB_MARHV      IPFIDWDYTRKSVLVMERIHGIPIADVPALEKAGVNMRVLAEKGVEIFFTQVFRDSFFHA
UBIB_HAHCH      IPEVYWEMTHSRVLVMERIYGVPIADVEQLRKANVNMKLLAERGVEIFFTQVFRDSFFHA
UBIB_XYLFA      VPEVIWSHTAEQVLTLERMYGIPSDDIALLDASGIDRKALSSKGIRVFYTQVFRDNFFHA
UBIB_XYLFT      VPEVIWSHTAERVLTLERMYGIPSDDIALLDASGIDRKALSSKGIRVFYTQVFRDNFFHA
UBIB_XANC8      VPEVIWSHTAERALTLERVYGIPSDDVAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHA
UBIB_XANCP      VPEVIWSHTAERALTLERVYGIPSDDVAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHA
UBIB_XANOR      VPEVIWSHTAERALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHA
UBIB_XANOM      VPEVIWSHTAERALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHA
UBIB_XANC5      VPEVIWSHTAERALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHA
UBIB_XANAC      VPEVIWSHTAERALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHA
                :* :         :. * : *    .   *     :   *:  .: :*:**:**..***.

UBIB_BURPS      DMHPGNIQVSLDPKH--FGRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATLHL
UBIB_BURMA      DMHPGNIQVSLDPKH--FGRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATLHL
UBIB_RALSO      DMHPGNILVSVAPES--LGRYIALDFGIVGALSEFDKNYLAQNFLAFFQRDYHRVALLHV
UBIB_NEIMB      DMHPGNILVAAD------NRYIALDFGIVGTLTDYDKRYLAINFLAFFNRDYRRVATAHI
UBIB_NEIMA      DMHPGNILVAAD------NRYIALDFGIVGTLTDYDKRYLAINFLAFFNRDYRRVATAHI
UBIB_CHRVO      DMHPGNIFVAAD------GRYIALDFGIVGSLTDTDKHYLAVNFLAFFNRDYHRVATAHI
UBIB_PROST      DMHPGNIFVSYEHPE--DPLYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_PHOLL      DMHPGNIFVSYEHPE--DPFYIGIDYGIVGSLNKDDKRYLAENFIAFFNRDYRKVAELHV
UBIB_YERPP      DMHPGNIFVSYEHPH--DPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHV
UBIB_YERPA      DMHPGNIFVSYEHPH--DPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHV
UBIB_YERPN      DMHPGNIFVSYEHPH--DPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHV
UBIB_YERPE      DMHPGNIFVSYEHPH--DPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHV
UBIB_YERP3      DMHPGNIFVSYEHPH--DPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHV
UBIB_YERPS      DMHPGNIFVSYEHPH--DPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHV
UBIB_YERE8      DMHPGNIFVSYEHPH--DPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHV
UBIB_SERP5      DMHPGNIFVSYEHPE--DPCYIGIDCGIVGSLNKDDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SHIBS      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SHIDS      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SHIF8      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECO24      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SHIFL      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECOHS      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECOLI      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECO57      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECOLC      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECOL5      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECOK1      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECOUT      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ECOL6      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SHISS      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SALTI      DMHPGNIFVSHEHPE--NPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SALPA      DMHPGNIFVSHEHPE--NPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SALCH      DMHPGNIFVSHEHPE--NPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SALPB      DMHPGNIFVSHEHPE--NPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SALTY      DMHPGNIFVSHEHPE--NPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_CITK8      DMHPGNIFVSYEHPE--NPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_ENT38      DMHPGNIFVSYEHPE--DPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_KLEP7      DMHPGNIFVSYEHPE--DPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_CROS8      DMHPGNIFVSHDHPH--DPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRRVAELHV
UBIB_PECAS      DMHPGNIFISYDHPE--DPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_SODGM      DMHPGNIFVSFEHPE--NPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHV
UBIB_VIBCH      DMHPGNVFVNPNHPE--NPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAQLHV
UBIB_VIBC3      DMHPGNVFVNPNHPE--NPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAQLHV
UBIB_VIBVU      DMHPGNVFVNPEHPE--NPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAELHV
UBIB_VIBVY      DMHPGNVFVNPEHPE--NPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAELHV
UBIB_VIBPA      DMHPGNVFVKPEHPE--NPMWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAELHV
UBIB_VIBCB      DMHPGNVFVKPEHPE--NPMWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAELHV
UBIB_ALIF1      DMHPGNVFVNPDNPE--NPQWIGLDCGIVGTLNKEDKRYLAENLLGFFNSDYHKVAQLHV
UBIB_PHOPR      DMHPGNIFVSYENPE--TPQWIALDCGIVGTLNRDDKRYLAENLLAFFHRDYRKVAELHV
UBIB_AERHH      DMHPGNIFVSYEHPE--NPLWIGIDCGIVGTLNREDKRYLAENFLAFFNRDYRRVAELHV
UBIB_AERS4      DMHPGNIFVSYEHPD--NPLWIGIDCGIVGTLNREDKRYLAENFLAFFNRDYRRVAELHV
UBIB_PASMU      DMHPGNIFVNRAHPD--DPQYIGIDCGIVGRLNDHDKRYLAESFVAFFNRDYRRVAEMHV
UBIB_HAES1      DMHPGNIFVNPHYPE--NPQYIGIDCGIVGKLNESDKRYLAESFVAFFNRDYRRVAQMHV
UBIB_ACTP2      DMHAGNIFVNPNHPE--NPQYIGIDCGIVGTLNQNDKRYLAESFVAFFNRDYRRVALMHV
UBIB_HAEDU      DMHAGNIFVNPNHPE--DPQYIGIDCGIVGTLNQNDKRYLAESFVAFFNRDYRRVALMHI
UBIB_SHESM      DMHPGNIFISRDHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHESR      DMHPGNIFISRDHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHESA      DMHPGNIFISREHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHEB8      DMHPGNIFISRDHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHEB9      DMHPGNIFISRDHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHEB5      DMHPGNIFISRDHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHEPC      DMHPGNIFISRDHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHESW      DMHPGNIFISRDHPE--NPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYI
UBIB_SHEAM      DMHPGNIFISREHPE--NPFYIGLDCGIMGSLNEEDKRYLAENFLAFFNRDYHRIAQLYV
UBIB_SHEPA      DMHPGNVFVSREHPN--DPFYIGLDCGIMGTLTDEDKRYLAENFLAFFNRDYRRIAQLYI
UBIB_SHEHH      DMHPGNIFVSREHPN--DPLYIGLDCGIMGTLTEEDKRYLAENFLAFFNRDYRRIAQLYI
UBIB_SHELP      DMHPGNIFVSTEHPE--DPFYIGLDCGIMGTLTEQDKRYLAENFLAFFNRDYTRIAQLYI
UBIB_PSEAE      DMHPGNIFVSTRAPW--SPQYIAVDCGIVGSLTDEDQDYLARNLIAFFKRDYRKVAQLHI
UBIB_PSEAB      DMHPGNIFVSTRAPW--SPQYIAVDCGIVGSLTDEDQDYLARNLIAFFKRDYRKVAQLHI
UBIB_PSEA7      DMHPGNIFVSTRAPW--SPQYIAVDCGIVGSLTDEDQDYLARNLIAFFKRDYRKVAQLHI
UBIB_PSEMY      DMHPGNIFVSTRTPW--SPQYIAIDCGIIGSLTDEDQDYLARNLIAFFKRDYRKVAQLHI
UBIB_PSEPG      DMHPGNIFVSTVKPW--SPQYIAIDCGIVGSLTAEDQDYLARNLIAFFKRDYRRVAQLHI
UBIB_PSEP1      DMHPGNIFVSTVKPW--SPQYIAIDCGIVGSLTAEDQDYLARNLFAFFKRDYRRVAQLHI
UBIB_PSEE4      DMHPGNIFVSTVKPW--SPQYIAIDCGIVGSLTAEDQDYLARNLIAFFKRDYRRVAQLHI
UBIB_PSEPF      DMHPGNIFVSTVNPW--SPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHI
UBIB_PSEF5      DMHPGNIFVSTVQPW--SPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHI
UBIB_PSEU2      DMHPGNIFVSTVNPW--APKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHI
UBIB_PSESM      DMHPGNIFVSTVNPW--APKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHI
UBIB_PSE14      DMHPGNIFVSTVNPW--SPKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHI
UBIB_MARHV      DMHPGNIFVDVSNPA--DPKYIAIDFGIVGTLAPDDQSYLARNLLAFFRRDYRQVAQLHI
UBIB_HAHCH      DMHPGNIFVDVSNPA--NPRYIAIDCGIVGTLTPEDQSYLARNLLAFFRRDYRQVAVLHI
UBIB_XYLFA      DAHSGNIWVDSDPARKSNPRFIALDFGIMGQLSQKDQYYLAENFMAIFHKDYRRIAELHV
UBIB_XYLFT      DAHSGNIWVDSDPARKSNPRFIVLDFGIMGQLSQKDQYYLAENFMAIFHKDYRRIAELHV
UBIB_XANC8      DAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHV
UBIB_XANCP      DAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHV
UBIB_XANOR      DAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHV
UBIB_XANOM      DAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHV
UBIB_XANC5      DAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHV
UBIB_XANAC      DAHAGNIWVDSDPERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHV
                * *.**: :           :* :* **:* *   *: *** .:..:*. ** ::*  ::

UBIB_BURPS      ESGWVPPDTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLL
UBIB_BURMA      ESGWVPPDTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLL
UBIB_RALSO      ESGWAPEETRVEELEGAIRACCEPYFDRPLGEISLGLVLMRLFQTSRRFNVEVQPQLVLL
UBIB_NEIMB      ESGWVPADTRAEELEAAVRAVCEPVFNKPISQISFGLVLMRLFEVSRRFNVEIQPQLVLL
UBIB_NEIMA      ESGWVPADTRAEELEAAVRAVCEPVFNKPISQISFGLVLMRLFEVSRRFNVEIQPQLVLL
UBIB_CHRVO      ESGWVPRDTRAEELEAAVRTVCEPIFEKPLSEISFGMVLLRLFETSRRFNVEIQPQLVLL
UBIB_PROST      DSGWVPADTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_PHOLL      DSGWVPSDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMAVQPQLVLL
UBIB_YERPP      DSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_YERPA      DSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_YERPN      DSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_YERPE      DSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_YERP3      DSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_YERPS      DSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_YERE8      DSGWVPCDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SERP5      DSGWVPRDTNVEDFEFAIRTVCEPIFEKPLSEISFGNVLLNLFNTARRFNMEVQPQLVLL
UBIB_SHIBS      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SHIDS      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SHIF8      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECO24      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SHIFL      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECOHS      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECOLI      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECO57      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECOLC      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECOL5      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECOK1      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECOUT      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ECOL6      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SHISS      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SALTI      DSGWVPPDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SALPA      DSGWVPPDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SALCH      DSGWVPPDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SALPB      DSGWVPPDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SALTY      DSGWVPPDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_CITK8      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ENT38      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLSEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_KLEP7      DSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_CROS8      DSGWVPPDTNVEEFESAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_PECAS      DSGWVPPDTNVADFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_SODGM      DSGWVPPDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_VIBCH      DSGWVPLDTNVDEFEVAIRMVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_VIBC3      DSGWVPLDTNVDEFEVAIRMVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_VIBVU      DSGWVPADTNIDEFEFAIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_VIBVY      DSGWVPADTNIDEFEFAIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_VIBPA      DSGWVPADTNVDEFEFAIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_VIBCB      DSGWVPADTNVDEFEFAIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_ALIF1      DSGWVPADTNVEEFEFAIRMVCEPIFAKPLGEISFGHVLLNLFNTARRFNMEVQPQLVLL
UBIB_PHOPR      DSGWVPQDTNIDEFEFAIRTVCEPIFEKPLCDISFGHVLLNLFNTARRFDMEVQPQLMLL
UBIB_AERHH      ESGWVPPDTKVDEFEFAIRTVLEPIFEKPLSEISFGHVLLNLFNTARRFNMQVQPQLVLL
UBIB_AERS4      ESGWVPPDTKVDEFEFAIRTVLEPIFEKPLSEISFGHVLLNLFNTARRFNMAVQPQLVLL
UBIB_PASMU      ASGWTPKDTNIDDFEQAFREVCEPIFAKPLSEISFGHVLLNLFNVAREYNMEVQPQLVLL
UBIB_HAES1      DAGWTPQDTNIDDFEQAFREVCEPIFAKPLSEISFAQVLLNLFNVAREFNMQVQPQLVLL
UBIB_ACTP2      ESGWTPPDTDIDAFEQAFREVCEPIFAKPLSEISFGHVLLNLFNVAREFNMEVQPQLVLL
UBIB_HAEDU      ESGWTPADTDVDAFEEAFRTVCEPIFAKPLAEISFGQVLLNLFNVARQFNMEVQPQLVLL
UBIB_SHESM      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLL
UBIB_SHESR      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLL
UBIB_SHESA      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLL
UBIB_SHEB8      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLL
UBIB_SHEB9      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLL
UBIB_SHEB5      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLL
UBIB_SHEPC      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARSFDIVVQPQLVLL
UBIB_SHESW      ESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARSFDIVVQPQLVLL
UBIB_SHEAM      ESGWVSADTDILAFEQAVKLVCEPMFNKPLNEISFGHVLLELFRTARRFDIVVQPQLVLL
UBIB_SHEPA      ESGWVSADTDVGAFEQAVKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLL
UBIB_SHEHH      ESGWVSPDTDVAAFEQAVKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLL
UBIB_SHELP      ESGWVAADTDLVAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLL
UBIB_PSEAE      DSGWVPAETKVNDFEAAIRTVCEPIFEKPLKDISFGQVLLRLFQTARRFNMEIQPQLVLL
UBIB_PSEAB      DSGWVPAETKVNDFEAAIRTVCEPIFEKPLKDISFGQVLLRLFQTARRFNMEIQPQLVLL
UBIB_PSEA7      DSGWVPAETKVNDFEAAIRTVCEPIFEKPLKDISFGQVLLRLFQTARRFNMEIQPQLVLL
UBIB_PSEMY      DSGWVPADTKVNEFEAAIRTVCEPIFEKPLKDISFGQLLLRLFQTARRFNMEVQPQLVLL
UBIB_PSEPG      DSGWVPAHTKVNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_PSEP1      DSGWVPANTKVNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_PSEE4      DSGWVPAQTKVNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_PSEPF      DSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_PSEF5      DSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_PSEU2      DSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_PSESM      DSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_PSE14      DSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLL
UBIB_MARHV      QSGWVPPETRVNEFEAAIRTVCEPIFERPLKDISFGHFLLRLFQTARRFNMEVQPQLVLL
UBIB_HAHCH      SSGWVPGHTRVNEFEAAIRTVCEPIFERPLKDISFGQFLMRLFQTARRFDMEVQPQLVLL
UBIB_XYLFA      EAGWIPPHVRIEELEAAARSVCEPYFTRPLSQISLAEVLMKLFHVARRYQLTLQPQLILL
UBIB_XYLFT      EAGWIPPHVRIEELEAAARSVCEPYFTRPLSQISLAEVMMKLFHVARRYQLTLQPQLILL
UBIB_XANC8      EAGWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAEVLIKLFRVAQRYELTLQPQLILL
UBIB_XANCP      EAGWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAEVLIKLFRVAQRYELTLQPQLILL
UBIB_XANOR      EAGWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYELTLQPQLILL
UBIB_XANOM      EAGWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYELTLQPQLILL
UBIB_XANC5      EAGWMPSNVRIDELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYELTLQPQLILL
UBIB_XANAC      EAGWMPSNVRIDELEAAARSVCEPYFNRPLSEISLAQVLIKLFRVAQRYELTLQPQLILL
                 :** . ..    :* * :   ** * :.: :**:. .::.** .:: ::: :****:**

UBIB_BURPS      QKTMLNVEGLGRSLDPELDLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTLPQLP
UBIB_BURMA      QKTMLNVEGLGRSLDPELDLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTLPQLP
UBIB_RALSO      QKTLLNVEGLGRQLDPDLDLWKTAKPFLERWMHEQIGWRGLVDRLKIEAPQWANMLPDFP
UBIB_NEIMB      QKTLLNIEGLGRQLDPDLDLWKTAKPFLVKWMNGQVGPKALWRNLKNEAPDWAQIIPSLP
UBIB_NEIMA      QKTLLNIEGLGRQLDPDLDLWKTAKPFLVKWMNGQVGPKALWRNLKNEAPDWAQIIPSLP
UBIB_CHRVO      QKTLLNIEGLGRQLDPELDLWDTAKPFLTKWMNEQIGWRGLLRTLKHEAPQWATTLPTLP
UBIB_PROST      QKTLLYIEGLGRQLYPQLDLWKTAKPFLEDWVHSQVGIPAITQALKEKAPYWAEKMPEIP
UBIB_PHOLL      QKTLLYVEGLGRQLYPQLDLWKTAKPFLEEWLHSQVGLPAVIRALKEKVPYWAEKLPELP
UBIB_YERPP      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELP
UBIB_YERPA      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELP
UBIB_YERPN      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELP
UBIB_YERPE      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELP
UBIB_YERP3      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELP
UBIB_YERPS      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELP
UBIB_YERE8      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELP
UBIB_SERP5      QKTLLYVEGLGRQLYPQLDLWTTAKPFLESWMRDQVGIPAVIRALKEKAPFWAEKLPELP
UBIB_SHIBS      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_SHIDS      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_SHIF8      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECO24      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_SHIFL      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECOHS      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECOLI      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECO57      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECOLC      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECOL5      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECOK1      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECOUT      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_ECOL6      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_SHISS      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELP
UBIB_SALTI      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIP
UBIB_SALPA      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIP
UBIB_SALCH      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIP
UBIB_SALPB      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIP
UBIB_SALTY      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIP
UBIB_CITK8      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIP
UBIB_ENT38      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGLPALVRSFKEKAPFWIEKMPEIP
UBIB_KLEP7      QKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALVRAFKDKAPFWIERMPEIP
UBIB_CROS8      QKTLLYIEGVGRQLYPQLDLWKTAKPFLESWIKDQVGFPALVRSFKEKAPFWAEKIPEIP
UBIB_PECAS      QKTLLYIEGVGRQLYPQLDLWKTAKPFLESWLKQQVGLPAVFRALKEKAPFWAEKLPEIP
UBIB_SODGM      QKTLLYIEGVGRQLYPQLDLWKTAKPFLEEWIKDQMGLPAILRALKEKAPYWAEKLPELP
UBIB_VIBCH      QKTLLYVEGLGRQLYPQLDLWQTAKPFLEKWMANQVGPQAFLHALKERAPLWFEKMPELP
UBIB_VIBC3      QKTLLYVEGLGRQLYPQLDLWQTAKPFLEKWMANQVGPQAFLHALKERAPLWFEKMPELP
UBIB_VIBVU      QKTLLYVEGLGRQLYPQLDLWETAKPFLEEWMMNQVGPKALINAIKDRAPYWAEKLPELP
UBIB_VIBVY      QKTLLYVEGLGRQLYPQLDLWETAKPFLEEWMMNQVGPKALINAIKDRAPYWAEKLPELP
UBIB_VIBPA      QKTLLYVEGLGRQLYPQLDLWETAKPFLEEWMMNQVGPQALVNSIKDRAPFWAEKLPELP
UBIB_VIBCB      QKTLLYVEGLGRQLYPQLDLWETAKPFLEEWMMNQVGPQALVNAIKDRAPFWAEKLPELP
UBIB_ALIF1      QKTLLYVEGLGRQLYPQLDLWATAKPFLETWMAKQVGPAAFVTALSEKAPFWAEKLPELP
UBIB_PHOPR      QKTLLYVEGLGRQLYPQLDLWITAKPFLEDWMSRQVGPQAIVEAVKSKAPFWAEKLPELP
UBIB_AERHH      QKTLLYVEGLGRQLYPQLDLWQTAKPYLENWMYQQVGPKAVWNAIKEKAPFWAEKLPELP
UBIB_AERS4      QKTLLYVEGLGRQLYPQLDLWQTAKPYLENWMHEQVGPKAVWNAIKEKAPFWAEKLPELP
UBIB_PASMU      QKTLLYIEGLGRQLYPQLDLWDTAKPFLQKWLDEQMGIKAFTKSVKQKLPYWREHLVDLP
UBIB_HAES1      QKTLLYIEGLGRQLYPQLDLWDTAKPFLQNWLNEQIGMKVTFKKLKAKLPYLQEHLPDFP
UBIB_ACTP2      QKTLLYIEGLGRQVYPQLDLWQTAKPFLQNWLNEQVGVKAILRDLKQRAPQFREHFAEFP
UBIB_HAEDU      QKTLLYIEGLGRQVYPALDLWQTAKPFLQKWLDQQVGFKAILRDLKQQAPQFREHFAQFP
UBIB_SHESM      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFP
UBIB_SHESR      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFP
UBIB_SHESA      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFP
UBIB_SHEB8      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMADQVGPKAMFKKVSTKLPYWADKLPEFP
UBIB_SHEB9      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMADQVGPKAMFKKVSTKLPYWADKLPEFP
UBIB_SHEB5      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMADQVGPKAMFKKVSTKLPYWADKLPEFP
UBIB_SHEPC      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFP
UBIB_SHESW      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFP
UBIB_SHEAM      EKTLLYIEGLGRQLYPQLDLWQTAKPFLERWMAEQVGPKAIFKKVQTNLPFWSDKLPEFP
UBIB_SHEPA      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMAAKVKQQLPYWAEHLPELP
UBIB_SHEHH      EKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKVMAAKVKQKLPYWAEHLPELP
UBIB_SHELP      EKTLLYIEGLGRQLYPQLDLWQTAKPFLESWMAEQMGPLGMAKKIKKQFPYWTDKLPELP
UBIB_PSEAE      QKTLLNIEGLGRQLYPELDLWATAQPFLERWMRERVSP----KQLLRNFQQQVEQVPHLS
UBIB_PSEAB      QKTLLNIEGLGRQLYPELDLWATAQPFLERWMRERVSP----KQLLRNFQQQVEQVPHLS
UBIB_PSEA7      QKTLLNIEGLGRQLYPELDLWATAQPFLERWMRERVSP----KQLLRNFQQQVEQVPHLS
UBIB_PSEMY      QKTLLNIEGLGRQLYPDLDLWSTAQPFLERWMRERVSP----LHLLRNLQQQAEQVPHLS
UBIB_PSEPG      QKTLLNIEGLGRQLYPDLDLWSTAKPFLERWMRDRYSP----KAVFGNIHGQVEQLPHLA
UBIB_PSEP1      QKTLLNIEGLGRQLYPDLDLWSTAKPYLERWMRDRYSP----KAVFGNLHSQVEQLPHLA
UBIB_PSEE4      QKTLLNIEGLGRQLYPDLDLWSTAKPFLERWMRERMSP----KAVIGNLYNQAEQLPHLA
UBIB_PSEPF      QKTLLNIEGLGRQLYPDLDLWNTAQPFLERWMRERVSP----KALLGNVQSQFEQLPHLA
UBIB_PSEF5      QKTLLNIEGLGRQLYPDLDLWNTAQPFLERWMRERVSP----KAVLGNIHSQIEQLPHLA
UBIB_PSEU2      QKTLLNIEGLGRQLYPELDLWSTAQPYLERWMRERVSP----KTLLGNLQSQVEQLPHIA
UBIB_PSESM      QKTLLNIEGLGRQLYPELDLWSTAQPYLERWMRERVSP----KTLLGNLQSQVEQLPHIA
UBIB_PSE14      QKTLLNIEGLGRQLYPDLDLWSTAQPYLERWMRERVSP----KTLFGNLQSQVEQLPHIA
UBIB_MARHV      QKTLLNVEGLGRQLYPDLDLWSTAQPFLEDWMRKRIGPSGLIKSLQNHLPSWLEQSPEMP
UBIB_HAHCH      QKTLLNIEGLGRQLYPDLDLWSTAQPFLENWMKQRIAPPGLLKAIKQHAPDWIEQTPELP
UBIB_XYLFA      QKTLLNIEGVGRQLDPELDIWVVARPVLERILRARYSPRHALKELNKRLPEIMTHAPDTP
UBIB_XYLFT      QKTLLNIEGVGRQLDPELDIWVVARPVLERILRARYSPRHALKELNKRLPEIMTHAPDTP
UBIB_XANC8      QKTLLNIEGVGRQLDPKLDIWAVARPVLERILRERYSPRRVLGELRKRLPEIMTHAPDMP
UBIB_XANCP      QKTLLNIEGVGRQLDPKLDIWAVARPVLERILRERYSPRRVLGELRKRLPEIMTHAPDMP
UBIB_XANOR      QKTLLNIEGVGRQLDPKLDIWAVARPVLERILRERYSPRRVLRELSKRLPEIMTHAPDMP
UBIB_XANOM      QKTLLNIEGVGRQLDPKLDIWAVARPVLERILRERYSPRRVLRELSKRLPEIMTHAPDMP
UBIB_XANC5      QKTLLNIEGVGRQLDPKLDIWAVARPVLERILRERYSPRRVLRELGKRLPEIMTHAPDMP
UBIB_XANAC      QKTLLNIEGVGRQLDPRLDIWAVARPVLERILRERYSPRRVLRELSKRLPEIMTHAPDMP
                :**:* :**:**.: * **:* .*:* *   :  : .       .  .           .

UBIB_BURPS      RLVHQALISHH-----------EAPRAISDDLIRQILVEQRRTNRLLQALLVFGLAVGAG
UBIB_BURMA      RLVHQALISHH-----------EAPRAISDDLIRQILVEQRRTNRLLQALLVFGLAVGAG
UBIB_RALSO      RLAHQILERHA-----------RDNGSAQTATLSALLAEQRRTNRLLSAALLFIGGFAVG
UBIB_NEIMB      RKISALIDENR-----------QQ--EMRDAYIHLVKVQQRQSLWLAVIAVVLLLILLLK
UBIB_NEIMA      RKISALIDENR-----------QQ--EMRDAYIHLVKVQQRQSLWLAVIAVVLLLILLLK
UBIB_CHRVO      RKLNEALGSAK-----------TD--LLVEGYIQLMREQKRQNFLLLLIAILLAALLAKS
UBIB_PROST      DLIYGALRQHK---------FLQSNIEQLSEQLKQQRNKQRKSQYLLGIGATLILCGSLF
UBIB_PHOLL      ELVYDSLQQHK---------HLQVSIEKLSGHLRGQQIKQRQSQYLLGVGATLFLCGSLF
UBIB_YERPP      ELVYDSLQQHK---------LLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTIL
UBIB_YERPA      ELVYDSLQQHK---------LLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTIL
UBIB_YERPN      ELVYDSLQQHK---------LLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTIL
UBIB_YERPE      ELVYDSLQQHK---------LLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTIL
UBIB_YERP3      ELVYDSLQQHK---------LLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTIL
UBIB_YERPS      ELVYDSLQQHK---------LLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTIL
UBIB_YERE8      ELVYDSLQQHK---------LLQQSVDKLTTQMQGQQQRQGQSRYLFGVGATLLVSGTIL
UBIB_SERP5      ELFYDSLQQHK---------LLQQSVDKLTNQMQAQRVRQGQSRYLFGVGATLLVSGTIL
UBIB_SHIBS      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_SHIDS      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_SHIF8      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECO24      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_SHIFL      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECOHS      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECOLI      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECO57      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECOLC      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECOL5      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECOK1      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECOUT      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_ECOL6      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_SHISS      ELVYDSLRQGK---------YLQHSVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFL
UBIB_SALTI      ELVYDSLRQGK---------YLQHSVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFL
UBIB_SALPA      ELVYDSLRQGK---------YLQHSVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFL
UBIB_SALCH      ELVYDSLRQGK---------YLQHSVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFL
UBIB_SALPB      ELVYDSLRQGK---------YLQHSVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFL
UBIB_SALTY      ELVYDSLRQGK---------YLQHSVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFL
UBIB_CITK8      ELVYDSLRQGK---------YLQHSVDKIARELQENHVRQGQSRYLLGIGATLLLSGTFL
UBIB_ENT38      ELIYDSLRHSK---------NLQHSMDKITRELQSNRVRQGQSRYLFGIGATLLLSGTLL
UBIB_KLEP7      ELVYQSLQQSK---------QLQTSVDTIVRDMRVRHVRQGQSRYLFGIGAVLLLSGTLL
UBIB_CROS8      ELVYNSLRQGK---------QLQQSVDKIAHELQEHRVKQGQSRYLFGIGATLMLSSTLL
UBIB_PECAS      ELFYDGLRQHK---------MLKQSVDKLAYELRTQQARQGQSRYLLGIGATLLIGGTLL
UBIB_SODGM      ELVYDGFKQHR---------LLQKSVDRLTVEMRVHHVRQSQSRFLFGIGATLLLIGTFL
UBIB_VIBCH      ELLYDSLKQGR---------NLNQRLDNLYQGYRQSKRQQGTGKFLFGVGATLVVCSAIW
UBIB_VIBC3      ELLYDSLKQGR---------NLNQRLDNLYQGYRQSKRQQGTGKFLFGVGATLVVCSAIW
UBIB_VIBVU      ELLYDSLKQGK---------AMNQRMDQLYQGYRASKRQQATGKFLFGVGATLVVCSAIL
UBIB_VIBVY      ELLYDSLKQGK---------AMNQRMDQLYQGYRASKRQQATGKFLFGVGATLVVCSAIL
UBIB_VIBPA      ELLYDSLKQGK---------AMNQRMDLLYQGYRQSKRQQATGKFLFGVGATLVVCSAIL
UBIB_VIBCB      ELLYDSLRQGK---------AMNQRMDQLYQGYRHSKRQQATGKFLFGVGATLVVCSAIL
UBIB_ALIF1      DLVYDSLRQGK---------VLNQRMDKLYAGYRQSKRQQAKGQFLFNVGATLLICSAVL
UBIB_PHOPR      ELLYDSLRQGK---------VMNQRIDKLYDNFMESRRSQGLARFYFGIGATLVVCSAIL
UBIB_AERHH      ELVYETLRQTR---------HQQRHFDQMFADFRRHSRRQGQARYLLGVGASLLLAGVFL
UBIB_AERS4      ELVYETLRQTR---------HQQRHFDQMFADFRRHSRRQGQARYLLGVGASLLLVGVFL
UBIB_PASMU      ENVMDALAQQK---------IIADELIHLNRTLAKKR-------------------NIPH
UBIB_HAES1      ETLMDALKQQK---------FISQQLVEINKKLAKQQRWQKKM-FVLIVGIVIFSVTLWQ
UBIB_ACTP2      EAVFNALQQQK---------QINFRLDELNKTLQAQGRQKSHN-VRSIVSGVIILGVLWR
UBIB_HAEDU      EAVFNALQQQK---------HINYRLAELNKTLQSQADNKTYN-VKMIIMGSIILSLLWQ
UBIB_SHESM      ELIYDNLKLGR---------KLLSSQQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLL
UBIB_SHESR      ELIYDNLKLGR---------KLLSSQQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLL
UBIB_SHESA      ELIYDNLKLGR---------KLLSSQQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLL
UBIB_SHEB8      ELIYDNLKLGR---------KLLSSQQQMLDKYLKYQQQAHKSNYLLITSAVLLICGTLL
UBIB_SHEB9      ELIYDNLKLGR---------KLLSSQQQMLDKYLKYQQQAHKSNYLLITSAVLLICGTLL
UBIB_SHEB5      ELIYDNLKLGR---------KLLSSQQQMLDKYLKYQQQAHKSNYLLITSAVLLICGTLL
UBIB_SHEPC      ELIYDNLKLGR---------KLLSSQQQMLDKYLKHQQQAHKSNYMLITSAVLLICGTLL
UBIB_SHESW      ELIYDNLKLGR---------KLLSSQQQMLDKYLKHQQQAHKSNYMLITSAVLLICGTLL
UBIB_SHEAM      ELIYDNLKLGR---------KLLGSQQQMLDRYLKYQQKAHKSNFLLITSAVLLICGTIL
UBIB_SHEPA      ELIYDNLKIGR---------DLSKNQNKLLDRYLKHQQKAHKSNYLLITSAILVICGTIL
UBIB_SHEHH      ELIYDNLKMGR---------NLSKNQNNLLDRYLKHQQKAHKSNYLLITSAILVICGTIL
UBIB_SHELP      ELVYDNLKMGK---------NFVNSQNQLLDRYLKQQQKAHKSNYLLITSAVLVICGSIL
UBIB_PSEAE      QMARDTLERLS-------QPHAHNAPPPEWKGSRHDWLGRLVGAVLLVGAAEVG------
UBIB_PSEAB      QMARDTLERLS-------QPHAHNAPPPEWKGSRHDWLGRLVGAVLLVGAAEVG------
UBIB_PSEA7      QMARDTLERLS-------QPHAHNAPPPEWKSSRHDWLGRLVGAVLLVGAAEVG------
UBIB_PSEMY      QIARDALERLQ-------RPE-----PPRESDARDQWPLRLLGAALIAAGAVQG------
UBIB_PSEPG      NMARDLLERLS-------QPHLNDPQLPERRRQGDRWALRLLGAGLLGGGAVLA-AGAAE
UBIB_PSEP1      GMTRDLLERLS-------QPHLHDPQLPERRRQGDRWALRLLGAGLLGGGAVLA-AGAAE
UBIB_PSEE4      DMTRDLLERLS-------QPHLNDAQLPERRRQGDNWALRLLGAGLLGGGATLA-AGAV-
UBIB_PSEPF      NMARDLLERMS-------QPHANDPPPPWKKRK-DDWFLRLLGSAHLAGGTILA-----A
UBIB_PSEF5      NMTRDLLERMS-------QPHAADPPAPWHKRK-DDWFLRLLGTAHLGGGAVLA-----A
UBIB_PSEU2      GMTRDLLERMS-------RPHASDPPRPWHDRK-DEPVLRLIGAALLVGGAIQGWVMSEA
UBIB_PSESM      GMTRDLLERMS-------RPHASDPPRPWHDRK-DEPVLRLIGAALLVGGAIQGWVMSEA
UBIB_PSE14      GMTRDLLERMS-------RPHASDPPRPWHERK-DEPVLRLIGAALLVGGAIQGWVMSEA
UBIB_MARHV      QLVHDALLQIRSSGPT-EAQNRATLALMKEQQLRSERRWRRGFIALVLAGAALVGSQPHA
UBIB_HAHCH      QILYEAFDQLRHLDRY-NQANQDSLASLSRAFEKDKQQRRDFWLAGLVLASAAAMAIGDQ
UBIB_XYLFA      RLIHTWLVQQVESRKQNDVYLQQIRALAMTLQGLQRRVVNAIVGSGLLVAAAVLYGLHPD
UBIB_XYLFT      RLIHTWLVQQVESRKQNDVYLQQIRALAMTLQGLQRRVVNAIVGSGLLVAAAVLYGLHPD
UBIB_XANC8      RLVHSWLKQQVEGRHQLDIRSSELRALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPD
UBIB_XANCP      RLVHSWLKQQVEGRHQLDIRSSELRALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPD
UBIB_XANOR      RLVHSWLKQQVEGRHQIDIRSTELLALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPD
UBIB_XANOM      RLVHSWLKQQVEGRHQIDIRSTELLALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPD
UBIB_XANC5      RLVHSWLKQQVEGRHQIDIRSPELLALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPD
UBIB_XANAC      RLVYSWLTQQVEGRHQIAIRSPELLALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPD
                      :                                                     

UBIB_BURPS      AVIARVLIVLAYGG---------------------
UBIB_BURMA      AVIARVLIVLAYGG---------------------
UBIB_RALSO      IIATHVLAWLARH----------------------
UBIB_NEIMB      -----------------------------------
UBIB_NEIMA      -----------------------------------
UBIB_CHRVO      LL---------------------------------
UBIB_PROST      FISASN--RMAIAFMSAGALSWIIGWYKSGKS---
UBIB_PHOLL      LLSGLA--NIPWLFIGAGTVSWLFGWCRLCKI---
UBIB_YERPP      FLADAT--EVSTGFIVAGALAWFIGWRRTC-----
UBIB_YERPA      FLADAT--EVSTGFIVAGALAWFIGWRRTC-----
UBIB_YERPN      FLADAT--EVSTGFIVAGALAWFIGWRRTC-----
UBIB_YERPE      FLADAT--EVSTGFIVAGALAWFIGWRRTC-----
UBIB_YERP3      FLADAT--EVSTGFIVAGALAWFIGWRRTC-----
UBIB_YERPS      FLADAT--EVSTGFIVAGALAWFIGWRRTC-----
UBIB_YERE8      FLANAV--EISIGFIVAGVLAWFIGWRRTS-----
