CLUSTAL format seed alignment for MF_00417

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PCP_BACAM       MEKKVLLTGFDPFGGETVNPSWEAVKRLNGA-AEGPASIVSEQVPTVFYKSLAVLREAIK
PCP_BACSU       MRKKVLITGFDPFDKETVNPSWEAAKRLNGF-ETEEAIITAEQIPTVFRSALDTLRQAIQ
PCP_STRCO       -MTRVLITGFAPFGGERVNPSWQAASLVAAE-PPAGLAVTAAELPCVFGESLDALRDAIR
PCP_LACLM       --MKILVTGFDPFGDDKINPAIEAVKRLPD--EIAGAQIVKLEIPTKFNVSADVVKDAIA
PCP_STRP1       --MKILVTGFDPFGGEAINPALEAIKKLPA--TIHGAEIKCIEVPTVFQKSADVLQQHIE
PCP_STAAU       --MHILVTGFAPFDNQDINPSWEAVTQLEN--IIGTHTIDKLKLPTSFKKVDTIINKTLA
PCP_PSEFL       -MRIVLLTGFEPFDQDPVNPSWEAVRQLDGVQLGSDVKIVARRLPCAFATAGECLTRLID
PCP_DEIRA       -MPTLLLTGFEPFHTHPDNPSAQAAQELHGLELPGGWGVHSALLPVEPHAAGAALTRLLS
PCP_PYRAB       --MKVLVTGFEPFGGDDKNPTMEIVKFLDGK-EIGGAKVIGRVLPVSFKRARKELVAILD
PCP_PYRHO       --MKILLTGFEPFGGDDKNPTMDIVEALSER----IPEVVGEILPVSFKRAREKLLKVLD
PCP_THELN       -MKKVLITGFEPFGGDSKNPTEQIAKYFDRK-QIGNAMVYGRVLPVSVKRATIELKRYLE
PCP_PYRFU       --MKVLVTGFEPFGGEKINPTERIAKDLDGI-KIGDAQVFGRVLPVVFGKAKEVLEKTLE
PCP_MYCTU       -MSKVLVTGFGPYGVTPVNPAQLTAEELDGR-TIAGATVISRIVPNTFFESIAAAQQAIA
PCP1_SACS2      --MTVLLFGFEPFLEYKENPSQLIVEALNRS-TILKEEVKGVILPVEYKKIEDVIVTKIR
PCP2_SACS2      --MTVLLFGFEPFLEYKENPSQLIVEALNGS-TILKEEVKGVILPVEYEKIEDLIVTKIR
PCP_BACHD       MGNIILLTGFQPFLDYSINPTEAIVKELNGR-KIGEYEVRGVILPVSFRESGDLLLHHFQ
                    :*: ** *:     **:      .          :    :*             : 

PCP_BACAM       KHQPDIIICVGQAGGRMQITPERVAINLNEAR---IPDNEGNQPVGEDISQGGPAAYWTG
PCP_BACSU       KHQPDIVICVGQAGGRMQITPERVAINLADAR---IPDNEGHQPIDEEISPDGPAAYWTR
PCP_STRCO       ADNPDLVLCLGQAGGRPGVTVERVGINVDDAR---IPDNAGGQPIDEPVVPDGPAAYFST
PCP_LACLM       KEKPDYVLSIGQAGGRFELTPERVAINLDDGR---IQDNAGYQPLNHTIHGDDENAYFTQ
PCP_STRP1       SFQPDAVLCIGQAGGRTGLTPERVAINQDDAR---IPDNEGNQPIDTPIRADGKAAYFST
PCP_STAAU       SNHYDVVLAIGQAGGRNAITPERVAINIDDAR---IPDNDDFQPIDQAIHLDGAPRYFSN
PCP_PSEFL       ELHPAMVIATGLGPGRSDISVERVAININDAR---IPDNLGEQPIDTAVVADGPAAFFTT
PCP_DEIRA       EQDPGAVLLTGLAAGRPQVTLERVGVGVMDFQ---IPDNAGQTYRDQPIEPDAPAAYLAT
PCP_PYRAB       EIKPDVTINLGLAPGRTHISVERVAVNIIDAR---IPDNDGEKPIDEPIVENGPAAYFAT
PCP_PYRHO       DVRPDITINLGLAPGRTHISVERVAVNMIDAR---IPDNDGEQPKDEPIVEGGPAAYFAT
PCP_THELN       EIKPEIVINLGLAPTYSNITVERIAVNIIDAR---IPDNDGYQPIDEKIEEDAPLAYMAT
PCP_PYRFU       EIKPDIAIHVGLAPGRSAISIERIAVNAIDAR---IPDNEGKKIEDEPIVPGAPTAYFST
PCP_MYCTU       EIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVGEPTDPAGPVAYHAT
PCP1_SACS2      ETKPILTLGIGLAPGRAKITPEKIAINYRYSREG---DNAGKKYRGEKIDPLGQDGIFTN
PCP2_SACS2      EMKPILTLGIGVAPGRAKITPEKIAINYKYSREG---DNAGKKYKGEKIDPLGQDGIFTN
PCP_BACHD       TVQPTAVFMLGLAAGRGKITPERVAININSGPE----DRDGIAPVDEPIRQGGPAAYFST
                       :  *       :: *::. .          *  .    .            : 