UBIB_SERP5      LSGDVE--VFPAWLIAAGIVSWVIGWKRTT-----
UBIB_SHIBS      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_SHIDS      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_SHIF8      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECO24      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_SHIFL      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECOHS      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECOLI      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECO57      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECOLC      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECOL5      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECOK1      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECOUT      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_ECOL6      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_SHISS      LVSRPEWGLMPGWLMAGGLIAWFVGWRKTR-----
UBIB_SALTI      LVNRPEWGLMPGWLMVGGVVVWLVGWRKTR-----
UBIB_SALPA      LVNRPEWGLMPGWLMVGGVVVWLVGWRKTR-----
UBIB_SALCH      LVNRPEWGLMPGWLMVGGVVVWLVGWRKTR-----
UBIB_SALPB      LVNRPEWGLMPGWLMVGGVVVWLVGWRKTR-----
UBIB_SALTY      LVNRPEWGLMPGWLMVGGVVVWLVGWRKTR-----
UBIB_CITK8      LVSRPEWGLMPCWLMAGGLVAWLIGWRKTR-----
UBIB_ENT38      LINRPDWQMMPAWLMAGGLVVWLIGWRKTR-----
UBIB_KLEP7      FIHRPEWGMMPGWLMAGGVVTWLIGWRKTH-----
UBIB_CROS8      FINRPDWGMSPGWLMAGGILVWLIGWRRTD-----
UBIB_PECAS      LISRVEADMVPTGLIAAGIVAWIIGWRRTR-----
UBIB_SODGM      MTQGADEGSLPAWLMAAGTVSWIIGWKRTA-----
UBIB_VIBCH      ISNQLE--PLAIGSATIGVLCWLLSWRAYRQ----
UBIB_VIBC3      ISNQLE--PLAIGSATIGVLCWLLSWRAYRQ----
UBIB_VIBVU      VDHTYE--QLSLATAIAGVTFWLFSWRAYRR----
UBIB_VIBVY      VDHTYE--QLSLATAIAGVTFWLFSWRAYRR----
UBIB_VIBPA      VDNAYE--QLSMASGIAGVTFWLLSWRAYRQ----
UBIB_VIBCB      VDNAYE--QLSIASGIAGVTFWLLSWRAYRR----
UBIB_ALIF1      LTSNIT--VLASISAATGAAFWLFSWRAYRR----
UBIB_PHOPR      FSNHVE--TIPVASAAMGVTFWLLGWRACRK----
UBIB_AERHH      LTQKQHI-EWGQISLAGAGLCWLLGWLRTRSH---
UBIB_AERS4      LTQKQHI-EWGQISLAGAGLCWLLGWFKARSH---
UBIB_PASMU      FTSFIL--GLCTGL-----AIWLLIYLLS------
UBIB_HAES1      FAALPL--AISAGLFLVGFLVWLIGFLLP------
UBIB_ACTP2      FDDLPL--WLSCGTLVTVLLVLLLQRKS-------
UBIB_HAEDU      FNSLPL--WLSLPILTMLCLALCRRK---------
UBIB_SHESM      FNQDATL-WSPYVCLISGAALWIIGWRSRPKNRKF
UBIB_SHESR      FNQDATL-WSPYVCLISGAALWIIGWRSRPKNRKF
UBIB_SHESA      FNQDATL-WSPYVCLISGAVLWIIGWRSRPKNRKF
UBIB_SHEB8      INRDATL-WTPYVCLVSGIILWFVGWRSRPKNRKF
UBIB_SHEB9      INRDATL-WTPYVCLVSGIILWFVGWRSRPKNRKF
UBIB_SHEB5      INRDATL-WTPYVCLVSGIILWFVGWRSRPKNRKF
UBIB_SHEPC      FNQDATL-WSPYVCLTSGVLMWFIGWRSRPKNRKF
UBIB_SHESW      FNQDATL-WSPYVCLTSGVLMWFIGWRSRPKNRKF
UBIB_SHEAM      FAQTDTL-WLASACLGSGALVWGAGWRSRPKNRKF
UBIB_SHEPA      LNQDATL-WPSYGSIGIGITLWVLGWRSRPKNRKI
UBIB_SHEHH      INQDATL-WPSYGSIGTGIALWVLGWRSRPKNRKI
UBIB_SHELP      FSQNATL-WASYACIGIGATLWLLGWRSRPKNRKF
UBIB_PSEAE      --LGQQLEAWPAWVMLAGGVFLILRR---------
UBIB_PSEAB      --LGQQLEAWPAWVMLAGGVFLILRR---------
UBIB_PSEA7      --LGQQLEAWPAWVMLAGGVFLILRR---------
UBIB_PSEMY      --LAPLLATWPAWLMVGGGLYLVLRR---------
UBIB_PSEPG      AASLAAPAAWPAWLMLAAGLYLIVRQ---------
UBIB_PSEP1      TASLAAPAAWPAWLMLAAGLYLIVRQ---------
UBIB_PSEE4      --SLSAPAAWPAWLMLAAGLYLIVRR---------
UBIB_PSEPF      GGPLHELGHWPAGIMVAVGLYLVVRR---------
UBIB_PSEF5      GGPLHELGHWPAGIMIAVGLYLIVRR---------
UBIB_PSEU2      ATQLLTLTAWPAAIMLIAGLYLIVRR---------
UBIB_PSESM      ATQLLTLTAWPAAIMLIAGLYLIVRR---------
UBIB_PSE14      ATQLLTLTAWPAAIMLIAGLYLIVRR---------
UBIB_MARHV      GQWLADLPVWSWALLAGAAGVMLRGSR--------
UBIB_HAHCH      PLRLTELP-WPSVMLAVAGLYLLMRPK--------
UBIB_XYLFA      GLYLGAIPVWSLISGCVGALALFSAWWRS------
UBIB_XYLFT      GLYLGTIPVWSLISGCIGALALFSAWWRS------
UBIB_XANC8      GWYLGTVPVWSWISGGAGSAALLIAWLRR------
UBIB_XANCP      GWYLGTVPVWSWISGGAGSAALLIAWLRR------
UBIB_XANOR      GWYLGTVPVWSWISGGAGSAALLVAWLRR------
UBIB_XANOM      GWYLGTVPVWSWISGGAGSAALLVAWLRR------
UBIB_XANC5      GWYLGTVPVWSWISGGAGSAALLVAWLRR------
UBIB_XANAC      GWYLGTVPVWSWISGGAGSAALLVAWLRR------