PCP_BACAM       LPIKRIVEEIKKEGIPAAVSYTAGTFVCNHLFYGLMDEISRH-HPHIRGGFIHIPYIPEQ
PCP_BACSU       LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRT-SPHIRGGFIHIPYIPQQ
PCP_STRCO       LPVKACVAAMREAGVPAAVSNTAGTFVCNHVAYGLGHLIATE-FPHLRGGFAHVPWAPEQ
PCP_LACLM       LPIKAMAKAIREAGVPSAVSNTAGTYVCNHIFYQVQYMRDKM-FPDIKAGFMHIPFLPEQ
PCP_STRP1       LPIKAMVAAIHQAGLPASVSNTAGTFVCNHLMYQALYLVDKY-CPNAKAGFMHIPFMMEQ
PCP_STAAU       LPVKAMTQSVINQGLPGALSNSAGTFVCNHVLYHLGYLQDKH-YPHLRFGFIHVPYIPEQ
PCP_PSEFL       LPIKAMVKAVREAGIAASVSQTAGTFVCNQVFYLLQHALAG---SGVRSGFIHVPFLPEQ
PCP_DEIRA       LPLRAILAAWREAEIPGDISNSAGLYVCNFVLYHALHWLREHGRGAVPCGFLHVPANAAV
PCP_PYRAB       IPTREIVEEMKRNNIPAVLSYTAGTYLCNFVMYLTLHHSATK-GYPRKAGFIHVPYTPDQ
PCP_PYRHO       IPTREIVEEMKKNGIPAVLSYTAGTYLCNFAMYLTLHTSATK-GYPKIAGFIHVPYTPDQ
PCP_THELN       LPVRAITKTLRDNGIPATISYSAGTYLCNYVMFKTLHFSKIE-GYPLKAGFIHVPYTPDQ
PCP_PYRFU       LPIKKIMKKLHERGIPAYISNSAGLYLCNYVMYLSLHHSATK-GYPKMSGFIHVPYIPEQ
PCP_MYCTU       VPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQK-GLPVRAGWIHLPCLPSV
PCP1_SACS2      IPVEDLVDLLNENGIPAELSLSAGSYLCNNAMYIIIREARKYNS---LGGFIHVPLHESY
PCP2_SACS2      IPVEDLVDLLNENGIPAELSLSAGSYLCNNAMYIIIREARKYNS---LGGFIHVPLHESY
PCP_BACHD       LPVRRLIQRLNEEGFPAEMSNSAGTYVCNHVMYRMLDYLHEKGSEQVAAGFVHLPASKEL
                :* .          ... :* :** ::**   :                *: *:*     

PCP_BACAM       TLQKS------APSLSLDHITKALK--IAAVTAAVHEDDIETGGGELH
PCP_BACSU       TIDKT------APSLSLDTIVRALR--IAAVTAAQYDEDVKSPGGTLH
PCP_STRCO       VPDGT------APALPPATVAHGLRALLAAAARTPAEQDLKVTEGATH
PCP_LACLM       VVTRPE-----TPALSLDDDVLGITAAIKAIVSRDGKGDIETIEGKDH
PCP_STRP1       VVDKPN-----TAAMNLDDITRGIEAAIFAIVDFKDRSDLKRVGGATH
PCP_STAAU       VVGKSD-----TPSMPLEQIVAGLTAAIEAISDHD---DLRIALGTTE
PCP_PSEFL       VAGSQ------RPSMALDAMVAGLQA--AVLTAWHTPVDVKEAGGQVS
PCP_DEIRA       ALAVPAD-RPPLPYLPQSEITRAVRVAAEAITAQSSVLQMGKM-----
PCP_PYRAB       VIEK-----KNTPSMSLELEIKGVEIAIRKSL----------------
PCP_PYRHO       VLEK-----KNTPSMSLDLEIKGVEIAIRVAQSALHSSQLR-------
PCP_THELN       VVNKFFLLGKNTPSMCLEAEIKAIELAVKVSLDYLEKDRDDIKIPL--
PCP_PYRFU       IIDKIGK-GQVPPSMCYEMELEAVKVAIEVALEELL------------
PCP_MYCTU       AALDHNL---GVPSMSVQTAVAGVTAGIEAAIRQSADIREPIPSRLQI
PCP1_SACS2      AARI----QRSIPSMSLDTMIRGIKLSIEFILTNKNKKENLTLS----
PCP2_SACS2      AARI----QRPIPSMSLDTMIRGIRLSMEFILTNK--KENLTFS----
PCP_BACHD       AAQ-----HHSLPSMDLKDLTRAVTLMIEEL-----------------
                            . :       .: