CLUSTAL format seed alignment for MF_00418

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DAPA_AZOPC       ---------MRQIVLRGMGVALITPFKCDG----TVDYPALSYLVDYQLQ-NGIDYLIVL
DAPA_BACV8       ---------MIQTRLKGMGVALITPFKEDD----SVDYDALLRLVDYQLQ-NGTDFLCVL
DAPA_PORG3       ---------MDRAQLRGMGVALITPFDEKG----EVDHESLRLLADYQVA-GGADYIVAL
DAPA_FLAJ1       -----------MQSLIGTGVALVTPFKKDF----SVDIEALQRVVNFSID-GGVEYLVVM
DAPA_GRAFK       -----------MEAFVGTGVALITPFKEDL----SIDTEALSNLVKYQIE-NGIEYLVVL
DAPA_SULMW       -----------MKNINGIGIALVTPFNKKG----EIDFISLEKIVSYVIN-EGVQYLVLL
DAPA_CYTH3       -----------MHTFYGTGTALITPFKKDH----SVDYDAFKNLIEFNIS-SGVDYIVVN
DAPA_KORVE       ------------MKLRGCGTALVTPFKQDG----SVDFAAQRALVEWQIE-SGIDFLVPC
DAPA_ACIC5       ------------MDLSGCGTALITPFRADE----SIDEPALRALVDWQIA-SGIDWLVAC
DAPA_CHLP8       ---------MSNRLISGSTVALVTPFKEDG----SVDYEALRRLVRFHRE-AGTDIILPC
DAPA_CHLPB       ---------MSKRKLSGSAVALVTPFRQDM----SVDREAIRRLVHFHIA-AGTDILIPC
DAPA_CHLCH       ---------MPTPYLSGSAVALVTPFKSDS----SIDFEAIARLTEFHVA-AGTNIIIPC
DAPA_CHLT3       ---------MQRRELSGSAVALVTPFKKDL----TVDEEALRRLVNFQIE-NGTDIIIPC
DAPA_SALRD       --------MAHDMLFRGVAPALVTPFTSDD----DIDEAAFRRLIDAQIE-GGVSALVVL
DAPA_PARUW       ------------MYLKGLYTALITPFTPTG----QLDEEGLKKLIQIQLH-HQVDGVVVL
DAPA_ARCB4       -----------MDIITGSMTALITPFKNG-----KVDLQKYESLIKRQIA-QGINAVSPV
DAPA_SULDN       -----------MDIVTGSTTALITPFKNG-----KLDESAYANLIKRQIN-NGINAVCPV
DAPA_CAMHC       ---------MESTLIKGSMVAIITPFKNG-----KIDEVGYEKLIKREIA-NGINVIVPV
DAPA_HELHP       -------------MVFGAMSALITPFINH-----KVDFETYETLIKRQIT-YGMDACVPV
DAPA_WOLSU       -----------MNTVTGAMSALITPFRNG-----RLDTETYEKLIQRQIR-HGMDALVPV
DAPA_HELAH       -------------MQFHSSSALVTPFKKDL----SVDEAVYEALIKRQIL-QGMDACVPV
DAPA_ACICJ       -------------MFHGSLVALVTPMHEDG----RIDEAALERFIEWQIA-EGTNGLVPV
DAPA_GLUDA       ---------METTMFKGSITALITPMNDDG----SLDFSGFGRFVDWQVT-EGSSGVVPV
DAPA_GLUOX       --------MADTSMYQGSLTALVTPMHTDG----RIDFDVSAKLIERQIE-AGTTALIPA
DAPA_AGRFC       -------------MFKGSIPALITPFTDNG----SVDEKAFAAHVEWQIA-EGSNGLVPV
DAPA_BRUAB       -------------MLKGSITALVTPFDREG----AFDEKAFRAFVNWQIE-EGTKGLVPV
DAPA_BARBK       -------------MLKGALTALITPFNENG----SVDEETFCNFIEWQIT-QGIDGLIPA
DAPA_METRJ       ------MTEMTGSRLRGSLTALVTPFR-DG----AFDEAAFRKFVRWQIE-QGSHGLVPT
DAPA_NITHX       --------MASKTKFRGSYTALVTPFK-NG----SVDEAAFRSLVSWQIG-EGVHGLVPV
DAPA_PARL1       -------------MFKGSYVALITPFK-NG----AVDEAAFVKLVEWQIE-QGTHGLVPC
DAPA_DINSH       -------------MFKGSMPALVTPMK-DG----AVDFATLEALVEWQIA-EGSHGLVPV
DAPA_RHOCS       -------------MFRGSIVALITPFR-NG----GIDERAFQDFVEWQIA-EGTHGLVPV
DAPA_PELUB       -------------MFKGSNVALITPFK-NN----ELDVEAYIKLIHFQIS-NGTNGLVPA
DAPA_CAUVC       ---------MVQSHFKGVIPALVTPFR-DG----EVDEKAFVALVERQIA-GGVHGLVPV
DAPA_HYPNA       -------------MFHGSIPALVTPFK-NG----AVDEAAFAALVERQIA-AGSAALVPV
DAPA_NOVAD       -------------MFSGSIPALVTPFR-DG----AFDEKAFRRLVDWQIE-NGSSALVPC
DAPA_SPHAL       -------------MFSGSIPALVTPFR-DG----AFDAPTFARLVDWQVK-EGTSALVPC
DAPA_SPHWW       -------------MFSGSIPALVTPFR-DG----AFDEKLFRGFVDWQIA-EGSSALVPC
DAPA_ZYMMO       -------------MFTGSIPALVTPFR-NG----KFDEVVFRAHVDRMIE-GGSSALVPC
DAPA_ANAMF       ------------MKLSGVFTALATPFRDDL----SLDERALASFVDWQIS-SGISGIVPC
DAPA_EHRCR       -----------MYSLMGVFTALITPFKDDF----SIDENAFCHLIEEQIS-NNIHGLVPC
DAPA_ACIF2       -------------MFHGSMVALVTPMQVDG----AIDDVALRELVEWHIA-EGTHALVAV
DAPA_LEGPC       -------------MFSGSIVALVTPMRND-----SVDVHHLRELVEFHIA-KGTHALVAA
DAPA_ACISJ       -------MTSPSAPLTGSIVALVTPMHDDG----SVDYPALRKLIDWHIA-EGTDCIGVV
DAPA_BORPE       ------------MQFQGSLVALVTPMQPDG----SLDYDAYRSLIDWHVA-EGTDGLVVV
DAPA_POLAQ       -MTNKAHSQGSKKTIQGSMPAIVTPMFEDG----SLDYPGLRALLDWHVS-EGSDGIVIV
DAPA_RALSO       -----------MTQISGSLVAIVTPMHEDG----SLDFPSLRSLIDWHIA-EGTDGIVIV
DAPA_HERAR       -------------MIQGSIVAIVTPMHADG----ALDLPGLRKLIDWHIA-EGTDGIVIV
DAPA_AZOSB       -------------MITGSIVAIVTPMHEDG----SLDFPRLRSLIDWHVA-EGTDGIVIV
DAPA_NITMU       ---------MDNVAIKGSLVAIVTPMHENG----ELDLERFQSLIDFHVT-EGTDGIVVV
DAPA_THIDA       --------MAEISTARGSLVAIVTPMSDDG----ALDLGALRRLIDWHIE-QGTDGIVIV
DAPA_LARHH       -------------MLTGSLVAIVTPMLEDG----SVDFEALDRLVDFHIE-SGTSGIVAV
DAPA_MARHV       -------------MITGSLVALVTPMYPNG----DIHWEDLDKLVDFHIE-NGTHGIVAV
DAPA_CHRSD       -------------MITGSIVALATPMKASG----EIDWEALRRLVGFHLD-NGTDAIVAA
DAPA_ALCBS       -------------MIRGSIVALVTPMRADG----SVDWERLRSLVNWHVE-QGTHAIVAV
DAPA_METCA       -------------MIQGSIVALATPMEPDG----RLDVPGLRRLVEFHIE-QGTDAIVAV
DAPA_PSEAE       -------------MIAGSMVALVTPFDAQG----RLDWDSLAKLVDFHLQ-EGTNAIVAV
DAPA_NITOC       -------------MFHGSMVALVTPMHPDG----ALDWEGLRRLVDFHIE-NGTDAIVTV
DAPA_THISH       -------------MFHGSMVALVTPMEADG----SVSDASLAELVEFHIQ-KGTDAIVAV
DAPA_ALKEH       -------------MFHGSMVAMVTPMHPDG----AVDEVSLARLVDYHVE-HGTDAIVAV
DAPA_HALHL       --------MTEVVMFRGSMVAMVTPMKAQDGIRDAVDEKALKQLVEYHVE-QGSDAIVAV
DAPA_SACD2       -------------MLRGSMVALVTPMQADG----SLDWEALHKLVDWHLQ-EGTDAIVAV
DAPA_TERTT       -------------MYRGSMVALVTPMKADG----SLDWDALHKLIDWHLE-QGTHAIVAV
DAPA_RUTMC       --------MRINHPLTGSIVALITPMFDDG----SIDFGVLKSLVAFHID-SGTKAIVSM
DAPA_COXBU       -------------MFNGSLVALVTPMQENG----EIDYSNLKELVEWHLE-NDTDGLVIL
DAPA_DICNV       -------------MFTGSLVALVTPMHIDG----SIDWQALEALINWHIA-SQTQAIVVA
DAPA_ALISL       -------------MFSGSIVALVTPLDTDG----EVDYTSLKNLVDYHIN-AGTDGIVAV
DAPA_VIBCH       -------------MFSGSIVALITPFTPDG----EVDYISLKKLVDFHVD-AGTDAIVSV
DAPA_HAEDU       -------MIMSVPLFHGSIVALLTPMTH-G----EVNYQEIKNLVEYHIQ-AGSHGIVAM
DAPA_HAEIN       -------MSAQNSLFSGSIVALVTPMNHYG----EVDFSCLEKLVEHHIE-AGSNALVSV
DAPA_EDWI9       -------------MFTGSIVALVTPMDDKG----NVDRASLRKLVDYHVA-SGTSAIVAV
DAPA_ECOLI       -------------MFTGSIVAIVTPMDEKG----NVCRASLKKLIDYHVA-SGTSAIVSV
DAPA_BLOPB       -------------MFMGSIVALITPMDLKG----TVDRISLKKLVDHHVV-SGTSAIVSV
DAPA_BUCAI       -------------MFKGSIVALITPMDEKG----QICRISLEKLINYHVA-SKTEAIVSI
DAPA_BUCCC       -------------MFKGSIVALITPMDIKG----NICKKSLKKLVKYHIK-NKTNAIISV
DAPA_PSYIN       -------------MLTGSIVALVTPMDKTG----EIDFLTLKQLVEFHIK-SGTAAIVAV
DAPA_SHEB5       -------------MINGSIVALITPMNSDG----SVDFASLERLVEFHID-QGTDAIVAV
DAPA_PSEA6       -------------MFTGSYVALITPMYQSG----EIDYPSLKKLVDFHIA-NGSHGLIAV
DAPA_IDILO       -------------MLKGSIVALVTPFTKYG----NVDYSELEFLVNKHCE-AGTDAIVAV
DAPA_NEIG1       -------------MLQGSLVALITPMNQDG----SIHYDQLRQLIDWHIE-NGTDGIVAA
DAPA_PSYWF       ---MSNRYSDFKTQLQGSMVALVTPMKANG----EVDYPRLADLIDWQIE-QGTHCLVAV
DAPA_SORC5       ---------MSQLPLSGTFTALVTPFTPDGE---AVDFDALDALVEAQIA-GGVSGLVPC
DAPA_THERP       -------------MLRGTFVALITPFA--GE---EIDEPRLRDLVDWLIA-NRVDGLVPC
DAPA_ANAD2       -----------MRRLEGSMVAIVTPMK--DG---AVDLRALRDLTEWQLA-EGTDGIVPC
DAPA_AQUAE       -------------MFQGSIVALITPF-KEG----EVDYEALGNLIEFHVD-NGTDAILVC
DAPA_HYDS0       -------------MLTGSITAIVTPF-KNG----EVDYGAFERLIEFQIQ-NGTDGILVC
DAPA_PERMH       -------------MFKGSIVALITPF-KDG----AIDRKSLKRLIDFHVE-KGTDGIVIA
DAPA_THET2       -------------MFRGSIPPLPTPF-RRG----RLDEEALRRLVERVVQ-GGSHGVSVG
DAPA_GEOBB       -------------MFQGSIVAIVTPF-KNG----AVDEEKLRELVEFQIE-NGTDAIVPC
DAPA_PELCD       -------------MFTGSMVAIITPFDREG----RFDEETFRKLIDFQIE-NGTDVIVPC
DAPA_SYNFM       -------------MFQGAMVAIVTPF-KAG----QVDEETFRNLIEFQIA-NGTHGIVPC
DAPA_SYNAS       -------------MFKGAIVAIVTPF-KNG----EIDEPALRDLIEFQIE-NGTDGIVPC
DAPA_THEYD       -------------MFKGSMVAIVTPF-KKG----KIDEKAFEKLIEWHIK-EGTHGIVPC
DAPA_DESPS       -------MGGVMEKFHGAYVAIITPF-ING----EVDEQSFVDLIEFQIA-NGTHGIVPC
DAPA_DESAG       ------------MQFSGALTAIVTPL-KNG----HIDEEAYRNLIEWQIE-QGINGLVPC
DAPA_DESAD       ------------MTFQGAFTALVTPF-KDG----EIDQDAYRELIEWQIE-QGIDGLVPC
DAPA_LAWIP       ---------MGQIQFQGAITALVTPF-KKG----EIDLECYREIIEWQIE-QGINGLVSC
DAPA_LEPBA       -------------MFQGVYTAVITPF-RQG----KIDYDSYFKILENQIR-SGVAGVVPC
DAPA_LEPIN       MIAKSGSNQESNPMFQGVYTAIITPF-KND----KIDYDSYFKLLEKQIK-AGVSGVVPC
DAPA_ENDTX       -------------MFSGVYTALITPF-KDY----KVDFDAFEKLIENQYK-KGVNGIVPC
DAPA_MAGMM       -------------MFKGVYTALITPF-KNR----AVDYTALAKLVEQQIN-GGIHGLVPC
DAPA_HALMA       ---------MTAIDFHGVFPAMCTPFHQD----GSIDFETLRDDAQRLES-AGVDGLVPV
DAPA_NATPD       ---------MTHDTFTGVFPAMTTPFDDE----ERIDHETLRDHAQRLEA-AGVDGLVPV
DAPA_METBU       -------------MFEGVLPALITPFTKD----DTIDRTGLIKNIEFAEN-GKVTGVVVC
DAPA_METAC       -------------MFEGAMPALITPFTKD----DRIDREGLRRNIAFVEE-GGVSGIVPC
DAPA_METTP       -------------MFRGVFPAIITPFKDD----GSLDEDGLRRNVEVLSK-TGISGVVPC
DAPA_METMJ       -------------MFEGILPAIITPFYRDSR--ASLDIEGLQSNIESLLQ-RGVHGIVPC
DAPA_METHJ       -------------MFEGVFPALITPFQRNHG--KNLDLDGLRSNIAHLVA-AGVHGVVPC
DAPA_METLZ       -------------MFEGVIPALITPFNDDAS--QSLDIEGLRNCIEYVIR-GGVHGLLAC
DAPA_METJA       -------------MFKGVYPAIITPFKN-----KEVDFDGLEENINFLIE-NGVSGIVAV
DAPA_METKA       ----------MGFQIEGVIPALITPFTDDL---KGINEEGLRENVSRLLE-AGVHGVVPA
DAPA_METTH       ------------MKIEGTVVAMVTPFTED----DVVDEAGLRENINYLIE-NGVDGLLVA
DAPA_METST       ------------MNLEGTHVAMITPFNND----NTINEEKYREFIDFLIE-GGVDGILAA
DAPA_METS3       ------------MNFEGTYVAMVTPFTDD----GNIDEEGFRSNINYLID-KGVTGLLGA
DAPA_ARCFU       -------------MFEGVIPAMVTPFKED----FSVDYEGIAKNLDYL-E-KHVNALVPA
DAPA_RICM5       ----MKIKKIMHNIFKGLITALITPFK-DN----KLDLYALERIVKHQIK-YEVDAVLIA
DAPA2_CLOAB      ------------MKIEGVLIPLITPFK-DG----KVDLASYEKLIRHYSK-KGVAGFMPL
DAPA_WIGBR       -------------MFTGSIVALITPMKKSG----KIDFDSIKGLIEYHIV-NNTSAILAI
DAPA_ACHLI       -----------MKKFTGSGVALVTPFK-GS----KINYPVLQKLLDFHIE-NETDFLVIL
DAPA_BDEBA       -----------MKNFKGTFTALVTPFK-NG----KIDFASLDKLLKQQLA-GGVDGFVVN
DAPA_FERNB       -------------MFTGVGTAIVTPFS-NG----EVDYGSYEKLVRWQIE-SGVKAIVVA
DAPA_THEMA       -------------MFRGVGTAIVTPFK-NG----ELDLESYERLVRYQLE-NGVNALIVL
DAPA_THEAB       -------------MFEGIGTAIVTPFK-EG----KLDIESYEKLLNFQIN-NQINAIIVL
DAPA_THEM4       -------------MFSGIGTAIITPFK-NG----EIDYHALKNFLETQ---RMVDAIILL
DAPA_KOSOT       -------------MFRGAASAVITPFK-GN----EIDYDSFDKFLKFQLD-SGINGLIVL
DAPA_ALKOO       -------------MFKGAGVAIVTPFK-EG----KIDFAAFEKLIDFHLE-NNTQALIVL
DAPA1_CLOAB      -----------MSIFKGSAVALITPFT-QD----GVNFDELKKLLEWHIK-NKTDAIVIC
DAPA_CLOPE       -------------MFKGSCVALITPFT-ED----GVNYEELRKLLEWHIK-NHTDAILVC
DAPA_CLONN       -----------MTLFKGSGVALVTPFK-DG----KVNFKKLEEILNWHVE-CGTDAIIVC
DAPA_CALBD       -----------MSLFKGSGVALITPFKDEE----SVDFETLGRLVDFHLE-HKTDAIIVC
DAPA_THEP3       -----------MPVFKGSGVAIVTPFN-EE----GVNFEKLGELIEWHIK-EGTDAIIIC
DAPA_HUNT2       ---------MRKPIFTGAGVAIITPFT-EN----GVNYDKLGELIEFQIR-EGIDSIIIC
DAPA_LACP7       -----------MAIFTGAGVAIVTPFKENR----EVNYEKLGELIDFQIN-NGTDSIIIC
DAPA_BRAHW       -----------MSLFEGAGVALITPFTEDN----QINYEKLEELIEFQIA-NKTDAIIAA
DAPA_EXIS2       -------------MFKGAGTALATPFTSTG----ELDLAVFEQLIEQQLA-ANIQALVVG
DAPA_EXISA       -------------MFTGVATALATPFQENG----QLNLEAWAALIEDQIK-EGVTGLVIG
DAPA_XANAC       ------------MSLSGIITALATPFGPDG----ALDLDAWRRLLEQQLH-GGVQGLVVA
DAPA_STAAB       ----------MTHLFEGVGVALTTPFTNN-----KVNLEALKAHVNFLLE-NNAQAIIVN
DAPA_STAS1       ----------MGHIFEGVGVALATPFTHN-----EVDFDALRRHVKYLLD-NNAKSIVVN
DAPA_MACCJ       ----------MNIHFKGTGVAVTTPFNGQ-----TIDYNLFEDHLNFLIN-NNVEALIIN
DAPA_ACAM1       -----------MTFFGQILTAMVTPFT-DTG---DMNFSVAEALAIHLAD-HGTDTLLLC
DAPA_THEEB       -----------MTDFGRVITAMITPFT-ADG---AIAYDVAAKLAQHLVA-NGSDGIVVC
DAPA_NOSS1       -----------MGDFGTVLTAMITPFK-ADG---SVNYAVAAELAANLVD-NGTDTLVVC
DAPA_MICAN       --------MSETTYFGRVITAMVTPFT-VEG---QVNYALVEKLADYLVT-HGSDGIVVC
DAPA_SYNY3       -----MADFVSTSPFGPVLTAMVTPFN-ADG---GVDYGVAEKLADHLIT-HGSDGLVVC
DAPA_SYNE7       --------MPQPYPFGRVITAMITPFN-AEG---QVAYDIAQSLAVHLVE-QGSDGLVIC
DAPA_SYNJB       ------------MNFGRVLTAMVTPFT-DEG---ELNYDEAARLADYLAT-HGSDGLVVC
DAPA_PROMA       ---MSTVPEISSAPFGRLLTAMVTPFD-TAG---AVDFALAARLARYLVD-QGSDGLIVC
DAPA_SYNR3       ------MSSLSSAPFGRVVTAMVTPFA-ADG---SLDLPLAARLAQHLVA-HGSDGLLVC
DAPA_PROM5       --MIPNNTQFSNPIFGRILTAMVTPFK-ENG---GVDYELAIKLANHLCE-NGSDGIVLC
DAPA_DESAP       ----------MTVDFGRVLTAMVSPFD-KNM---ELNLPMARKLARHLVD-SGSDGLVVC
DAPA_DESRM       ---------MSTVDFGRVITAMVTPFH-PDM---SVNYTQAKKLSRYLVE-NGSDGLVVS
DAPA_HELMI       ------------MEFGRLITAMVTPFN-DRL---EVDYVRAAELANHLVN-TGSDGIVVA
DAPA_MOOTA       ------------MQWGRILTAMVTPFT-ADG---KLDLDGARRLAAYLVD-HGSDGLVVA
DAPA_SYMTH       -----------MPTFGRLLTAMVTPMT-PDG---AVDYQRAGELAKHLVA-AGSEGLVVS
DAPA_DEHM1       -----------MKELGRLITAMVTPFK-KDG---TVDYAQAQKLALGLLD-SGSDGLVVV
DAPA_NATTJ       -----------MRGFGELITAMITPFN-KQG---ELATENCVKLAKKLVNEQNSDALVLS
DAPA1_BACHD      ------------MNIGRIVTAMVTPFN-EQD---QVNLEATCQLVNELIA-NGSDALVVG
DAPA2_BACHD      ------------MDFGHVLTAMVTPFD-AKG---NVDLEKVERLVEFLLA-NGTEGLVVA
DAPA_BACSU       ------------MNFGNVSTAMITPFD-NKG---NVDFQKLSTLIDYLLK-NGTDSLVVA
DAPA_OCEIH       ------------MNFGKVLTAMVTPFD-KHE---EIDFQALDHLIDHLIN-NGSDGLVVA
DAPA_LISIN       ------------MDLGKVITAMVTPIHPEKN---KVCKKRIHHLVNHLID-NGSDGLVIA
DAPA_LACLM       ---MSAKETIEKLKKARIITALVTPFK-ENG---QINFEAFPKLVEDLLA-SHTEGLILA
DAPA_STRGC       -------MAYKDLLNCKIITAFITPFH-EDG---SINFGAIPDLIEHLLA-HHTDGILLA
DAPA_ENTFA       ----------MDLTNATIITAMVTPFQ-ESG---EIDFDKLPQLVDYLLA-NHTEGVILA
DAPA_LACAC       ---------MATLIDADLLTAIVTPFD-ENN---KIDFSSLEKLVNYLIG-QGCNGFVVG
DAPA_LACRD       ---------MTLLQNADLMTAIVTPFD-DEE---NIDYGRLEYLTNYLIE-HGSNGFVIG
DAPA_LACF3       ---------MTELTNADLLTAIVTPFT-DEG---TIDYPALDQLTEHLLQ-AGNNGFVVG
DAPA_PEDPA       -----------MLENVDLISAIITPFD-DQL---KINFTALERLTNHLIE-TGNTGFIIG
DAPA_LACP3       ------------MQKAELITAIVTPFN-DRD---EIDYGVMQRLVDHLIA-EGTDGFVVG
DAPA_OENOB       --------MTNLLENTNLLTAIITPFD-KNN---RIDFQVYRRLIDSQIS-DGVKGFVIS
DAPA_LACS1       ----------MNFRNAHILTAMVTPFD-DEG---NYSSKRTKNLINYLLD-NGTEGLLVS
DAPA_LEUCK       -----------MYEHINLITAIITPFN-AEN---EIDYPALDRVIDHLLE-TGTQGLVIA
DAPA_LEUMM       -----------MYEGINLITAIITPFT-VND---EIDYESLEKLIEHLLN-HGSQGFVIA
DAPA_ACIC1       -----MTTSLRPAPFGRVLTAMVTPFTADG----ALDLDGAARLATYLVDHGN-DGLVIS
DAPA_KINRD       --MPTATAAQPLRPFGTVLSAVVTPFTASG----AVDLDAAAALAVHLVEHGH-DGLVVS
DAPA2_STRCO      ----MAPTSTPQTPFGRVLTAMVTPFTADG----ALDLDGAQRLAAHLVDAGN-DGLIIN
DAPA1_STRCO      -----MTTDDDSAPFGRSLCAMVTPFTGSG----ALDLDGAQRLADRLVARGC-DGLVLS
DAPA_CUTAK       ---------MSAPVFGRLLTAMVTPMTFDG----AVDLRRTGELAHKLVEEQNNDGIVVN
DAPA_CORA7       -MSTGMTAQAGVDTFGRVGVAMVTPFDQDG----ALDVSAGRRLAAHLVDNGV-DSLILA
DAPA_CORDI       -MSTGLTANNGIEEFGTIAVAMVTPFDANG----ALDIKAGQKLAAHLVSNGI-DSLVLA
DAPA_CORJK       -MSTGNAATRGSAHFGTISLAMVTPFKKDG----SIDLDAGVALAGHFVDEGC-DSLVLA
DAPA_MYCGI       -MPVSTSGFDAPARLGTLLTAMATPFKPDG----SLDIETAARLATRLVDAGC-DGLVVS
DAPA_BIFA0       -MSDGIMHLLDPAPFGRVLPAMITPMKPNG----DVDFDMAQTVAKQLVADGA-DGLVVN
DAPA_CHLMU       ---------------MSVVTACITPFKADL----SIDFAALESVVRSQEH--AGNGVFLF
DAPA_CHLTR       ---------------MSVLGACITPFKADL----SIDFAALESVVRSQEH--AGNGIILF
DAPA_CHLAB       ---------------MKLLTASVTPFLPDH----SIDFLSFENLLRFQER--ESHGVVLL
DAPA_CHLFF       ---------------MKLLTASVTPFLPNY----DIDFLSVEKLLHSQEK--EGNGVVLL
DAPA_CHLPN       ---------------MHLLTATVTPFFPNG----TIDFASLERLLSFQDA--VGNGVVLL
DAPA_WOLPP       ------------MKSTFLWTACVTPFNCSGD---SIDYQSLQRLLTMQAE--TENGVVLL
DAPA_FRAP2       ---------MSIDINNRLYTALVTPMFVDG----SIDWGSFENLLRIQEY--QGCGILIL
                                     .  :*:                                  

DAPA_AZOPC       GTTAETPTLSYEEQKEIVRLVVSIVRER-------IPIVVGVGGNNTQAVIHKLNT-EDF
DAPA_BACV8       GTTAETPTLTKEEKDKIKRLIIERVNGR-------IPILLGVSSNCTRAVVETLKN-DDM
DAPA_PORG3       GTTGESPTIEEAERSAILQTVREAVAGR-------CPIIVGAGGNYTERLVNRIQA-MDK
DAPA_FLAJ1       GTTAENATLTAEEKELVINTVIDVNKGR-------LPLVLGVGGNNTMQIVEELKT-RDF
DAPA_GRAFK       GTTAESATLTQDEKELIKKVVKEANAGE-------LPLVLGVGGNNTAGVVEELQI-ADL
DAPA_SULMW       GTTGETPTLKLKEKIDIINCVKNISQNR-------IPIVLGMGSNNTEDVLLTLKL-IKL
DAPA_CYTH3       GTTAESATTSKEEKAKLLEVALDVNNGR-------VPVMYGIGGNDTAEVIQRIGS-ADF
DAPA_KORVE       GTTGETPTLSHDEWLKVIAQTVEVNHGR-------VPIVAGATSNNTAEAVEKAKEVAAI
DAPA_ACIC5       GTTAETPTLTHDEWLRVIRIIAEQAAGR-------VPVWAGCTHNATRQAVENARQAAQI
DAPA_CHLP8       GTTGESPTLTNEEEAEIIRTVRDEAGDS-------MMVAAGAGTNDTRHAVELSRN-AEK
DAPA_CHLPB       GTTGESPTLTADEQTEIIEIVREEAGNK-------MLVAAGAGTNATEEAVSLASN-AQK
DAPA_CHLCH       GTTGESPTLAEEEQVAIIKTVVEAAQGK-------LMVAAGAGTNNTHHAVELAKN-AEK
DAPA_CHLT3       GTTGESPTLTNEEQVQVIKIVCDEARGK-------AQVAAGAGTNSTIHAIELAKA-AEA
DAPA_SALRD       GTTGENPTITEDERRRIVDAALDAADGR-------VPVIVGTGTNNTDESVAFSKA-AVD
DAPA_PARUW       GTTGESPTLTQIEKRRIIEIALEEIQGR-------IKVIVGTGSYSTQQAIEQTLQ-AKQ
DAPA_ARCB4       GTTGESATLSHKEHKECIEVAVATCKNSGV------KVLAGAGSNATHEACDIAKF-AQE
DAPA_SULDN       GTTGESATLSYAEDKRCIEIAVEICRGTAT------KVLAGAGSNSTSEAIEAAIT-AQK
DAPA_CAMHC       GTTGESATLTHEEHRVCIEIAVDTCKGTDV------KVLAGAGSNATHEAIGLAKF-AQD
DAPA_HELHP       GTTGESATLSHKEHMECIEVAVAVCRGSKV------KVLAGAGSNSTSEAKELALF-AQK
DAPA_WOLSU       GTTGESATLSHSEHKECIEIAVKVCQGTGI------KVLAGAGSNSTLEAIDLAKF-AEK
DAPA_HELAH       GTTGESATLTHKEHMHCIEIAIETCKNTKTPSNSRMKVLAGVGSNATSESLSLAKF-AQK
DAPA_ACICJ       GTTGESPTLSHDEHKRVVEITVEVARKR-------VPVIAGAGSNATREAIGLAKH-AES
DAPA_GLUDA       GTTGESPTLTHEEHARIVEYTVQVVAGR-------IPVIAGAGSNSTAEAVGMARH-AKS
DAPA_GLUOX       GTTGESPTLSHEEHGRVVAHCVETANGR-------VRVMAGAGSNSTSEAVLMAKH-AHS
DAPA_AGRFC       GTTGESPTLSHDEHKRVVELCIEVAAKR-------VPVIAGAGSNNTDEAIELALH-AQE
DAPA_BRUAB       GTTGETPTLSHDEHKRVIEVCIEVAAGR-------VPVIAGAGSNNTVEAIELAQH-AEK
DAPA_BARBK       GTTGESPTLSHEEHKKVIELCVEKVAKR-------VPVVAGAGSNSTDEAVELAQH-AKK
DAPA_METRJ       GTTGESPTLTHSEHDRVVEACIDEAGGR-------VPVVAGAGSNSTAEAVERAQH-AER
DAPA_NITHX       GTTGESPTLSHDEHRKVVEWCIDEARGR-------VPVIAGAGSNSTREAVDLAVH-AEK
DAPA_PARL1       GTTGESPTLSHDEHKRVVELCVKTAKGR-------VPVIAGAGSNNTVEAIELTRF-AKK
DAPA_DINSH       GTTGESPTLSHEEHEAVVAKVIEVAAGR-------VPVIAGAGSNNTVEAVRFVRH-AKD
DAPA_RHOCS       GTTGESTTLSHEEHRRVIQLCVEVSRGR-------VPVIAGTGSNSTEEAISLTRF-AKE
DAPA_PELUB       GTTGESPTLSHDEHQKVIDLCVKESNGK-------NIVIAGTGSNSTKEAISLTTH-AEK
DAPA_CAUVC       GTTGETSTLSHEEHRRVVELCVKTTAGR-------VPVIAGAGSNSTDEAIELARH-AKT
DAPA_HYPNA       GTTGETSTLSTEEHKRVVSLCVEVAAGR-------VPVIAGAGSNSTDEAIDLVAH-AKA
DAPA_NOVAD       GTTGEASTLSNAEHHRVIEVCVEQAAGR-------VPVIAGCGSNDTMNALLHMNF-SKK
DAPA_SPHAL       GTTGESPTLSFDEHYRVIDCCIEAAAGR-------VPVIAGCGSNDTATAIRHMRH-AQA
DAPA_SPHWW       GTTGESATMSIEEHNHVVRVCIEQAQGR-------VPVIAGCGSNDTAVALEHMKA-AQA
DAPA_ZYMMO       GTTGESATMTIEEHNYVMAVCIDQTKGR-------VPVIAGCGSNDTKVSLAHLRH-AAK
DAPA_ANAMF       GTTGESATLNFEEYCTVVRLCIETARGR-------ILVIAGAGSHCTTETISRALF-VQS
DAPA_EHRCR       GTTAECPTLSFEEYCKVIELCVKITNKR-------VPIIAGSSSNSTQEAIKRTLY-VQS
DAPA_ACIF2       GTTGESATLEMREHVAVIQTVVEQARGR-------VPVIAGTGANATHEAIELTRA-AME
DAPA_LEGPC       GTTGEAGTLSHSEKLLVIKTVIEQAKER-------VPVIAGTAMNATKDCIELTQQ-AME
DAPA_ACISJ       GTTGESPTVNVEEHCEIIRVSVEQAAKR-------VPIMAGCGANSTAEAIELARF-AKK
DAPA_BORPE       GTTGESPSVSMEEHAELIRVAVEHAAGR-------IPVIAGVGANSTDEAIHLARH-AKA
DAPA_POLAQ       GTSGESPTVSVEEHCELIRVTVEQIAGR-------IPVIAGTGGNSTQEAIELTHF-AKK
DAPA_RALSO       GTSGESPTVSVDEHRELIRVTVEQVNKR-------IPVIAGTGGNSTTEAVELTAY-AKS
DAPA_HERAR       GTTGESPTVSVDEHCELIRVAVEHTAKR-------IPIIAGTGGNSTSEAIELTQF-AKD
DAPA_AZOSB       GTTGESPTVSVDEHCELIRVAVEHAAGR-------IPVIAGTGANSTAEAIALARY-AQQ
DAPA_NITMU       GTTGESPTVDFEEHHLLIKTAVEQAAGR-------VPVIAGTGANSTREAIDLSIY-AKN
DAPA_THIDA       GTTGESPTVNFDEHCLLIRTAVEQAGGR-------VPVIAGTGANSTSEAIALTEC-ARA
DAPA_LARHH       GTTGESAALAVEEHLQVVAAVVKRAAGR-------IKVIAGAGANSTHEAIDLTRE-SRR
DAPA_MARHV       GTTGESATLDPEEHIRTIGHIIKRVNGR-------IPVIAGTGGNSTREAIELTTE-AHK
DAPA_CHRSD       GTTGEPTTMSFAEHFDVIRCVVEEVAGR-------IPVIAGTGANATSEAVELARY-ARE
DAPA_ALCBS       GTTGESATLGFEEHDSVIREVVALAKGR-------LPVIAGTGANNTEEAIRLTRD-AKR
DAPA_METCA       GTTGESATLDEEEHTEVIRLVVEQAAGR-------IPVIAGTGANATTEAIRLTAR-AKA
DAPA_PSEAE       GTTGESATLDVEEHIQVIRRVVDQVKGR-------IPVIAGTGANSTREAVALTEA-AKS
DAPA_NITOC       GTTGESPTLEVKEHIRVIREVVDQAQGR-------LPVIAGTGANSTREAEELTRA-ALE
DAPA_THISH       GTTGESATLDFDEHCEVIRKVVDRVAGR-------IPVIAGTGANSTSEAIELTRC-AMQ
DAPA_ALKEH       GTTGESATLDYDEHCHVMRKVVEAARGR-------IPVIGGTGANSTWEAIKLTRC-AME
DAPA_HALHL       GTTGESATLDYEEHRDVIRATVEAAAGR-------IPVIGGTGANSTWEAIELTRS-AME
DAPA_SACD2       GTTGESATLDVKEHIAVIRAVVDQVNGR-------VPVIAGTGANSTSEAIELTQA-AKD
DAPA_TERTT       GTTGESATLNMAEHLEVISKVVDQVNGR-------VPVIAGTGANSTSEALELTQG-AKQ
DAPA_RUTMC       GTTGESATLNQDEHIEVIRATIEFANSR-------IPIIASTGANSTSEAIELTKA-AKV
DAPA_COXBU       GTTGESPTITAEERHKIIRQVVDQVNKK-------IPIIVGTGANSTVHTIEMTQQ-AME
DAPA_DICNV       GTTGEAATLTLDEHKAIMRFCVDIANDR-------IPIIAGAGANATARAIELTLA-AYH
DAPA_ALISL       GTTGESATLSVEEHVKLVMKTLEFSDGR-------IPVIAGTGANATHEAVTFSKL-FRD
DAPA_VIBCH       GTTGESATLTVEEHVKVVAKTVEFAEGR-------LPIIAGTGANATHEAVTFSRL-LNN
DAPA_HAEDU       GTTGESTTLSIDEHVKVIKKTVEFADGR-------IPIIAGSGSNATSEAVTITKL-LNG
DAPA_HAEIN       GTTGESATLSIEENVKVIEKTVEFAKGR-------IPIIAGAGANATSEAITMTKL-LRD
DAPA_EDWI9       GTTGESATLSHDEHVNVVLQTLELADGR-------IPVIAGAGANATAEAIALTEC-FNH
DAPA_ECOLI       GTTGESATLNHDEHADVVMMTLDLADGR-------IPVIAGTGANATAEAISLTQR-FND
DAPA_BLOPB       GTTGEMSGLTHEEHVDVVMRTLEFSDGR-------LPVIAGTGANSTAEAVALTNK-FND
DAPA_BUCAI       GTTGESATLSQEEHINIVMLTLELADGR-------IPVIAGTGANATTEAISLTKR-FEK
DAPA_BUCCC       GTTGESATLNKNEHTNVIMHTLEYADEK-------IPIIAGTGSNATSESILLTKK-LEL
DAPA_PSYIN       GTSGESATLDVDTHAKVVIKALEFADGR-------IPIIAGNGANSTSEAVLLSKR-FAD
DAPA_SHEB5       GTTGESATLPMSEHVTVVSQTVKFAAGR-------VPVIGGNGANATSEAVELTKS-LSK
DAPA_PSEA6       GTTGESATLPFDEHIEVVKRMVEFADKK-------IPVIAGSGANSTAEAIFLSEQ-MAG
DAPA_IDILO       GTTGESTTLTHEEHIAVVNAMVELSAGR-------IDIIAGNGSNSTSEAVQLTEK-MTQ
DAPA_NEIG1       GTTGESATLSVEEHLSVIEETVKHVAKR-------VPVIAGTGANNTVEAIALSQA-AEK
DAPA_PSYWF       GTTGESATLSMQEHSDVIHFFVKHVNGR-------VPVIAGTGANNTQEAIHLTSE-AKA
DAPA_SORC5       GTTGESPTLSEAETTAVIRRVVEAARGR-------VPVIAGTGSFSTKKTIEASRA-ALA
DAPA_THERP       GTTGETPSLSDTEWQRVAAVVIEQAAGR-------VPVIVGTGTNSTMVTIQRTRV-ARE
DAPA_ANAD2       GTTGEGVTLTPAERADVIRTVIETVRGR-------ALVIAGAGSNATHEAIESVKL-AKT
DAPA_AQUAE       GTTGESPTLTFEEHEKVIEFAVKRAAGR-------IKVIAGTGGNATHEAVHLTAH-AKE
DAPA_HYDS0       GTSGESPTLSYEEHEAVIEFAVKSAKKR-------IHIMAGTGANSTEEALRFTTF-AKA
DAPA_PERMH       GTTGESATLTFSEHEDLIKMAVEFADKR-------IPIIAGTGANATHEAIALTKS-AEK
DAPA_THET2       GTTGEPGTQTLEERKRAIEVVLDQVAGR-------VPVIPGTGALRLEETLELTRF-AKE
DAPA_GEOBB       GTTGESSTLSYVEHDRVIQVVVEQVNKR-------VPVIAGTGSNSTHEAIEITQH-AKE
DAPA_PELCD       GTTGESATLDHAEHKKVIKTCIEQVNKR-------VPVLAGTGSNATSEAIELTRD-AKK
DAPA_SYNFM       GTTGESATLSFNEHERVIEIAVEQVDKR-------VPVIAGTGSNNTEEAIRLTKH-AKN
DAPA_SYNAS       GTTGESATLSHEEHDRVIEITIDAVRKR-------VPVIAGTGSNSTVEAMRLTKH-AHE
DAPA_THEYD       GTTGEASTLDYEEHYKVIEITVKVVNKR-------IPVIAGTGSNSTDEAIMITKK-AEK
DAPA_DESPS       GTTGESATLSFDEHKQVMDLAIKTVAGR-------VPVIAGAGANNTLEAIDLSES-AKE
DAPA_DESAG       GTTGESATLSHEEHRDVIRICIDQVKGR-------VPVLAGAGSNSTKEACGLAQF-AKD
DAPA_DESAD       GTTGEAATMTHEEQGEVIRICVEQAKGR-------VPVIAGAGSNNTKEAVNLTKL-AKQ
DAPA_LAWIP       GTTGESATLTYEEYKLLIKACVEQTKSR-------VPVIAGAGSNDTAKAIQLTKI-AKE
DAPA_LEPBA       GTTGESPTLSYEEHKELIQKTVQVVSGK-------IQVIAGTGSNSTKEAIELTES-ACA
DAPA_LEPIN       GTTGESPTLSHSEHAELIRETVKAVQGK-------IQVVAGTGSNSTKEAIELTEA-ACK
DAPA_ENDTX       GTTGESPTLSCKEHEEVIEFCVEKAKGK-------MKVLAGTGSNSTDEAIYFTRT-AKR
DAPA_MAGMM       GTTGESATLSHEEHKAVIRTVVELVQGR-------VKVLAGTGSNCTEESTELTCY-AEE
DAPA_HALMA       GSTGESATLSHDEHIEVVEAVIDAVDD--------VPVIAGSGSNNTKEALELSRR-SAE
DAPA_NATPD       GTTGESATMSHDEHIEVVETVVDAVDD--------VPVIAGSGSNNTREALELSER-AAD
DAPA_METBU       GTTGESATLSTAEHMEVIDIAVECAN---------VPVVAGTGSNNTAEAVELTKH-AEE
DAPA_METAC       GTTGESATLSALEHEEVIDIAVECAK---------VPVVAGTGSNNTGEALQFTKH-AAD
DAPA_METTP       GTTGESATLSHEEHKKVVEIVVDCSD---------VPVVAGTGSNNTSEAIELTRH-AAD
DAPA_METMJ       GSTGESATLTFEEHEQVIGKAVEVVDGR-------VPVLAGTGSNNTEEAVRLTRS-AKD
DAPA_METHJ       GSTGESATLSFAEHEQVVEVTMDEAGGK-------VPVLAGTGSNNTSEALRFTRA-AKD
DAPA_METLZ       GSTGESATMTHAEHIRVIEETVSAASNR-------IPAIAGTGSNNTEEALLMTRA-AKM
DAPA_METJA       GTTGESPTLSHEEHKKVIEKVVDVVNGR-------VQVIAGAGSNCTEEAIELSVF-AED
DAPA_METKA       GTTGESSTLSHAEHRRVIEIVVDEVNGK-------VPVIAGAGSNSTREALELSTY-AED
DAPA_METTH       GTTGESATITHEEQRRMIDILVDEVNGR-------VRTVAGAGSNSSREAMGLVEY-AED
DAPA_METST       GTTGESATLTLEEHQKVIDIMVDQANGR-------VTTIAGAGSNATSEALDLVNY-SKD
DAPA_METS3       GTSGESATLTHEEHRKVVEILIDEVGGR-------VETVAGSGSNSTHEAIELTKS-AEE
DAPA_ARCFU       GTTGEAATLSYEEHIDVVRYVAETSK---------LPVIGGAGSNSTREAIWLAKE-VEK
DAPA_RICM5       GSTGESSSLSFEEYKLLLQTSVEIVNKC-------IPIISGCSSNNTTYARALAAE-STK
DAPA2_CLOAB      ATTGETPTLSDYEYQSILEKTVECNELN-------LPIYVGFGGNNTEKMTKDIKM-LDK
DAPA_WIGBR       GTTGENFSLTFEEQCNIVKYIFETCDKK-------IPVIAGIISSNIENIKKQINF-YNK
DAPA_ACHLI       GTTAESPTLTSSEKKEVISFVVNYINKR-------IPIMVGTGSNDTKQTISFSRT-AQR
DAPA_BDEBA       GTTGESPVLTSSEKAELFKHIRNVCGDK-------VVLIMGTGSNNTAQTIEDSRK-AEE
DAPA_FERNB       GTTGEGVTLTVEEREKLVALTKQICEGK-------AQVIVGTGTNDTRKTLELSLS-AEK
DAPA_THEMA       GTTGESPTVNEDEREKLVSRTLEIVDGK-------IPVIVGAGTNSTEKTLKLVKQ-AEK
DAPA_THEAB       GTTGEAPNISLDEREILIKKAKEVSGNK-------AKVIVGAGSNGINHTIELIKN-AEK
DAPA_THEM4       GTTGEAPNISIEERDKLIPFVREYFPDK-------P-LIVGVGTNSSHHTMELVKN-AEK
DAPA_KOSOT       GTTGEAPTVTSEERREIISFAVKKVGGR-------VPVIIGTGSNSTAHSIELSQE-AFE
DAPA_ALKOO       GTTGEASTQTMEEREALIRLAVQRVEGR-------IPVIVGTGSNCTDTALQYTRQ-AED
DAPA1_CLOAB      GTTGEASTMSLNERKETIKYTVETVNKR-------IPVIAGTGSNNTKSSVEMSIW-AEK
DAPA_CLOPE       GTTGEGSTMTLEEKKEVIKFSVEVVNKR-------VPVIAGTGTNNTKASIELSKY-AEE
DAPA_CLONN       GTTGEASTMTEEERKETIKFTVDTINKR-------IPVIAGTGSNNTEAAIKMSKW-AES
DAPA_CALBD       GTTGEPSTMPDDEHLEVIRFVIDRVAGR-------KPVIAGVGSNHTKHAVYLSKK-AQE
DAPA_THEP3       GTTGEASTMTQEEQQQAIKFTVEKVAGR-------IPVIAGTGSNNTAHAVEMSEY-AQS
DAPA_HUNT2       GTTGEASTMPDEEHKAVIKYTVEKVNKR-------VPVIAGTGSNDTIHAVELSKY-AEE
DAPA_LACP7       GTTGESSTLTHEEHIECIRFAIEYTKKR-------VPVIAGTGSNCTETAIYLSKE-AQV
DAPA_BRAHW       GTTAESATLTPEERMQVIKFCIERTKKR-------TIVIAGTGTNNTASAVEFSKK-SYE
DAPA_EXIS2       GTTGEGSTLTNEEFETLLETAIRVTAGR-------VPVIAGTGTNNTAQTIEKTQT-AAR
DAPA_EXISA       GTTGEGMTITDDEFETLLVRAVEVANGR-------AVIIAGTGSNNTAVSIEKTKR-AAE
DAPA_XANAC       GSTGEAAALSDDEYDTLLRAAAAQVAGR-------VPVLAGTGLSGTAKTIAQTRR-AAA
DAPA_STAAB       GTTAESPTLTTDEKELILKTVIDLVDKR-------VPVIAGTGTNDTEKSIQASIQ-AKA
DAPA_STAS1       GTTAENPTLTDEEKDQILEVVVNVVDGR-------VPVIAGTGTNNTQKSIQASVR-ARE
DAPA_MACCJ       GTTGEGSTLTEDEKLKTIEIAVRVAHGR-------VPVIAGTGTNNTQATIEHSLK-AKA
DAPA_ACAM1       GTTGESPTLTWQEEYELFQVVRKAVASK-------AKVMAGTGSNSTREAIEATQQAAKL
DAPA_THEEB       GTTGESPTLTWEEEFQLFQTVQQAVAGK-------AKIIAGTGSNSTREAIDATAKAAEL
DAPA_NOSS1       GTTGESPTLSWDEEYNLFVEVLQTVAGK-------AKVIAGCGSNSTKEAIAATQKAAKI
DAPA_MICAN       GTTGESPTLSWQEEYELFSIVKKAVNGR-------GKVIAGTGSNSTSEAIEATQQAAKL
DAPA_SYNY3       GTTGESPTLSWEEEHELFRVVKQTVGDR-------GSVIAGTGSNCTREAMEATQIAAKL
DAPA_SYNE7       GTTGESPTLTWEEELQLFRAVKEAVGDR-------AAVIAGTGSNCTREAIAATQSAATL
DAPA_SYNJB       GTTGESPTLTWQEEYELFRVVRDAVAGR-------AKVIAGTGSNSTREAIEATKKAAQL
DAPA_PROMA       GTTGESPTLSWEEQYQLLETVRNAVNGS-------AKVLAGTGSNSTSEAIHATAKAAEA
DAPA_SYNR3       GTTGESPTLSWDEQLALIKTVLDAVGEK-------VPVLAGTGSNSTAEAVEATREAAAL
DAPA_PROM5       GTTGESPTLSWDEQHNLFVAVKSSLNSR-------SKVIVGTGSNCTSEAIEATKKAYEF
DAPA_DESAP       GTTGESPTLSKEEKLELFRTVVDEVGGR-------AVVVAGTGSYSTKDSIALTQAAEKL
DAPA_DESRM       GTTGESPTLNKDEKIQLFKAVVEEVGGQ-------ATVIAGTGSYDTASSIILTKEAEKV
DAPA_HELMI       GTTGESPTLTKDEKIRLFSTVVDAVGDR-------ASVIAGTGSYDTEATIELSRKAKEA
DAPA_MOOTA       GTTGESPTLTHEEKIALFREVKKAVGDR-------AAVIAGTGTNSTAASIELSREAEAL
DAPA_SYMTH       GTTGESPTLSHEEKLRLFETVVDAVGGQ-------VSVIAGTGSNNTAESIRFSREAART
DAPA_DEHM1       GTTGESPTVTWEEEHALFAAVKSAVGNR-------GKVIAGTGANSTQEALENTLKAEKI
DAPA_NATTJ       GTTGESPTLSTEEKLTLFQLITEKVGGN-------ANIIAGTGSYSTKETLELTKKAEEV
DAPA1_BACHD      GTTGESPTLTTDEKMALFHTVVEAAGGR-------VPVIAGTGSNNTRASIELSKKVEDL
DAPA2_BACHD      GTTGESPTLREEEKLALFEKVVTVVNKR-------VPVIAGTGSNNTYVSAQLTKKATAL
DAPA_BACSU       GTTGESPTLSTEEKIALFEYTVKEVNGR-------VPVIAGTGSNNTKDSIKLTKKAEEA
DAPA_OCEIH       GTTGESPTLTHEERIKLFEYVVKKVNGA-------VPVIAGTGSNYTKASIELTKEVAKT
DAPA_LISIN       GTTGESPTLSHDEKMKLFRQVVETNAGR-------AKLIAGTGSNNTAETIAFTKEVAEL
DAPA_LACLM       GTTAESPTLTHDEELEIFASINQLVDGR-------VPLIAGIGTNDTRDSVEFIKEVAKL
DAPA_STRGC       GTTAESPTLTHDEELELFAAVQKVVKGR-------VPLIAGVGTNETRDSIEFVKEVDAF
DAPA_ENTFA       GTTGESPTLTHEEELQLFQRIIELIDGR-------IPIICGVGTNDTRDSVAFVKELATI
DAPA_LACAC       GTTGETPTLTHDEKIDLYKHFSQFVNKR-------VPIIAGTGSNNTAETIAFTNEVAQI
DAPA_LACRD       GTTGETPELTHDEKIELYQHFGEIVNGR-------VPVIAGTGSNNTKETIAFTNEVAQI
DAPA_LACF3       GTTGETPTLSHDEKIELYTHFGRLIAGR-------VPVIAGTGSNNTAETIAFTNEVAQI
DAPA_PEDPA       GTTGETPTLTHAEKLGLYTRFAEIVAGR-------VPIIAGTGSNNTQATIDFTKEVRQI
DAPA_LACP3       ATTGEGPTLSHPEKITLYTRFADMVHGR-------ALVIANSGSNNTKETAAFTHEVGGI
DAPA_OENOB       GTTGEAPTLSHDEKIELFKRTVDFVSGR-------AKVIVGTGSNNTKETIEFTKEAGRI
DAPA_LACS1       GTTGEAPTLSEDEKLQLIKDSVKFIDGR-------VPLMVGTGSNNTQQTIDYTNKVADI
DAPA_LEUCK       GTTGESPTLSHEEKLALTQHIAAYVPVD-------TLLIANAGTNNTVESVRNARELSEI
DAPA_LEUMM       GTTGESPTLSFEEKVELTRFIAKQVGNR-------ALLIANAGSNNTKESVEAAKALSKI
DAPA_ACIC1       GTTGESPTTTDDEKERLLRAVLDAVGD-------RATVVAGVGTNDTRHTIELAQR-AEK
DAPA_KINRD       GTTGESPTTSDEEKDRLLRAVLDAVGD-------RVHVLAGVGTNDTAHTLELARA-AEK
DAPA2_STRCO      GTTGESPTTSDAEKADLVRAVVEAVGD-------RAHVVAGVGTNNTQHSIELARA-AER
DAPA1_STRCO      GTTGESPTTTDAEKAALVTAVREAVGD-------RAALVAGVGTADTRHTVELALA-AEK
DAPA_CUTAK       GTTGESPTTTDSEKAEIVKAVVEAVGS-------DAAVVAGVGTNDTAHTIELAHQ-AAE
DAPA_CORA7       GTTGESPTTSLDEKLELFAAVKEEVGG-------RAKLCAGAGTNNTATSIEAARA-FAD
DAPA_CORDI       GTTGESPTTSLEEKIDLLKAVKAEVGD-------SAKLIAGAGTNNTAASVEMARA-SAE
DAPA_CORJK       GTTGESPTTGATEKLDLLRAVRSELGD-------SVKLIAGSGSYDTAVTVEMSRA-SQE
DAPA_MYCGI       GTTGESPTTTDDEKILLLRTVLEAVGD-------RARIVAGAGTYDTAHSIHLAKA-SAA
DAPA_BIFA0       GTTGESPTTHMDEKVELVKAVKEVV---------DVPVISGAGSNDTAHTVRMVEQ-TQE
DAPA_CHLMU       GSTGESLSLAYEEKFAALSFVSTLKLNV--------PLFLGVTATSIQEAISWIEF-AQR
DAPA_CHLTR       GSTGEGLSLTYEEKLSILSFVSTLNLNV--------PIFVGVTATSVQETMSWIDF-AQQ
DAPA_CHLAB       GSTGESLSMTAKEKESLVSYACSLNLKV--------PIIVGVPGTSLHEASEWIHT-CQS
DAPA_CHLFF       GSTGESLALTVQEKEKLVAYACSLDLKI--------PIIVGVPGTSLHEASAWVSL-CQS
DAPA_CHLPN       GSTGEGLSLTKKEKQALICFACDLQLKV--------PLFVGTSGTLLEEVLDWIHF-CND
DAPA_WOLPP       GSTGESLSLTDSEKRTLVEFVCELKLNT--------KIIIGVPGVNLYQTLEWLDF-CKG
DAPA_FRAP2       GSTGEALALDFDEQCEVVRFVTNLNLNV--------PIMVGVGGFQLTKQLQWIEF-CQT
                 .::.*                                   .                   

DAPA_AZOPC       GKIDAILSVVPYYNKPTQDGIYQHFKYIAQAT-SLPIILYNVPSRTGVNMTAETSLLLAN
DAPA_BACV8       TGVDAVLVAVPYYNKPSQEGIYQHYKAIAEAT-DLPVVLYNVPGRTGVNMTAETTLRLAR
DAPA_PORG3       TGVDAILSVAPYYNKPTQEGIYRHYRTLAEST-DTSIILYNVPGRTGVNIKSETTLRLAT
DAPA_FLAJ1       SAFEAILSVSPYYNKPTQEGIYQHFKAIAEAS-PVPVILYNVPGRTASNMLPSTVIRLAN
DAPA_GRAFK       DGFDAILSVSPYYNKPTQEGIYRHFEAISKAS-PLPIILYNVPGRTSSNVLPETINRIAR
DAPA_SULMW       DNFEAILSVCPYYNKPSQEGIYNHFKTISENT-DMKIIIYNVPHRTGTNINLDTINRLIN
DAPA_CYTH3       KGVDALLSVCPYYNKPSQEGVFQHYKAIAEKC-PVPVLAYNVPGRTGINISAKTSIRLS-
DAPA_KORVE       KGVDAILTASPYYNKPTQEGQYLHFKAIAEAV-DKPLVLYNVPGRTAANIETATLLRLA-
DAPA_ACIC5       PGVTAILVANPYYNKPTQQGLYEHFLAVARAV-ELPVVLYNIPSRTGCNLEPETVLRLVG
DAPA_CHLP8       AGAQAILSVAPYYNKPSQEGYYQHFRHVAESV-SVPIIIYNVPGRTASNVSAETILRLAH
DAPA_CHLPB       AGAQALLSVAPYYNKPSQEGYYQHYRRIAEAV-SIPVIVYNVPGRTGSNVHAETILRLAH
DAPA_CHLCH       AGAAAILSVAPYYNKPSQEGFYQHYRHIAEAV-AVPIIIYNVPGRTGCNVAASTILRLAR
DAPA_CHLT3       AGASAILSVAPYYNKPSQEGFYQHYKGIANAV-SVPIIIYNVPGRTGSNIAVDTIIRLAE
DAPA_SALRD       AGADGLLVVGPYYNKPSQAGFAAHVETIAAAA-EAPIILYNVPGRTSFNIAPETALHLAE
DAPA_PARUW       MGADAALIVTPYYNKPTQEGIFKHFEAINQAV-SFPICLYNIQGRTGQNIQTHTLKRIS-
DAPA_ARCB4       VGADGILSIAPYYNKPTQEGLYQHYKAIANSV-ELPLMLYNVPGRTGVDLLPETAIRLFD
DAPA_SULDN       CGVDAIFSVAPYYVKPSQEGLYQHYKAIAESVSDMPFMLYNVPGRTVVDISADTVIRLFD
DAPA_CAMHC       HGADAVLSVAPYYNKPTQQGLYLHYKEIANSV-EIPVLLYNVPGRTGCDIKADTVIRLFR
DAPA_HELHP       CGADALLCVTPYYNKPTQEGLFEHYKAVANAV-EIPVMLYNVPSRTGVSIEIETAKRLRD
DAPA_WOLSU       MGADGILCVTPYYNKPSQEGLFQHYKAVAESV-GIPLMLYNVPGRTGVNLETCTIQRLFN
DAPA_HELAH       VGADAILCVSPYYNRPTQQGLFEHYKTIAQSV-EIPVMLYDVPSRTGVSIEVPTALKLFR
DAPA_ACICJ       VGADGVLVVTPYYNKPTQDGLLRHFTAVADAI-GIPLIIYNIPPRSVIDMSVATMARLA-
DAPA_GLUDA       VGADGVLVVAPYYNKPTQEGLYRHFMTVADAT-DLPLIIYNIPGRSVVDISVETMARMA-
DAPA_GLUOX       VGADSVLVVVPYYNKPTQEGLYRHFMTIADAT-PLPMFLYCIPGRSVVDISVATMARLA-
DAPA_AGRFC       AGADALLVVTPYYNKPTQKGLFAHFSAVAEAV-KLPIVIYNIPPRSVVDMSPETMGALVK
DAPA_BRUAB       AGADAVLVVTPYYNKPNQRGLYEHFSRVARSI-SIPLVIYNIPGRSIIDMTPETMGALVR
DAPA_BARBK       AGADAVLVVTPYYNKPNQEGIYSHFATIAKAV-SIPIVIYNIPGRSVVDMAVETMKDLCQ
DAPA_METRJ       AGADAVLVVTPYYNKPTQAGLYAHFKAVNDAV-GIPIIIYNIPPRSVIDMSVETMARLF-
DAPA_NITHX       AGADAVLVVTPYYNKPTQEGMYHHFKTVNDAI-GIPIIIYNIPSRSVVDLSVETMARLF-
DAPA_PARL1       VGADAVLSVTGYYNKPSQEGIFAHFKAVNDAV-DIPIILYNIPGRTIVDITLETMTRLF-
DAPA_DINSH       AGADGALVVTPYYNKPTQGGMIAHYTALAEAA-DIPIVIYNIPGRSVVDMTPATMAALA-
DAPA_RHOCS       AGATAALVVTPYYNKPTQEGLYAHYKAIHDAV-DLPIVIYNIPGRSVVDMSVATMARLA-
DAPA_PELUB       AGADAALIVTPYYNKPTQEGLYQHYKAINDKC-GIPIIIYNIPGRSVIDMSVDTMARLF-
DAPA_CAUVC       VGADACLVVTPYYNRPSQEGMYQHYKAINDAV-ELPIFVYNVPGRTGVDISNDTLERLAK
DAPA_HYPNA       AGADAALVVSPYYNNPNQDGLFEHFRAINDAV-ALPVVLYNVPSRTVVDLKPETVARLAR
DAPA_NOVAD       CGAQAALCVAPYYNRPSQAGIIAHFSYLAEHN-DLPIVLYNVPGRTVTDILPETVCELAK
DAPA_SPHAL       SGADAALIVAPYYNRPSQEGMIAHFKALADAS-DLPIVVYNVPGRTVADISAETMCKLAE
DAPA_SPHWW       AGADAALVVLPYYNRPNQDGLIAHFRHLTDNC-TLPIIVYNVPARTVTDILPETLGALAG
DAPA_ZYMMO       AGAAAGLVVLPYYNKPSQEGLYAHYSYLAENS-PIPILIYNVPGRTSSDISVETLARLSR
DAPA_ANAMF       AGADAALIVVPYYNRPSDEGVYQHFRAVHDAT-NIPIVLYNVPQRTAIDISNDTIRRIAE
DAPA_EHRCR       LNVDAALVVVPYYNRPSDEGIYQHFKAVHDAT-NLPIIAYNIPNRSAIDASDALLARILS
DAPA_ACIF2       VKADAALLVSPYYNKPTQEGLFQHYSAIAEHC-HFPIILYNVPGRTAGDILPETVARLAP
DAPA_LEGPC       YGAHAAFIMTPAYIKPTQEGLYLHYSHIAQSV-AIPIILYNVPGRTACDMLPETVARLAK
DAPA_ACISJ       VGADSQLQVVPYYNKPTQEGQYRHFKAIAEAVGDLPMVLYNVPGRSVADMQHETVLRLTQ
DAPA_BORPE       VGAQAGLSVVPYYNKPNQEGIYRHFRAVAEAV-DLPTVLYNVPGRTVADMSNDTVLRLAE
DAPA_POLAQ       VGADASLQVVPYYNKPTQEGMYAHFKKIAESV-DLPVILYNVPGRTVADMAGDTVVRLAG
DAPA_RALSO       VGADASLQVVPYYNKPTQEGMYLHFRKVAESV-DLPVILYNVPGRTVADMSVDTMLRLAQ
DAPA_HERAR       VGADASLQVVPYYNRPTQEGMYQHFKKIVEAV-DLPAILYNVPGRTVADMSNETILRLAQ
DAPA_AZOSB       AGAVAHLSVVPYYNRPSQEGLYQHFRSVAEAV-ELPLILYNVPGRTVADLSNDTALRLAE
DAPA_NITMU       AGADASLSVVPYYNKPTQEGLYQHFRAVAEAV-DIPQILYNVPGRTVADIANDTVLRLAQ
DAPA_THIDA       AGAQAGLSVVPYYNKPTQEGLYQHYRKIAEAV-DLPLILYNVPGRTVADLANDTAVRLAE
DAPA_LARHH       LGADQVLSVVPYYNKPTQEGMYRHFRAIAEST-DIPVILYNVPGRTVADMCNDTVLRLAE
DAPA_MARHV       LGADACLLVVPYYNKPTQEGLYQHFKAIAEAVPGMSQILYNVPGRTACDMLNETVVRLAD
DAPA_CHRSD       VGADLCLSVAPYYNKPTQEGLYQHFKAVAEGG-GLPVILYNVPGRTCSDIYNETVFRLAE
DAPA_ALCBS       DGADACLLVTPYYNKPPQEGLYQHFLAIARAV-DIPQILYNVPGRTSCDLLPETVERLSK
DAPA_METCA       VGADACLLVTPYYNKPTQEGLYRHYLAVAEAV-DIPQILYNVPGRTGCDMLPATVGRLAQ
DAPA_PSEAE       GGADACLLVTPYYNKPTQEGMYQHFRHIAEAV-AIPQILYNVPGRTSCDMLPETVERLSK
DAPA_NITOC       AGADACLLVVPYYNRPTQEGLYLHFKAIAEAV-PIPQILYNVPTRTACDLLPETVARLAD
DAPA_THISH       AGADACLLVTPYYNKPTQEGLYLHHKAVAEAV-PIPQILYNVPGRTAVDMHNDTVVRLAE
DAPA_ALKEH       GGCDATLLVVPYYNKPTQDGLYRHFAAIADAV-AIPQILYNVPGRTACDLLPDTVDRLAD
DAPA_HALHL       AGCDAALLVVPYYNKPTQEGLVQHFSAIAEAV-PIPQILYNVPGRTGCDMLPETVERLAD
DAPA_SACD2       GGVDACLLVAPYYNKPTQEGLFLHHQKIAASV-AIPQLLYNVPGRTAVDMLPETIVRLSH
DAPA_TERTT       AKADACLLVTPYYNKPSQEGLYQHYCYLAREV-AIPQFLYNVPGRTAVDMLPETVARLAT
DAPA_RUTMC       IGADACLLVTPYYNRPTQEGLYQHYKLIAETV-DIDQILYNVPSRTAVDLCVETVLRLSN
DAPA_COXBU       LGADAALIVTPYYNKPTQEGLFQYFKTIAEAV-PIAQILYNVPSRTACDLLPETVIRIAK
DAPA_DICNV       CGCAASLQVTPYYNRPPQRGLYAHFAKIAAAA-PLPMILYNVPTRTACDIALETVTALAK
DAPA_ALISL       SGVAGCLSVTPYYNKPTQEGLFLHYKAISEST-DVPQILYNVPGRTAVDLLPETVARLAE
DAPA_VIBCH       TGIAGYLSVTPYYNKPTQEGLFLHYNAIAQET-DIPVILYNVPGRTAVDMRPETVARLSE
DAPA_HAEDU       VGVVGCLSVVPYYNKPTQEGLYLHYKAIAEST-ELPQILYNVPSRTGCDLKPETIGRLSE
DAPA_HAEIN       SGVAGCLSVVPYYNKPTQEGMYQHFKAIAECT-DLPQILYNVPSRTGSDMKPETVARLAE
DAPA_EDWI9       CGVVGCLSVTPYYNKPTQEGLYQHFRAIASCT-DLPQILYNVPSRTGCDMLPETVARLAQ
DAPA_ECOLI       SGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHT-DLPQILYNVPSRTGCDLLPETVGRLAK
DAPA_BLOPB       SDIAACLSVTPYYNRPNQEGLFQHFKAISEST-DLPQILYNVPIRTGCDMLPITVSRLAK
DAPA_BUCAI       SGVAGCLSVTPYYNRPTQEGLYQHFKAISENT-ELPQILYNVPSRTGCDLLPETVAKLSH
DAPA_BUCCC       SGISGCLNITPYYNKPTQEGLYLHFKSISEST-DLPQILYNVPHRTGCDLLPQTIAKLAK
DAPA_PSYIN       SGIIAGLNVTPYYNKPTQEGLFQHFKAIAESC-DLPQILYNVPGRTSVDMLPETVARLSK
DAPA_SHEB5       VGVAAMLGVTPYYNKPTPKGLIAHYKAVAAST-DIPQILYNVPGRTAVDMLPETVAELVS
DAPA_PSEA6       TGIDGFLSVVPYYNKPQQKGMVAHFNAVADAT-DLPVLLYNVPGRTVADMLPDTVAELAT
DAPA_IDILO       AGVSGFLNVTPYYNKPSLAGLIAHYQACADAT-DKPQILYNVPGRTSLDMTPDMVEQLAK
DAPA_NEIG1       AGADYTLSVVPYYNKPSQEGMYRHFKAVAEAA-AIPMILYNVPGRTVVSMNNETILRLAE
DAPA_PSYWF       AGADCALLVAPYYNKPTQEGLYQHYKAISEAV-DMPQMLYNVPGRTVVDIAQETVERLAD
DAPA_SORC5       AGAAGVMIVMPYYSKPSQDGLREHTLAVARAV-PAPIVLYNIPGRTVVDLSAETTERICA
DAPA_THERP       LGATAAMVVTPYYNKPQQDGLYRHVAAIADAV-DLPLVIYNVPSRTGVNLAPETARRLLD
DAPA_ANAD2       LGADAALVVTPYYNKPTQEGLFRHYQAIWEAT-RFPVVAYNVPSRTSVDLLPETVARLAK
DAPA_AQUAE       VGADGALVVVPYYNKPTQRGLYEHFKTVAQEV-DIPIIIYNIPSRTCVEISVDTMFKLAS
DAPA_HYDS0       VGADSALLVVPYYNKPTQEGLYRHFSKIAKEV-DIDIYIYNIPSRTGIEISVDTLERLAK
DAPA_PERMH       AGADGSLQIVPYYNKPTQEGIYQHFKAIAEET-SIPLILYNIPSRTGVDMLPETFARLYS
DAPA_THET2       AGAQGAMVIVPYYVKPNQEGLYRYFAEVARAVPDFPLLIYNIPGRAGVEIAPKTVGRLRR
DAPA_GEOBB       LGADGALLVTPYYNKPSQEGLFRHYKAVADAV-ALPQILYNVPGRTGVNLLPETVARLSV
DAPA_PELCD       MGADGALLISPYYNKPSQEGVYRHFKAIADNV-ALPQVLYNVPGRTGMNMTAATTIRLAS
DAPA_SYNFM       AGADGALLISPYYNKPTQEGLYRHYEKIAKAV-DIPLVPYNIPGRTAVNMEPDTIARLAK
DAPA_SYNAS       AGADGVLVVAPYYNRPTQEGLYQHYKALAESV-PIPIIPYNIPSRTGVNILPETVARLAK
DAPA_THEYD       LGADAALLVTPYYNKPTQEGLYRHYKEIADKT-GIPLILYNVPGRTSVNILPQTVARLAE
DAPA_DESPS       SGADAILSVAPYYNKPSQEGIYQHFKAIAEAV-DIPMFLYNVPGRTVVNIAPETTARLAG
DAPA_DESAG       AGADGALLITPYYNKPTQEGLYQHFKAIAAEV-SMPYIMYNVPGRTGVNMTSETVARVKR
DAPA_DESAD       AGADATLQITPYYNKPTPAGLLAHFKALSEEA-SMPFILYNVPGRTGLNALPETIAMIAN
DAPA_LAWIP       LGADGVLHVTPYYNKPTQEGLFQHFKTIASQE-SIPILLYNVPGRTGCNLLPETVARIVQ
DAPA_LEPBA       DGVDGILSVNPYYNKPTQEGMFQHFTAIANVS-SKPVMLYNIPGRTNVNLLPETVSRL-A
DAPA_LEPIN       DGVDGILSVNPYYNKPTQEGLFQHFKSIAEHS-TVPVMLYNIPGRTSVNLLPETVLRL-S
DAPA_ENDTX       VGCDGVLVVSPYYNKPTQKGLYLHFKTIADTI-DIPIVLYNIAGRTSINIEPATVAKLFK
DAPA_MAGMM       VGADGALLITPYYNKPTQAGLIAHYTTVANHT-KLPVVLYNVPGRTAVDMHADTVIAL-S
DAPA_HALMA       AGADALLLISPYYNKPEQQGFIDHYTTLADAV-DLPQIVYNVPSRTGQNIEPDTAAELAS
DAPA_NATPD       AGADGLLLISPYYNIPEPEGMETHYRTVADAV-DLPQIIYNVPGRTGRNIAVETAVSLAE
DAPA_METBU       AGASGALVISPYYNKPNKAGLISHFRTIAEAV-EIPIVLYNVPSRTGQDISLEVITELAK
DAPA_METAC       AGVDGVLLISPYYNKPNPAGLLAHFKKIAEAV-DIPMILYNVPSRTGQDMPVDVITKLAK
DAPA_METTP       AGADAALLITPYYNRPNERGLFEHFRKVAESS-DIPIVLYNVPKRTGVELRPDVVARLSE
DAPA_METMJ       AGADGALIISPYYNKPNRSGLIKHFTKLAD-L-DIPIVLYNVPGRTGQNLQPDLVAELAR
DAPA_METHJ       VGADGVLVISPYYNKPNRSGLIKHYTAIAD-L-DIPVVVYNVPGRTGQNITPDIIAELAK
DAPA_METLZ       SGADGVLLISPYYNKPNRSGLLKHYRKVAD-I-GLPVIVYNIPGRTGQNLPADLIIEMVE
DAPA_METJA       VGADAVLSITPYYNKPTQEGLRKHFGKVAESI-NLPIVLYNVPSRTAVNLEPKTVKLLAE
DAPA_METKA       VGADAILSVVPYYNKPPQEGLFIHFSKIAEAV-ECPIILYNVPSRTGCALEPETAAKLAE
DAPA_METTH       AGADAALVITPYYNKPQPHGLIEHYTMLEEAA-DIPLIIYNVPSRTGTDIDVDTVAELAK
DAPA_METST       AGADVALVITPYYNKPQQSGLYNHFKLLNDQC-DMPIIAYNVPSRTGVDLSVDNIINLAK
DAPA_METS3       LGADAALVITPYYNKPQQHALIKHYQAISDAT-DIPIIAYNVPSRTGVDMSVETIVELAK
DAPA_ARCFU       AGAEAAMLVTPYYNKPNAEGLYQHYKAVASEV-SIPIIVYNVPSRTGINTTPELVRRLAE
DAPA_RICM5       IGVDGFMASPPSYVKPTQHGIYKHFEALHEAC-NLPIMLYSAPTRSGVDFSDETILRLSK
DAPA2_CLOAB      YNIKGILSVCPYYNRPDQRGIYEHFKRISEST-SLDIVLYNIPYRTGRNIENDTIRRLSE
DAPA_WIGBR       INISGILISTPYYSCPTQNGIFNYFKEISKNT-DIPQIIYNNPKRTGCDILPETVSKLSY
DAPA_ACHLI       LGADALLIVTPYYNKPTQNGLLAHYKAVAKSI-NLPIMLYNVPSRTGVNLEVDTVKRLSK
DAPA_BDEBA       MGADAILVVVPYYNKPPQRGLYEHFKAVASSV-KIPTILYNVPGRTITSLETGTIRDLAK
DAPA_FERNB       SGADALLIVTPYYNKPTQEGLYAHYKYLSERL-SKPIIIYNVPSRTGVNISPETVARLAS
DAPA_THEMA       LGANGVLVVTPYYNKPTQEGLYQHYKYISERT-DLGIVVYNVPGRTGVNVLPETAARIAA
DAPA_THEAB       NGADGLLIVTPYYNKPTQNGLYEYYKYISEHT-DLEIIVYNVPSRTGINILPETVYKIAS
DAPA_THEM4       NKADALLVVTPYYNKPTQIGLYHYYKYISEHT-DLEIIIYNVPGRTGVNIAPETVYKLAS
DAPA_KOSOT       LGADGVLVVTPYYNKPTQEGLYRHYEAIAKSV-PGHVIIYNVPGRTGIDIIPETVLRCA-
DAPA_ALKOO       LGADGILVVTPYYNKCTQKGLIEHFTQIANAT-KLPVILYNVPSRTGVNILPETVATMS-
DAPA1_CLOAB      IGVDGVLVITPYYNKTTQKGLIEHFKSINDNI-NIPIILYNVPGRTGLNILPETLYAMRD
DAPA_CLOPE       VGADMVLIITPYYNKTSQKGLYAHFSAINDAI-NIPIMLYNVPSRTGMNITPLMLDKLAD
DAPA_CLONN       IGVDGVLVITPYYNKTTQKGIFEHFKAINDSI-NIPIVLYNVPSRTGLNITPKTLLKLCD
DAPA_CALBD       LGADGLLHVTPYYNKTTQKGLIEHFKEINDAV-SIPIIVYNVPSRTGLNVLPETMKELAK
DAPA_THEP3       AGADALLVITPYYNKTTQKGLVAHFTEIARHV-DIPIIIYNVPSRTSLNMLPETYLELSK
DAPA_HUNT2       VGADAILSVTPYYNKTTQKGLYEHFKLIAESI-KIPVVLYNVPGRTGLNIEPKTVKQLAE
DAPA_LACP7       AGADAVLLVTPYYNKATQKGLIEHFTAIAKSI-DLPVMLYNVPSRTGCNILPGTAATLVN
DAPA_BRAHW       YGADMVMAVTPYYNKGNESGLIDYYTQIANSV-KCPVIMYSVPSRTGVKLSLNVIKTLSE
DAPA_EXIS2       LGADAAMLVTPYYNKTSQAGLVAHFTAVADAV-DLPIMLYNVPSRTGVAISVETAVTLAK
DAPA_EXISA       LGAEMAMVVTPYYNKSTQAGLIAHFTAIADAS-PIPLMLYNVPSRTGVALAPETVGELAE
DAPA_XANAC       LGAQYALVVTPPYVRPTQAGLKAHFLAVADEG-GLPVVLYNVPGRTGCDLLPETVAELVG
DAPA_STAAB       LGADAIMLITTYYNKTNQRGLVKHFEAIADAV-KLPVVLYNVPSRTNMTIEPETVEILSQ
DAPA_STAS1       IGADAIMLITPYYNKTNQRGLIAHFTTIADAV-KLPVVLYNVPSRTNMTIDAETVETLSE
DAPA_MACCJ       LGVDSIMLITPYYNKTNQRGLLAHFTTIADAV-ELPVLLYNVPARTNMTIEQETVAALAE
DAPA_ACAM1       G-LDGALLVVPYYNKPPQEGLYEHFRAIAESVPDFPLMLYNIPGRTGQNLEADTVARLA-
DAPA_THEEB       G-LDGALLVVPYYNKPPQEGLYAHFQAIAKAVPDFPLMLYNIPGRTGQNLLPETVIRLA-
DAPA_NOSS1       G-VHGTLQVVPYYNKPPQAGLYQHFQAIAQACPELPLLLYNVPGRTGQNLSPETVVRLA-
DAPA_MICAN       G-LDGSLQVVPYYNKPPQEGLYEHFLTIAKACPDLPVMLYNIPGRTGQNMTPETIIKLA-
DAPA_SYNY3       G-VDGSLQVVPYYNKPPQEGLLAHFQAIANCAPELPLMLYNIPGRTGQSLAPETVYRLA-
DAPA_SYNE7       G-LNGSLQVVPYYNKPPQEGLYAHFRAIAEACPDLPLMLYNIPGRTGQSLQPETVARLA-
DAPA_SYNJB       G-LDGSLQVVPYYNKPTQAGLYEHFKAIAQA-SDLPILLYNIPSRTGASLQPETVAQLA-
DAPA_PROMA       G-ADGALVVVPYYNKPPQAGLESHFRAVAQAAPDLPLMLYNIPGRTGCSISPITVQRLM-
DAPA_SYNR3       G-AHGALVVVPYYNRPPQEGLEAHFRAVAAAAPELPLMLYNIPGRTGCSLHPATTARLL-
DAPA_PROM5       G-ADGALVVVPYYNKPPQEGLYNHFSSIATAASDLPLMLYNIPGRTGCNLLPTTVNKLM-
DAPA_DESAP       G-VDAVMLVCPYYNKPSQDGLYQHFRAVAES-TNLPVMIYNIPGRTSINLLPQTCARLA-
DAPA_DESRM       G-CDGVMLVAPYYNKPSQEGLYQHFRTIAEC-TSLPVMLYNIPGRTGINVLPATVERLAK
DAPA_HELMI       G-VDGLLLVGPYYNKPPQEGYYQHFAAVAKA-VPLPIMLYNIPGRTGSNIIPATVARLM-
DAPA_MOOTA       G-VDGLMLVVPYYNRPSQEGLYQHFKAIAAA-TTLPIILYNIPSRTGRNMDAATTLRLA-
DAPA_SYMTH       G-VHGLLLVTPYYNKPPQEGLYRHFRAVAEA-VDLPCILYNVPSRTSVNMLPATTLRLAR
DAPA_DEHM1       G-VDACLLVVPYYNKPTQEGLYLHFKTIAEA-TKLPCILYNVPSRTITHMSPETVIRLS-
DAPA_NATTJ       G-VHGIMLVTPYYNKPTQGDLYKHFKTIAQK-TSLPIMLYNVPKRTGVDMSQDTILKLA-
DAPA1_BACHD      G-VDGIMLVTPYYNKPSQEGLFQHFKAISES-TSLPIMLYNIPGRSGVNLDAETTLRLA-
DAPA2_BACHD      G-VDGIMAVTPYYNKPSQEGMYAHFAAIAEA-THLPVMLYNIPSRSVVNLSAETIVKLS-
DAPA_BACSU       G-VDAVMLVTPYYNKPSQEGMYQHFKAIAAE-TSLPVMLYNVPGRTVASLAPETTIRLAA
DAPA_OCEIH       G-VDGVMLVAPYYNKPSQDSMYEHFKVIAES-TELPVMLYNVPGRTGVDMDVSTVVRLS-
DAPA_LISIN       GGIDAVLVVAPYYNKPNQDGLYAHFVAVAEA-SDLPVVIYNIPGRSVVNIEPETIIRLA-
DAPA_LACLM       GYIDAGLAVTPYYNKPSQEGIYQHFKAIATA-SDLPIILYNIPGRVVTEILPDTILRLA-
DAPA_STRGC       GGFAAGLAIVPYYNKPSQEGMYQHFKAIADA-SNLPIIIYNIPGRVVVEMTPETMLRLA-
DAPA_ENTFA       AGIDAVLAVVPYYNKPNQEGMYQHFKTIAEA-SELPIILYNVPGRTAACLEVETTLRLA-
DAPA_LACAC       EGIDYALIVVPPYNKPNQRSMVAHFSAINDA-TKIPFLIYNIPGRTGVKMEKETIVQLS-
DAPA_LACRD       NGIDYALVVVPPYNKPNQRGMVAHFTAVADS-VDLPIIIYNIPGRTGVKMAQETVVELS-
DAPA_LACF3       EGIDYALVVVPPYNKPNQRGMLAHFTAVADA-VELPLIIYNIPGRTGVKMETSTVLTLA-
DAPA_PEDPA       DGIIAALVVTPYYNKPNQRGMVAHFKTVARQ-ADFPIMMYNIPGRTGVQMENATIVELS-
DAPA_LACP3       AGIDATLVVVPYYNKPDQNGMIAHYTAVAAA-AQKPIVIYNIPGRTGVDMLPATVATLA-
DAPA_OENOB       NGIDAALIVTPYYNKPDQAGMIAHFSTIADE-SPLPIVIYNIPGRSISALTVESLLKLA-
DAPA_LACS1       DGVDAALVVVPYYNKPNQKGMIAHFRKVADY-SNLPIIIYNIPGRTGVTMEVDTIIELA-
DAPA_LEUCK       PNVDAILAVTPYYNKPNQRGMIAHFTAIADA-SNRPVMLYNIPGRSAVGLTVDSVVTLA-
DAPA_LEUMM       EHINGILAVTPYYNKPSQAGMIAHFKAIADA-SEKPVMLYNIPGRTVVGLTVDSVIELA-
DAPA_ACIC1       AGAHGLLVVTPYYSKPPQAGLLAHFRQVADAT-GLPVMLYDIPGRTGTAIEPETMVRLAE
DAPA_KINRD       AGAHGLLVVTPYYNKPPQAALAHHFTTVADGT-GLPVMLYDIPGRSGVPIETETLVRVAE
DAPA2_STRCO      VGAHGLLLVTPYYNKPPQEGLYLHFTAIADAA-GLPVMLYDIPGRSGVPINTETLVRLAE
DAPA1_STRCO      AGADGLLVVAPYYSRPPQDALEAHFREVADAS-GLPVMLYDIPGRTGTRIEPDTVVRLAA
DAPA_CUTAK       AGADGLLVVTPYYSKPSQAGIIEHFTAVADAT-DLPIMLYDIPGRTGTPIETKTLIELAD
DAPA_CORA7       AGADSLLVVTPYYSKPSQAGVYAHFTAVADAV-DLPVCLYDIPGRSGIPIETETLLRLAE
DAPA_CORDI       AGADALLVVTPYYSKPSQEGIYQHFRTVSEAT-DLPICAYDIPPRSVVPIAPDTLCRLAA
DAPA_CORJK       AGADSLLVVTPYYSRPSQEGIYQHFTTVADAV-DIPVCVYDIPSRSVVPVEPETLHRLAD
DAPA_MYCGI       EGAHGLLVVTPYYSRPPQAGLVAHFTAVADAT-DLPNILYDIPPRSVVPIEWDTIRRLAQ
DAPA_BIFA0       AGADAVLVVCPYYSRPSQQGIFCHYQAVNESA-DKPIIVYDVPGRTGVRIALDTYVHLAE
DAPA_CHLMU       WPIDGFFVPTPLYTKPGLYGQKVWFEKILSVS-KKPIILYNNPSRTGVALHPEVVKSLAS
DAPA_CHLTR       WPIDGFLVPTPLYTRPGLNGQKAWFDRILSVS-RKPIILYNNPIRTGVSLYPEVVKSFVS
DAPA_CHLAB       YPIYGFLITTPIYTKPGVHGQTLWFESLLNKA-NKPAILYNIPSRSGTTLYLDTVRSLAA
DAPA_CHLFF       YPVDGFLITSPIYTKPGIQGQILWFESILNIT-NKPAILYNIPSRAGSPIYLETVRALSG
DAPA_CHLPN       LPISGFLMTTPIYTKPKLCGQILWFEAVLNAA-KHPAILYNIPSRAATPLYLDTVKALAH
DAPA_WOLPP       MPIHGYLMTTPIYAKPGIMGQTLWFEKLLEKA-HVPAMLYNIPSRAGVSLHAETVRNLSS
DAPA_FRAP2       QRVDCFLVVTPLYAKPGSASQTSWFKTVLDKA-ERPCMLYNVPSRTGVNLAEEVLTSLKD
                       :     *                          *    *               

DAPA_AZOPC       DF--ENIVAIKEASGNIDQIGVIIEN-----KPSGFQVLSGDDELSLSLIGIGA----VG
DAPA_BACV8       DF--KNIIAIKEASGNITQMDDIIKN-----KPANFDVISGDDGITFPLITLGA----VG
DAPA_PORG3       DC--PNIIGIKEASGNVDQVRAIVLE-----KPDPFIVLSGDDHLSLSFIKEGA----EG
DAPA_FLAJ1       DF--DNVVAIKEAAGDMAQALKIIKD-----APKDFLVISGDDMIALPIVLAGG----AG
DAPA_GRAFK       NL--KNVIGVKEAAGDIVQAMKMISL-----VPDDFKVISGDDMITLPMTLAGG----KG
DAPA_SULMW       NR--DNIIGIKEASGNIIQSYNFIKHK----IKKDFLVFSGDDTIGLPIVLGGG----DG
DAPA_CYTH3       EV--KNIFGIKEASGDLVQALEIIKN-----TPNEFLVISGDDLLAVPTISLGA----VG
DAPA_KORVE       KI--PNIIAVKEASGSLPQIMDVCAQ-----KPEDFTVLSGDDALTLPILAVGG----VG
DAPA_ACIC5       AA--PNIAAIKESSSNLPQIGELLTR-----APESFRVYSGDDNMALGTIALGG----AG
DAPA_CHLP8       DF--DNVLAVKEASANFEQIMTLIDE-----RPERFSVMTGEDGLMLPFMALGG----DG
DAPA_CHLPB       DC--ENIAAVKEASDNMAQIMELLAS-----RPDDFSVMTGEDSLILPFMALGG----DG
DAPA_CHLCH       DF--DNVLAVKEASENFTQISELLEE-----RPSNFAVLTGEDSLILPFMAMGG----NG
DAPA_CHLT3       DL--GNVLAVKEASGNMSQITEMLNR-----RPEKLAVLSGDDPLILPVMALGG----DG
DAPA_SALRD       EV--PHVAGIKEASGDIEQIDDLLAH-----RPDGFGVYSGDDEMTLPLLAMGG----DG
DAPA_PARUW       TL--SSIIGVKETSGDINQIMDVIEAF--RQSHPNFAILSGDDALTLPMIALGG----HG
DAPA_ARCB4       DV--KNIYGIKEATGSLERATSLMS------ARKDFVVVSGDDSVDFPMLASGA----RG
DAPA_SULDN       DV--KNIYGIKEATGSLERTVELLS------RRPELKVFSGDDAIDYPILANGG----AG
DAPA_CAMHC       EC--KNIIGVKEASGDIDRCVDLLS------REPHMTVVSGEDSINYPILANGG----KG
DAPA_HELHP       AC--KNIYAIKEAAGLMERVVAFGA------EVPNLALLSGEDVINYPILANNG----KG
DAPA_WOLSU       EV--KNIYGIKEASGSMERIVELNT------KIPDFAILSGEDAINYPVLANHG----VG
DAPA_HELAH       EV--PNIKAIKEASGSLKRVAELHC------YEKDFHIFSGEDSLNHSIMFSGG----KG
DAPA_ACICJ       QH--PNIVGVKDATANLTRPLHTTA---ACG--ASFCQLSGEDHTALAFLAAGGVG----
DAPA_GLUDA       QH--ARIVGVKDATANLLRPLQVRR---AIRH-KPFTQLSGEDGTVVSFLAAGGEG----
DAPA_GLUOX       EH--PNIVGTKDATANMARPIAVRR---AVD--KPFNQLSGDDNSVLSFLAAGGDG----
DAPA_AGRFC       AH--KNIIGVKDATGKLDRVSEQRI---SCG--KDFVQLSGEDGTALGFNAHGGVG----
DAPA_BRUAB       DC--KNIVGVKDATGKIERVSEQRA---ICG--KEFIQLSGEDATALGFNAHGGVG----
DAPA_BARBK       NF--KNIIGVKDSTGNIERVSEQRE---KCG--KDFVQLSGDDQTALGFNAHGGVG----
DAPA_METRJ       EL--KNIAGVKDATAKIDRVSQQRQ---AMG--DSFIQLSGEDATALGYNAHGGHG----
DAPA_NITHX       EL--KNIAGVKDATANVARVSLQRH---AMG--PDFIQLSGEDMTALAFMAAGGHG----
DAPA_PARL1       EL--KNVVGVKDATANLARVSLQRQ---EMG--AEFCQLSGEDATALGFNAHGGVG----
DAPA_DINSH       AL--PTIVGVKDATGDLARVSQTRM---ACG--PEFIQLSGEDATALGFNAHGGVG----
DAPA_RHOCS       KL--PNIVGVKDATGDLVRPLRTRI---EIG--PDFCQLSGEDATATAFLAQGGVG----
DAPA_PELUB       EL--KNIVGVKDATGDLDRVNQQKD---KMG--TDFVQLTGNDDNALEFNNRGGVG----
DAPA_CAUVC       L---PNIVGIKDATGDLTRISFQRL---MCGPE--WVMLSGDDPTALGYMAHGGHG----
DAPA_HYPNA       L---PNIVGIKDATGDMDRVSYHSA---LIGDEEQFVQLSGDDPSALGFLAMGGAG----
DAPA_NOVAD       RYP-DKIIGIKDASGDLSRVTDHRM---GIGKH--FCQLSGDDELALPANAAGAVG----
DAPA_SPHAL       I---PTVVAVKDASGDLARVTVHRK---GARHG--FCQLSGNDELWLPHAVMGGAG----
DAPA_SPHWW       I---KTIVGIKDASGKVERVSAQRQ---HCGPD--FCQLSGNDDMALGFMAMGGVG----
DAPA_ZYMMO       L---PAIVGMKDASGHIARVSAQRL---ACGSD--FCQLSGNDDMALAFNAMGGVG----
DAPA_ANAMF       L---PRVVGIKDCTG-AERVAALKA---ILP--EKVAILSGEDETALASYMNGGSG----
DAPA_EHRCR       L---PRIIGLKDSTGDVSRPLNLKL---LLN--KEVVLFSGDDSTCLGFYAQSGSGGRTG
DAPA_ACIF2       RA---DIIGIKEASGKVERVAEIL-----ALCGDQVQVYSGDDGAALAAMALGA----RG
DAPA_LEGPC       IS---NIIGIKEATGQMTRLQQIL-----RLCEGSIDVYSGDDLTAAQWLLSGA----KG
DAPA_ACISJ       VP---GIVGIKEATGNIERAQWLI-----RDVPKGFAVYSGDDPTAVALMLCGG----QG
DAPA_BORPE       VP---GIIGIKEATGDIARGALLL-----REAPAGFQVFSGDDPTAAALILLGA----RG
DAPA_POLAQ       VP---GIIGIKDATGSLERGTLLINDL-KRAGHHEFSVFSGDDLTAAMLMLMGG----HG
DAPA_RALSO       VP---GVMGVKEATGNIDRAAQLI-----KAAPASFKIYSGDDPTAVALMLLGG----HG
DAPA_HERAR       IP---SVIGVKDATGNISRGIDLM-----RLRPKDFAVYSGDDATAMALMLCGA----NG
DAPA_AZOSB       IP---NIIGLKDATGSIDRACDLI-----ERAPEGFALYSGDDMTVAAFILLGG----HG
DAPA_NITMU       IP---NIVGIKDATGDIGRGFDLL-----CRAPEDFAIYSGDDASALALLLLGG----HG
DAPA_THIDA       VP---GIVGLKDATGNMERAADLV-----RRVPKGFALYSGDDASALPFMLLGG----HG
DAPA_LARHH       IP---NIIGLKDATADLARCCDLV----KRAPK-DFALYTGDDATAMAFMLCGG----HG
DAPA_MARHV       IP---NIVGIKDATGNIPRGAELI----EALDG-RLAVYSGDDATAADLMLAGA----KG
DAPA_CHRSD       LE---NIVGLKDATGNLERAEELV----DRLKGSDFALYSGDDPTACDFMLMGG----HG
DAPA_ALCBS       VP---NIVGIKEATGNLERAREIR-----ERCSDDFMLYSGDDATAMDFILAGG----HG
DAPA_METCA       VP---GIVGIKEATGKLERLAEIR-----ALCPEGFALYSGDDATACEFCLSGG----NG
DAPA_PSEAE       VP---NIIGIKEATGDLQRAKEVI-----ERVGKDFLVYSGDDATAVELMLLGG----KG
DAPA_NITOC       IS---NIVGIKEATEDIARGRQIL-----ELCGDKLDLYSGEDSAAMEYMLIGG----RG
DAPA_THISH       IS---NIVGLKDATGDLDRARDLV-----ARCGGKIDLYSGDDATAMEFLLLGG----KG
DAPA_ALKEH       IS---NIVGIKEAS-TIERVHDLV-----ERCSDRLDVFSGEDGLSREAVLAGA----KG
DAPA_HALHL       LP---NVVGLKEAQGTVERAEEVI-----RRCGDRLDVFAGDDFNALGMMRVGG----KG
DAPA_SACD2       VD---NIVGVKEATGDIARVGQIL-----ESAKAGFLLISGDDDTAVDFIAAGG----VG
DAPA_TERTT       VE---NIVGIKDATASMERLQQMQ-----ALTDDSFIFLSGDDATSVDFMALGG----HG
DAPA_RUTMC       ID---NIIGIKDATGDLNVAKALI-----EQCADDFLFYSGDDATAVEFILMGG----HG
DAPA_COXBU       CS---NVVGLKEATGDIQRVKQLK--------AEDLDLLSGDDKTAMDFMLAGG----KG
DAPA_DICNV       IT---HIIGIKEATPHARLAQIRQ----LFPKNQSFKIYGGEDALCAQAACEGLI---DG
DAPA_ALISL       FD---NIVALKDATAELDRIAITR----ELCGDK-FIQLSGDDATALEFVKMGG----HG
DAPA_VIBCH       IK---NIVALKDATGDLSRVAKHR----EMCKEG-FVLLSGDDATGLEFVKLGG----QG
DAPA_HAEDU       IP---NIIGVKEATGDLTRLPLIK----TLAGED-FIFLSGDDATGLESMKLGG----QG
DAPA_HAEIN       IE---NIVGIKEATRDVSRIVKIK----QLAGKN-FIVLSGDDATGLEAIKLGA----EG
DAPA_EDWI9       IN---NIIAIKEATGNLSRVGQIQ----DLVNDDRFILLSGDDASALDFMCLGG----KG
DAPA_ECOLI       VK---NIIGIKEATGNLTRVNQIK----ELVSDD-FVLLSGDDASALDFMQLGG----HG
DAPA_BLOPB       IK---NIVGIKEATGNLNRVNQLK----QLVHED-FILLSGDDLSALDFMKLGG----VG
DAPA_BUCAI       FN---NIIGIKEATGDLSRIHKIK----ELVKTN-FLLISGDDATALDFMQLGG----QG
DAPA_BUCCC       FK---NIIGLKDASGDLSRVNQIK----SLVNKN-FILISGDDTTALDFIQLGG----NG
DAPA_PSYIN       IK---NIIGIKEATGDLNRLADIK----ALVADD-FALYSGDDATGCDFLLQGG----HG
DAPA_SHEB5       VS---NIIGVKEATGDLSRVKRLR----ELCGDD-FLLYSGDDATAREFLLLGG----NG
DAPA_PSEA6       HP---KIVGLKDATGDIARLKQMQ----PLVDKD-FVFLSGDDATGCEFLTAGG----HG
DAPA_IDILO       ID---NVIGIKEATGDVSRVQELK----ERCGDD-FILLSGDDPTAREFMFAGG----HG
DAPA_NEIG1       IP---NIVGVKEASGNVGSNIELI-----NRAPEGFAVLSGDDHTALPFMLCGG----HG
DAPA_PSYWF       FD---NIVAIKDATGSVERGKLLI-----DALGDRIVVLSGDDGTALELMKHGA----KG
DAPA_SORC5       AAPN--VVAIKDASGNVFRCQELVR----RLG-DRLTILSGDDALTLAMMALGA----QG
DAPA_THERP       IAP---VIAFKDSSGSLDQVSELVL----AVG-DRSSVLSGDDSLTLPIIAVGG----QG
DAPA_ANAD2       AGA---IAGIKEATANMDRQVQLVE----KVGKDAIAYLSGDDFTVLPYIACGG----HG
DAPA_AQUAE       E--CENIVASKESTPNMDRISEIV-----KRLGESFSVLSGDDSLTLPMMALGA----KG
DAPA_HYDS0       D--HKNIKGSKESTPNMDRISEIL-----KRI-PNFTVFSGDDSLTLPMMSLGA----KG
DAPA_PERMH       D--FPNVIGIKEATGNVARVSEMI-----SLTNPDVVILSGDDALTLPMMAVGA----KG
DAPA_THET2       D--FPNIVGLKHSSKDLEYLSHLF-----LEAGRDFLVFCGLESLTLPMMSLGA----VG
DAPA_GEOBB       ---HQNIVAIKEATGSLQQASEVL-----ALCGDKIDVLSGDDFITLPIMAAGG----KG
DAPA_PELCD       ---HPNVVGIKEASGDLTQASTII-----AEAGDQINVISGDDFLTLPMMACGG----KG
DAPA_SYNFM       ---IDNIVAIKEAAGSMKQITDII-----ARCGDELVVLSGEDFLTFPLLCVGG----KG
DAPA_SYNAS       ---ISNIVGIKEASGSLKQMNDVI-----RLCDDGFSVLSGDDFFTLPLLTLGG----KG
DAPA_THEYD       ---HPRIVGIKEATGDMKQVSELI-----RLCGDKITVLSGDDFTNLTLLALGG----KG
DAPA_DESPS       ---IDNIIGIKEACGCLEQISDVI-----RKCPEDFIVLSGDDFTSMPTNVIGG----KG
DAPA_DESAG       D--VPEVVGIKEASANLKQVSEII-----EFCGPDFQVLSGDDFTVLPLLSVGG----CG
DAPA_DESAD       E--VPDVVGVKEATANLGQVSDVI-----EQCPEGFTVLSGDDFTVLPLLALGG----HG
DAPA_LAWIP       D--IPEVVGIKDATGNLEQFSEII-----EFCPIGFQVLTGDDFTILPSMILGG----CG
DAPA_LEPBA       A--HPKIAAIKEATGDLGQMAKVI-----SQCPTNFDLLSGDDNLTLPVLSIGG----KG
DAPA_LEPIN       E--VKQIRSMKEATGDLGQMGKLI-----SLVGNKMTVLSGDDNLTLPLLAIGG----VG
DAPA_ENDTX       N--CKNIIGVKEASGSLDQMSAIK-----SLVPD-IELISGDDALTLPLLSIGG----IG
DAPA_MAGMM       K--VSNIVAIKEATGNMERASQIH-----KGAGSSMTLISGDDATFLPFLSVGG----QG
DAPA_HALMA       H---PNIRAYKAASGDMNQISEIIERTRDED----FAVLSGDDGMTLPMLSVGG----TG
DAPA_NATPD       H---ENIVGYKAASGDLNRVGEVIERTREEN----FEVLSGDDALTLPIIAQGG----TG
DAPA_METBU       I---DNIVGIKEASGNLDKASQIIENTMDED----FKVTSGDDGLTLPIMSIGG----CG
DAPA_METAC       V---ENIVGIKEASGSVGKVSQILEQTIDDD----FVVLSGEDGLTLPIISVGG----SG
DAPA_METTP       I---SNIVAIKEASGSLTQVSRIIELTADKN----FAVLSGDDDLTLPMLALGA----TG
DAPA_METMJ       H---PNIVGIKEASGDITQISRIIEETRDEE----FSVISGDDAMTLPVLAVGG----AG
DAPA_METHJ       H---PNIVGVKEASGDLGQISTIIELTRDED----FAVISGDDNLTLPILSLGG----KG
DAPA_METLZ       TI--PNLVAVKEASGNLDQMMAIIQGTQDLDREYPFILTSGDDSLTLPVLSVGG----HG
DAPA_METJA       EY--SNISAVKEANPNLSQVSELIHDA-------KITVLSGNDELTLPIIALGG----KG
DAPA_METKA       EY--SHIVGVKEASGDLDVVQRFIEETPD-----DFILLSGVDELTLPILAVGG----VG
DAPA_METTH       L---DGIIGIKEASPDLDKVSMLRSRL-MDLGLDDFTVLSGNDNLTLPMISMGA----EG
DAPA_METST       L---DNIVAIKEANPDLNKLAHVFSRLNSENLLDDFTVLSGNDSLTLPMISQGS----KG
DAPA_METS3       I---DGVDAVKEASGSVNKVSKLYKALTKEGLEEDFNILSGEDGLTLPIMALGG----TG
DAPA_ARCFU       I---DNIFGIKEASGNLKQISEIIRTTPDD-----FVLLSGDDFLTLPILCLGG----KG
DAPA_RICM5       LP---RILALKDCGVDLERPLRIRAT-----VKKDFNILTGNDEVVLAFNAQGG----VG
DAPA2_CLOAB      LD---NIVGVKDACGDFTQTTELLLN-----RPDNFSILTGEDAFFYSTLMLGG----DG
DAPA_WIGBR       IK---NIIGIKDSSKDLSRVKKIKFF-----SKKNFCLLCGDDINILDFMQLGG----CG
DAPA_ACHLI       ---VKNIIGIKEASGNLEQVKSIIDQTHED-----FIVLSGNDDQVYDVLSLGG----HG
DAPA_BDEBA       ---VKGVVGIKEATGKIDLASEIIKACGSE-----FVMLSGDDGTYVEFLGVGG----HG
DAPA_FERNB       D--CKNIVAIKEANTDVNQADEIYRLTN-----GDFYIYSGNDDRAFHMICAGA----KG
DAPA_THEMA       D--LKNVVGIKEANPDIDQIDRTVSLTKQAR--SDFMVWSGNDDRTFYLLCAGG----DG
DAPA_THEAB       D--CKNVKALKEANSSFEQINKDLLLLKEL---KDFKIFSGNDDTAFQLLASGG----DG
DAPA_THEM4       D--CKNITALKEANSSFDQINKVLHLKPE-----TFKVFSGNDDISFQFLASGG----NG
DAPA_KOSOT       Q--IENIVGIKEASGNQAQVDELLRLKAKVR--PEFKIWSGNDDQAFHLVCSGG----DG
DAPA_ALKOO       K--VENVIGIKEAGGNTAQVLEIKRLVPE-----DFKIYSGNDDQIIPIYACGG----HG
DAPA1_CLOAB      ---LKNICAIKEASGNISQIAKIKALCRDR-----FDIYSGNDDQIVPILSLGG----SG
DAPA_CLOPE       ---LNNVVAIKEASGDLSQVAKMAELCGDR-----IAIYSGNDDQIVPILSLGG----AG
DAPA_CLONN       ---LNNVVAIKEASGNFSQLVEMKALCRDK-----IDLYSGNDDQVVPLLSLGG----IG
DAPA_CALBD       ---LPNVKAIKEASGNITQVAEIAMLCPE------IDIYSGNDDQIVPILSVGG----IG
DAPA_THEP3       H--VDNVVGVKEASGDIVQVAEIARIMGKS-----FEIYSGNDDQVIPIMSLGG----LG
DAPA_HUNT2       ---IENIVAIKEC--NINQVGEIISICPPD-----FTVYSGNDDMVVPLLALGG----KG
DAPA_LACP7       T--VDNIVAMKEASSNIAQVAELAHTCEGK-----LDIYSGCDDSIVPVMSLGG----LG
DAPA_BRAHW       ---ISNIQGIKEASGDISYVADIVNVAPK------LDLYSGNDDMVTPMMALGA----KG
DAPA_EXIS2       HP---NIQAFKEASGDVSFMGELMTAL-----PDGFAVFCGNDDQILPYMAWGA----QG
DAPA_EXISA       HP---RITALKEASGDISVMAQMMAHI-----PEGFTVYCGNDDQILPYMAWGA----QG
DAPA_XANAC       HP---NIVGIKEARSEPERVAALVALR-----SDSFVVLSGDDGSAAHAMLSGA----AG
DAPA_STAAB       HP---SIVALKDATNDFEYLEEVKKRID----TNSFALYSGNDDNVVEYYQRGG----KG
DAPA_STAS1       NE---YIVALKDATNDFDYLEDLKQRLN----LDEFALYSGNDDNIVDYFNQGG----HG
DAPA_MACCJ       HP---YIYGIKDATGDINYMKTLKSVV-----PDDFALYSGNDDAVLPFYEAGG----DG
DAPA_ACAM1       --EIGNIVAIKEASGNLDQVSQIRRL----TPPE-FSIYSGDDSLTLPYLSVGA----AG
DAPA_THEEB       --EYPNIVAIKEASGSLDQASTLRAA----LPPT-FRIYAGDDSLTLPLLAVGG----YG
DAPA_NOSS1       --EIDNIVGVKEASGNLDQAGEIRRL----TPKE-FQIYAGDDSLTLPLLAIGA----KG
DAPA_MICAN       --AVDNIVAVKEASGNLEQTCKIYCH----TPEN-FAIYSGDDFLTLPLMTCGA----VG
DAPA_SYNY3       --EVENIVAIKEATGSLEQASLIRAH----TPDD-FAIYAGDDVLTLPLLAVGG----AG
DAPA_SYNE7       --SLPNVVAIKAASGNVEEVSALRQL----LPDS-FAIYSGDDSLTLPMLAVGA----QG
DAPA_SYNJB       --ELETVVAIKEASGMMDVASEIRRL----TPSR-FAIYSGDDSLTLPLLSLGG----SG
DAPA_PROMA       --NCSNIVSFKAASGTTNEVTDLRIR----CGSR-LAIYSGDDGLLLPMLSVGA----VG
DAPA_SYNR3       --DCDNVVAYKAASGTTSEVSALRLA----CGSR-LAIYSGDDGLTLPMLAAGA----VG
DAPA_PROM5       --NFPNILSIKAASGRIEEVTELRAA----CGPK-LFIYSGDDSLLLPMLSVGA----VG
DAPA_DESAP       --EIGNIVAIKEASGNMDQATELRRL----LPDH-FHIYSGDDSMTLPLLAVGG----KG
DAPA_DESRM       --DVPNIVAIKEAAGDINQVSELRRI----LPED-FIIFSGDDSLTLPMLSLGC----KG
DAPA_HELMI       --AFDNIVAIKEAAGSMDQVSEVVRL----ARPD-FKVYSGDDSLTLPILSVGG----HG
DAPA_MOOTA       --EIKNIKAVKEASGDLDQATAILRQ----APAD-FLVYSGDDSLTLPLMAVGG----YG
DAPA_SYMTH       --DVPNIVGIKECA-DVGQLADILSG----APEG-FRVWSGDDANLLPYLTVGA----YG
DAPA_DEHM1       --QIPNIVGVKEASGKLDDIAQIINN----VRPD-FTVWSGNDSDTLPMLAMGA----YG
DAPA_NATTJ       --EIDNIIALKEASGDFNKIANVIRE----TRGE-FDVYSGDDISLMPVLSLGG----TG
DAPA1_BACHD      --ELRNIVSIKEASGNLDQIAEIIEH----SPAD-FSVYSGDDSLTLPLLSIGG----TG
DAPA2_BACHD      --YIPNITSLKEANGDLDHMVSVIEQ----TPDT-FHLYSGDDSLTLPALSIGA----KG
DAPA_BACSU       --DIPNVVAIKEASGDLEAITKIIAE----TPED-FYVYSGDDALTLPILSVGG----RG
DAPA_OCEIH       --QIDNIVSIKDASGNLEKMTNIIRL----TDDN-FSVYSGEDSLTLPALAIGA----DG
DAPA_LISIN       --KLPNIIGVKESSGNLDNISKIIAE----TSDD-FLVYSGDDSLTLPILAVGG----NG
DAPA_LACLM       --QLENVIAVKECTS-TDNLAYLIEN----VPED-FLVYTGEDGLAFHAKTLGG----QG
DAPA_STRGC       --EHPNIIGVKECTS-LANMAYLIEH----RPEE-FLIYTGEDGDAFHAMNLGA----DG
DAPA_ENTFA       --QLEKIVAIKECAG-LDAITELIER----APKD-FLVYTGEDGLAFATKALGG----QG
DAPA_LACAC       --RLDNIKGIKQCAS-LEEMEYIIEN----KDPD-FQVFTGEDTQALTARLLGA----NG
DAPA_LACRD       --HHQNIAAVKQCTS-LEELEYIVEH----RDPD-FAVFTGEDAQALTARVLGA----NG
DAPA_LACF3       --EHPNIAGIKQCAS-LEEFQTLVEN----RPAG-FAVYTGEDAQALTTKVLGG----DG
DAPA_PEDPA       --QEPNIIGIKQCTN-LNDIGFLVEN----TPND-FAVYTGNDPETLGAVALGA----NG
DAPA_LACP3       --QNPMIQGIKQCGS-LPALSDIIDR----TKHDAFNVWTGEDAQALNIKTLGG----MG
DAPA_OENOB       --DHPNIIAVKQCNS-DYDMSELIEH----APKD-FLVYTGEDGQSFLNYALGG----AG
DAPA_LACS1       --QHDNIIGIKDCTG-VENIAKIVEN----VPED-FLVYSGEDAEALSARVLGG----QG
DAPA_LEUCK       --QHPNINAIKETTS-VAFIAAEIEQ----TQNDDFAVYTGEDAQTLAAFVHGG----AG
DAPA_LEUMM       --QHPNINAIKETTS-TEFVEAEVEG----ATG--FAVYTGEDAMTLSAYTVGG----AG
DAPA_ACIC1       HE---RIVAVKDAKGDFEASSWVLAR-------TDLAYYSGDDKNTLPLLAIGA----VG
DAPA_KINRD       HE---RIVAVKDAKGDSWGTSWVLAR-------TELAYYSGDDAVNLPLLAQGA----SG
DAPA2_STRCO      HP---RIVANKDAKGDLGRASWAIAR-------SGLAWYSGDDMLNLPLLAVGA----VG
DAPA1_STRCO      HP---RIVAVKDCAYDLLGTQKVLSR-------TGLAYYAGCDEQILPLYAIGA----AG
DAPA_CUTAK       HA---RIVAVKDAKGLVVESATVMAS-------TTLAYYSGDDAITPALLSVGG----VG
DAPA_CORA7       VP---NIKAVKDAKGDLVAAAPLIQE-------TGLAWYSGDDGLNLPWLALGA----SG
DAPA_CORDI       LP---MIKAVKDAKGDITAATTLIAE-------TGLAWYSGDDPLNLPWLSVGA----TG
DAPA_CORJK       HP---QIAAVKDAKGDLAAGMELIEN-------TDLAWYSGDDPLNLPWLAAGA----TG
DAPA_MYCGI       HP---NIVAIKDAKADLHGGGQIIAE-------TGLAYYSGDDALNLPWLAMGA----VG
DAPA_BIFA0       LD---HVKAVKDATGDIAGAVRKRME-------TGLTWYSGDDALYLPFLSIGA----VG
DAPA_CHLMU       HP---LCMGVKDSGGSTQACTLFAE--------SGVRVFCGDDGMWPEMRLSGA----SG
DAPA_CHLTR       HP---LCIGVKDSGGSAQACELFAE--------SGLRVFCGDDNLWPDMRLSGA----SG
DAPA_CHLAB       HP---FFYGLKDSGGSIKHCQEYAQM------SSDFVLYCGDDGLWPQMYECGA----RG
DAPA_CHLFF       HP---FFYGIKDSGGSIDRCREYTQV------CPNLIIYCGDDGLWPQMHQCGA----RG
DAPA_CHLPN       HP---QFLGIKDSGGSVEEFQSYKSI------APHIQLYCGDDVFWSEMAACGA----HG
DAPA_WOLPP       HE---KFWAIKDSSGTVDTLTQYKKV------APNIEVFCGDDNMIPDMAAKGA----AG
DAPA_FRAP2       HP---NLWALKEASGDIQRCARYQEL------APNLVIYSGEDGLLPELADVGV----KG
                         . *                             * :                 

DAPA_AZOPC       VISVIGNVFPKEFGKMIRLALNGDSD---NARIIHGQFAELFELLFI--EGNPAGVKGML
DAPA_BACV8       VISVIGNAFPREFSRMTRLALQGDFA---NALTIHHKFTELFSLLFV--DGNPAGVKAML
DAPA_PORG3       VISVIGNAYPELFSRLIHLCLENRFE---EAETIQQRLEGMCYLMFV--DGNPAGIKELL
DAPA_FLAJ1       VISVIGQGYPKEFSEMIRLGLNKKAV---EAFKTQYFLSDCIDMIFE--QGNPAGIKQVF
DAPA_GRAFK       VISVIGQGLPKEFSNMVRAGLEGKVS---EAYQLHYKIAPSIEFIFA--EGNPAGIKTLL
DAPA_SULMW       IISVIGQAFPKELDFIYKFAYKNQVN---KAYKLYYKIFKILNLVFK--EGNPSGIKTLL
DAPA_CYTH3       AISVLSNTYPAKFSEMIKAAIQSRFQ---QATQILARFTEMNPLMYE--EGNPVGVKSLL
DAPA_KORVE       LVSVASNQIPKELSEMVRAALNNDWA---TARKLHNHFLALMNANFL--ESNPGPVKAVL
DAPA_ACIC5       LVSVASNEIPREMAEMVRAAVQNDWA---LARQLHRKYFPLLQANFL--ETSPGPVKAVL
DAPA_CHLP8       VISVAANQVPKVVKGLIDAMKAGNLE---EARAINRKYRKLFRLNFI--DSNPVPVKYAL
DAPA_CHLPB       VISVAANLLPAEVKQLVTEMHEGDLE---KARVIHNRLRRLFSLNFI--ESNPVPVKYSL
DAPA_CHLCH       VISVAANEIPAQIRQLVESAGSGDLV---TARTLYSRYRKLLKLNFI--ESNPVPVKYAL
DAPA_CHLT3       IISVAANQVPKTVKDLVEAMFASDLT---TAQKIHNQYYNLFTLNFI--ESNPVPVKYTL
DAPA_SALRD       AVSVISNALPGPFCELVAAGLDDDLA---TARDRHAELLPAMRACFL--ETNPVPIKDVC
DAPA_PARUW       IISVVSNLVPAAMKSLVNAALNGNFK---KARIIHNQLYSFIKAAFI--ETNPIPIKAAL
DAPA_ARCB4       IISVTSNLLPNLKSKLVSSVLEGDYK---TSLSIHNDLYELNKTLFC--ESNPIPIKAAM
DAPA_SULDN       ITSVTSNLLPDLKSELVKKALNGDFT---GSKAINDMLFPINKALFI--ESNPIMIKAAM
DAPA_CAMHC       VISVTANLLPDYVAKLCDYALKGDFV---KSREINNELYELNKILFV--ESNPVPIKAAM
DAPA_HELHP       VISVTGNLFPQEIADLTHYALQGNME---KSYEINTRLYEMNRILFC--ESNPVPIKAAM
DAPA_WOLSU       VISVIGNLLPDKISALVHKALQGELD---ESRRINNSLYKINKALFV--ESNPIPIKAAM
DAPA_HELAH       VVSVTGNLMPNLISQMVNCALKHEYQ---QALEIQDKLFSLHQALFV--ETNPIPIKMAM
DAPA_ACICJ       CISVTANIAPRLCAEMQAAWRAGDLK---TAMAIQSRLLPLHDAMFA--ESNPAPAKYAA
DAPA_GLUDA       CISVTSNIAPRLCAELHRAWQDGRVA---DAMAIQDRLSAVHDALFC--ESNPGPVKYAA
DAPA_GLUOX       CIGVTSNVVPHLCADMHLAWQEGRIE---DAIAIQDHLTPLHDAMFM--ESNPGPVKYAL
DAPA_AGRFC       CISVTANVAPRLCSEFQAAMLAGDYA---KALEYQDRLMPLHRAIFM--EPGVCGTKYAL
DAPA_BRUAB       CISVTSNIAPRLCAEFQEACQAGNFA---KALELQDRLMPLHKALFL--EPNPSGPKYAL
DAPA_BARBK       CVSVASNVAPKLCAELYAACRSGDYK---TALELNDRLMPLNRSIFI--EPSPSGIKYAV
DAPA_METRJ       CISVVANVAPRLCADLQEATLAGDYA---KALTLQDRLFPLQTGLFA--EANPAPVKYAL
DAPA_NITHX       CVSVVANVAPKLCASLMSAVLKGDYA---TGLAIQDRLVPLHAAIFK--EPGLAGAKHGL
DAPA_PARL1       CISVTANVAPALCSAFQEATLDGDYR---KALEIQDRLMPLHNALFV--DPNPAPVKYAA
DAPA_DINSH       CISVTANVAPALCAQFQEATLAGDFA---TALALQDKLMPLHEAIFV--EPGLVGAKYAL
DAPA_RHOCS       CISVTANVAPGLCARMQDAWARGDLA---EMARVRDLLMPLHHALFV--ETSPGPVKYAA
DAPA_PELUB       SISVTANIAPKLCSDFQKASKIENNESKLEAIRLDKILQPIHSSMFI--ESNPSPVKYAA
DAPA_CAUVC       VISVTSNVAPDACSAFMNACMQGEWE---KGLYWQDRLVRLHKALFL--DSSPAPTKFAM
DAPA_HYPNA       CISVTANVAPELCAAMHLAFEDGDLE---SARAIERRLINLHRAMFC--SPSPGPAKYAL
DAPA_NOVAD       CISVTANVAPRLCADFQAACAANDLE---KARELNDKLYPLHYAMFE--DASPGPVKYAL
DAPA_SPHAL       CISVTANVAPRLCADFAAACAAGEWT---RALALHDRLFDLHKAMFS--DTSPGPVKYAL
DAPA_SPHWW       CISVTANVAPGLCAEFQTACADGRWA---DALALQDKLFPLHAALFS--DASPGPVKYAL
DAPA_ZYMMO       CISVTANVAPKLSADFQKACAENRYQ---DALALQDRLYPLHSALFS--DSSPAPVKYAL
DAPA_ANAMF       CISVVSNVAPKMAVELYRLHALGKIN---MAKQVSGNLAALSRVLFI--EPSPSPTKYAL
DAPA_EHRCR       CISVVSNVIPKIHADMHNAFLANNMK---EAMNANLSVFKLAKALFC--QSSPAPTKYAM
DAPA_ACIF2       VISVTANAAPRLMARMCDLALAGDFV---GARAVNAQLTGLHRDLFL--ESNPIPVKWAL
DAPA_LEGPC       VISVTANVAAKLMAKMCDLAMDDDQA---GCLRIQEQLMPLHELLFV--ESNPIPVKWAM
DAPA_ACISJ       NISVTANVAPRLMHELCVAALAGDTR---RAMEIQFRLMPVHKQLFV--EANPIPVKWAV
DAPA_BORPE       NISVTANVAPRLMHELCTAARGGDVP---RTRELNARLARLNKALFI--EANPIPVKWAL
DAPA_POLAQ       NISVTANVAPRLMHELCVAAMSDDVK---RTREIQYQLIAVHKAMFI--EANPIPVKWAL
DAPA_RALSO       NISVTANVAPRAMHDLCAAAMRGDVE---TARRIHMQLLSVHKNLFV--ESNPIPVKWAL
DAPA_HERAR       NISVTANIAPRGMHQLCDAAINQRVA---EAIAINNKLVPLHNKLFI--EPNPVPLKWAM
DAPA_AZOSB       TISVTANVAPRAMHEMCAAALAGDAA---KARTINARLVGLHRHLFC--EANPIPVKWAV
DAPA_NITMU       VISVTANVAPKLMHEMCIAAFAGDLA---AARAANRKLLRLHLDLFI--EANPIPVKWAV
DAPA_THIDA       VISVTANVAPRLMHEMCVAAFEGNLA---RARECNDALLPLHSKLFV--EANPIPVKWAC
DAPA_LARHH       VISVTANVAPRQMAELCRAAIAGDVQ---AARRINDPLQGLHKDLFC--EANPIPVKWAL
DAPA_MARHV       NVSVTANVAPKAMAELCEAAIAGNED---ETRRLNELLMPLNRKLFL--EANPIPVKWAL
DAPA_CHRSD       DISVCANVAPRAMHELCEAAVAGDDE---RAHQINTRLMPLHTALGV--EANPIPVKWAL
DAPA_ALCBS       DISVTANVAPAKMAAMCEAALAGDAD---TARALNAELEPLHRDLFI--EANPIPVKWAL
DAPA_METCA       VISVTANVAPRLMQEMCRAAIAGDRA---TAEAINRRLEALHHDLFI--ESNPIPVKWAL
DAPA_PSEAE       NISVTANVAPRAMSDLCAAAMRGDAA---AARAINDRLMPLHKALFI--ESNPIPVKWAL
DAPA_NITOC       TISVTANVAPKAVHEMCTVALQGNRK---AAEAINTRLCPLYAALFS--EVNPIPVKWAL
DAPA_THISH       VISVTANVAPAEMHQMCEAAMRGDRA---AAEAINARIDLLHRNLFL--EANPIPVKWAL
DAPA_ALKEH       VISVTANVAPQQMHDMVAAALRGDEE---EASRIDARLAALHSALFL--ESNPIPVKWAV
DAPA_HALHL       VISVSANVVPRQMHDLCAAALAGDMQ---TAEAINERLTPLHQAMFC--EPNPVPVKWAV
DAPA_SACD2       EISVTANVAPKLVAQMCELAAQGKVE---EARAINARLADVHTAMFL--ESNPIPVKWAL
DAPA_TERTT       EISVTANVVPAQTAKICELALAGNVE---QARELDRPLAPLHEALFL--EANPVPVKWAM
DAPA_RUTMC       GISVTANITPKQVASAYQFALENDRE---LAESTNAPLADLHQHLFI--ESNPIPIKWAM
DAPA_COXBU       VISVVANVVPKPYHAFCITAVSGNVE---LAKKENDQLSPLYDSLFV--ESNPIPVKWAL
DAPA_DICNV       VISVTANVAPEAMQNMMHCALNGDLK---QAQAINQRLAALHESLFC--ETNPIAVKWAL
DAPA_ALISL       VISVTANVAAKDMATMFALAAQGKFE---EAEIINQRLMPLHQDLFV--EANPMPVKWAT
DAPA_VIBCH       VISVTNNIAAADMAKMMHLALDGKFD---EAAIINQRLMTLHKNLFI--ESSPIPVKWAA
DAPA_HAEDU       VISVTNNLAAADMAKMCELVLAGNFA---EAEAINQRLIDLHHDLFI--EANPIPVKWAA
DAPA_HAEIN       VISVTNNIAAKDMADMCRYALAGDFD---KAEEINARLMRLHHDLFI--ESNPIPVKWAA
DAPA_EDWI9       VISVTANVAARQMAEMCRLTLAGDVH---AARRLNQSLMPLHRDLFI--EANPIPVKWAT
DAPA_ECOLI       VISVTANVAARDMAQMCKLAAEGHFA---EARVINQRLMPLHNKLFV--EPNPIPVKWAC
DAPA_BLOPB       VISVTANIAAKEMAELCKLANENDFS---TAQHINQRLMPVHQALFI--DSNPIPVKWAC
DAPA_BUCAI       VISVTANIAAKEMMEICSYALKGDFI---NARSINKRLMLLHEALFI--EPNPIPVKWLA
DAPA_BUCCC       VISVTANIAARHISKICKLALAGNFY---KARKINEKLKILHNLLFK--ETNPIPIKWAA
DAPA_PSYIN       VISVTTNIAPVEMAKMCEYALSGQAD---LAKKIDNQLAPVHKYLFI--ESNPIPVKWAC
DAPA_SHEB5       VISVANNIVPQAFKAMCDAALAGNAE---LALSIDTPLRGLYSTLFC--EANPIPVKWAA
DAPA_PSEA6       VISVTANVVPKQMSQMCEAALAGNYS---KAKEIDQQIAELHSALFI--EPNPVLPKWAL
DAPA_IDILO       VISVTANIVPAKMKELVTAALAGDKE---SANQIDAELAPLHNMLFV--ESNPIPVKWSL
DAPA_NEIG1       VITVAANAAPKLFADMCRAALQGDIA---LARELNDRLIPIYDTMFC--EPSPAAPKWAV
DAPA_PSYWF       NISVTANIVPKAMSDVFSAALKGDFE---TAKKVHDSIEPLHKLMFV--ESSPIPVKYAL
DAPA_SORC5       VISVTSNVLPRETSAVTRRFLAGDLA---GARAAHLALLELHGLLFV--EPNPAPAKAAL
DAPA_THERP       VVSVLANIAPAATATMVRAALDGDLA---RARQLHGELFPLARALFI--ETNPVPVKTAA
DAPA_ANAD2       VISVIANVAPRAMKELVVAARSGDLA---GALAKQAAMAELNRMMFV--ETNPGPVKAAV
DAPA_AQUAE       VISVANNVMPREVKELIRAALEGDFR---RAREIHYYLHDLFKVLFI--ETNPIPVKTAC
DAPA_HYDS0       VVSVISNVMPKEIKEFTSYALKGDFE---KARDMHYYLLEIFKIMFI--ETNPIPVKTAL
DAPA_PERMH       VISVANNLVPEDIATMCRLALEGRFE---EARQIHDRYWKLFKTLFI--ETNPIPVKTAA
DAPA_THET2       TIAATANWLPKEVALLCEKALAGDYQ---GARELHFYLLEANEAIFW--DTNPIPLKTVL
DAPA_GEOBB       VISVTANIMPKEVSSLVDAFNAGNME---EARRLHLYLLKISNAMFI--ESNPVPVKAAV
DAPA_PELCD       VISVTANILPGEVKAMVTAVNENRYA---DAKKIHLNLLNLHQAMFI--ETNPVPVKVAA
DAPA_SYNFM       VISVVSNIAPADMANLCNLFLGGDFD---AARKLYYRLLPLCHGLFY--ETNPAPVKAAL
DAPA_SYNAS       VISVISNVAPADMACLVDAFEAGNMK---KARAMHDKMVPLVDALFI--ETNPTPVKAAL
DAPA_THEYD       AISVTANICPKDMAELFNAWEKGDIE---HARKLHYKLEPLNKAMFI--ETNPIPVKTAL
DAPA_DESPS       VISVISNVFPKGMAEMQEATFAGDWD---RARQLHYQMYDMMKQMFA--APSPAPAKKAL
DAPA_DESAG       VISVVSNIVPAKMSGLCKAFAGGDLA---RAKTLHHELSPLSRAMFC--ETNPIPVKTAL
DAPA_DESAD       VISVVSNIVPDLMSGMCAAYRAGDMK---KAQELHFKMQPLNRVMFV--ETNPIPVKTAL
DAPA_LAWIP       VISVISNIVPAMVVELCSLIEKNKLE---EARQIHYNLAPLCRLMFV--ETNPIPVKTAL
DAPA_LEPBA       VVSVVSNLFPRACVDMVSLYLRGDLE---ASKKIYYKLLPVFVNAFI--ETNPIPIKAAM
DAPA_LEPIN       VVSVISNLFPKALVQLVESFQQGKIS---EAKKIHYDFIEVFALAFM--ETNPIPIKAAM
DAPA_ENDTX       VISVLSNIIPTEIVSLVKTFEKGDLK---EAVKIHYKLLPLVKLMFI--ETNPIPVKTVA
DAPA_MAGMM       VISVTTNLAPRLVRDLWDLWHNGQIN---EAREVHEQLLEINGLLFC--ETSPIPVKAGA
DAPA_HALMA       CISVSANIEPERTCAMVGAALSGDFE---RAQAIHHELGPLFRAMFV--ETNPIPVKEAM
DAPA_NATPD       CISVSANVEPERTVALVGAALEGDFT---RARELQYELGDLFRTLFI--ETNPIPINEAM
DAPA_METBU       VISVVANIVPDRMSRLVNAFNEGDTA---TAQQLHYEIAPLIRALFT--ETNPVPIKRAM
DAPA_METAC       VISVAANIVPDKMSGMVSAALKGDYE---TARKIHFEIAPLIRALFL--ETNPIPAKKAA
DAPA_METTP       VVSVVANVAPRATVEMVNAFLDGNIT---RAQELHYRLAPLVRAMFL--ETNPIPVKTAY
DAPA_METMJ       VISVAANVDPGRMVGMYEAFRAGDLA---RAQVLHYELAPLMRAMFI--DTNPIPVKKAV
DAPA_METHJ       VISVAANIYPRPLIEMYEAAQKGDYE---TAREIHFKYSPLFRAMFY--ESNPIPVKKAA
DAPA_METLZ       CISVTANIEPKRLVEMYDLFRRSDVK---AAMKKHYELMDLSKALFM--EVNPVPVKRAA
DAPA_METJA       VISVVANIVPKEFVEMVNYALEGDFE---KAREIHYKLFPLMKAMFI--ETNPIPVKTAL
DAPA_METKA       VISVTANVAPELMVEMYEAWKSGDVE---RARELHYELLPLHRALFT--ETNPIPVKAAV
DAPA_METTH       VISVVANVDPARMSRLVNEALSGDFE---SAMKTHYELYSLMKVLFI--ESNPVPVKEAL
DAPA_METST       VISVVANIMPNKTSTMVNNALNGNYD---EARTLSNELFNLMDVLFI--EASPAPTKRAL
DAPA_METS3       VISASANVDPKRMVLMVDSILNDDYT---RAQELHYEMIDVIDALFI--ESNPVPAKTAM
DAPA_ARCFU       VISVAANVAPHLMKEMYEAFVEGNIE---RAREMHHRLTPLFDVLFI--DTNPIPVKKAL
DAPA_RICM5       WTSVASNIVPNICKELLEKWNKNDTK---GALEIHQKLLPLYTALFV--ESNPIPIKYAA
DAPA2_CLOAB      GIMASAHLNTEKYVEVFNKSKQNDYK---SALEIWKQVANMIPLLFE--EPNPAPIKYCL
DAPA_WIGBR       VISTAANIIAYESSSLCRLINNRHYY---KAEKLYYNILDLYKILLI--APNPTPIKWAC
DAPA_ACHLI       VISVTANIIPLSTSLLIQNFRAGIDN---KE--AFIKFNKLHDMMFV--ESNPIPVKRAL
DAPA_BDEBA       VISVASHVIPAQMVQWKKWVSEGALD---KARADIAKYNDLINLLFV--EANPIPVKKAL
DAPA_FERNB       VISVASNIIPEQMVELANKTLQNDVV---TARNIHFKYLELMKVLFV--ETNPIPVKAAL
DAPA_THEMA       VISVVSNVAPKQMVELCAEYFSGNLE---KSREVHRKLRPLMKALFV--ETNPIPVKAAL
DAPA_THEAB       VISVASNIIPLQMVQMFNFIKNGEIE---KARNIHFSYYKLFKNLFI--ETNPIPVKAAL
DAPA_THEM4       VISVASNVIPNQMVEMYKNIISGNIS---NARKIFYTYYPLFKALFI--ETNPIPVKQAL
DAPA_KOSOT       VISVLSNVAPSQTVEMIAAALEGDLE---KAREIHLKLFPLMKALFI--ETNPIPVKFAT
DAPA_ALKOO       VISVASNVIPKEIQEMCAAFMEGNVE---KALEIQLLYKKFIDLLFC--EVNPIPVKAAV
DAPA1_CLOAB      VISVLANIIPQTVHDMCFSYFQGKTT---DALNLQLDTLSLTNSLFI--ETNPIPIKTAM
DAPA_CLOPE       VVSVLANILPEETHNICEKYFLGEVI---ESRNLQLKYLSLANSLFI--ETNPIPVKTAM
DAPA_CLONN       VISVAANIYPKEMHDICDLYMNGKTH---EALKIQLDMLDVINSLFI--ETNPIPIKTAM
DAPA_CALBD       VISVLANILPDETHDIVEYFLNGEIE---KARELQLKLLPIIKALFI--EVNPIPVKEAM
DAPA_THEP3       VISVTANIIPAKIHEMTTAYLNGDIE---KARDMQLELNPLNKALFI--ETNPIPVKTAM
DAPA_HUNT2       VISVMANIIPKKTHELVATFLDGNVE---ESRKIQLSLLNLIKALFI--EVSPIPVKAAM
DAPA_LACP7       VVSVLSNIAPRQTHDIVAKFLEGDTK---GSLDLQLEYLPVINALFS--EVNPIPVKKAL
DAPA_BRAHW       VISVTSNIIPKENHDMVMNFLNGNVN---EAIKTQIKYIDFVRAMFI--ETNPAPIKEAM
DAPA_EXIS2       VISVLSNPYPAETQALAEALLANDYT---TARRIQSDLMPVISALFS--DVNPIPVKAAL
DAPA_EXISA       VVSVLSNVYPGATVALAEALLAGDLQ---TARTWQIRLLPVIDELFA--EVNPIPVKAAL
DAPA_XANAC       LISVASNALPAAYRRLCDLARDGQRD---AAAAWDARLSEYHNFCGI--ESNPIPVKALL
DAPA_STAAB       VISVIANVIPKEFQALYDAQQ-SGLD---IQDQFK-PIGILLSALSV--DINPIPIKALT
DAPA_STAS1       VISVVANVIPNAFQSLYDAKQ-NDEN---IQSQFQ-PIQTLLDALAV--DVNPIPVKALT
DAPA_MACCJ       VISVIANAIPAEFSDIYRTYQVNRHE---AERQFN-NLLPLINALSV--DVNPIPIKALV
DAPA_ACAM1       VVSVASHLVGELLQKMVTAFASGEPQ---VATEIHLKLLPLCKALFA--TTNPIPVKAAL
DAPA_THEEB       VVSVASHLVGLRIQEMIQAFVQGDTA---KATAIHCQLLPLFKALFV--TTNPIPIKAAL
DAPA_NOSS1       VVSVASHLVGNQLQQMIQAFNSGQVT---VASDIHLRLLPLFKTLFI--TTNPIPIKQAL
DAPA_MICAN       VVSVASHLVGEEIQGMIQALLTGDAA---KAIEINLKLFPLFKGLFC--ATNPIPIKAAL
DAPA_SYNY3       VVSVASHLVGDRLQAMVQHFAQGATA---QALEIHLQLIPLFKILFC--ATNPIPVKTAL
DAPA_SYNE7       VVSVASHLVGPQLQALIQAFEAGNVA---RAQQLHHQLYPLFKALFL--TTNPIPVRAAM
DAPA_SYNJB       VVSVASHLVGLQLQELIQSYIRGQHD---QALAHHLRLFPLFKVLFI--ETNPVPIKAAL
DAPA_PROMA       VVSVASHIVGMRLKAMIEAYFAGENS---LALSHHEQLQPLFKALFA--TTNPIPVKAAL
DAPA_SYNR3       VVSVTSHLAGVELSAMIDHYMAGRHA---EALALHERLLPLMEGLFC--TSNPTPVKAAL
DAPA_PROM5       VVSVASHIVGLQLKMMIESFQKGEFS---IALDIHEKLQPLFKALFE--TTNPIPIKAAL
DAPA_DESAP       VVSVAAHLVGGKIQEMINAFTSGNIT---LAAKLHSSLFPLIKGLFM--TTNPVPVKAAL
DAPA_DESRM       IVSVAAHIAGKQIQEMIDAFTSGNTT---LAANLHKELFPIFKGLFI--TSNPVPVKAAL
DAPA_HELMI       IVSVASHLVGKEIQKMIAACINGNIS---EAARIHRELYPLFKGLFI--TSNPICVKAAL
DAPA_MOOTA       IISVVAHVAGEKMQAMVRAFTAGDVQ---GAAALHRELFPLFKALFI--TSNPVPVKEAL
DAPA_SYMTH       IISVASHVVGPQMRELIDAFLAGDTA---RAAAWHRRLLPVFRGLFA--VTNPILVKAAL
DAPA_DEHM1       VISVASHIVGKQIKEMITSFVSGNTD---NAAAIHRHLTPLIRSLFV--VSNPIPIKYAL
DAPA_NATTJ       VVSVASHLIGKELKEIIDAYHANNSR---KALELFQEIYPFITALLV--KTNPIPIKAAV
DAPA1_BACHD      VVSVASHIIGNEMQEMVQLFLSGQVE---RAAAIHRKLLPLMKTLFM--TPNPTAVKAAL
DAPA2_BACHD      VVSVASHIIGPEMQQMMMAFRGGDVE---HAANLHRKLLPIMKGLFT--APNPTCVKAAL
DAPA_BACSU       VVSVASHIAGTDMQQMIKNYTNGQTA---NAALIHQKLLPIMKELFK--APNPAPVKTAL
DAPA_OCEIH       IVSVSSHIIGNDMQEMIQRFEQGQVA---EAANIHQRVLPVMQEMFA--NPSPVPVKTAL
DAPA_LISIN       VISVASHVVGNEMQEMMQAYESGDVK---KAASIHRSLLPLMNGLFS--VPNPAPTKYLL
DAPA_LACLM       VISVASHILGQEFFEMFAEIDQGSIQ---KAATIQRKILPKINALFS--VTSPAPIKTVL
DAPA_STRGC       VISVASHTNGDEMFEMLDAIEHNDIK---KAAAIQRKFIPKVNALFS--YPSPAPVKAVL
DAPA_ENTFA       VISVASHVFGSSMYEMYQALEQGNLP---EAAKIQRQLLPKMNALFS--VPSPAPVKAAL
DAPA_LACAC       VISVASHIYANQMRRMYDSLYEGNYP---LAAKIQRWLTPRMQALFM--YPSPAPVKAVL
DAPA_LACRD       VISVASHTYVDQMRQMYDSLYRGDYQ---TAGKLQRWLTPRMAALFM--FPSPSPVKAVL
DAPA_LACF3       VISVAAHNYAPQMRAMYDALSAGNYQ---VAAKLQRWLTPRMAALFM--FPSPSPVKAVL
DAPA_PEDPA       VASVASHIYGYQIRALLDAVKHGDLL---KAGKLQRELTPKMEALFL--YPSPAPVKAVL
DAPA_LACP3       VISVAAHLYAHSIREMYAALDRGDIT---TVAALQRQLLPKMAALFH--FPSPAPTKAAL
DAPA_OENOB       TISVASHFYAKEFADMFSAIDNGDFK---KAAGDFRFINPRVKALFS--YPSPAPVKAVF
DAPA_LACS1       IISVASHIYGDNMKTMYSSLESGDVS---MAGKIMRDLIPKAEALFS--YPSPSPVKAAL
DAPA_LEUCK       TISVASHLYGREMSALFTALAVGDWQ---EAGVLQRYLTPKMNALFA--FPSPAPVKAKL
DAPA_LEUMM       TISVASHLYGDEMSELFSAMNAGNWR---EAGRLQRYLTPRMNALFA--YPSPTPVKTKL
DAPA_ACIC1       VVGVPTHVFGTQTGAMIAAYLRGDVD---GALALHRQLLPVFTGFF--RTQGVILAKAAL
DAPA_KINRD       IVSVVSHVAGREYAAMVAAVDAGDLV---TARAIHTRLLPAVRGIMT-RTQGVVAVKAAL
DAPA2_STRCO      FVSVVGHVVTPELRAMVDAHVAGDVQ---KALEIHQKLLPVFTGMF--RTQGVMTTKGAL
DAPA1_STRCO      YVSTVANVVPELFRAVLDAFDAGDTG---RAALLQRRAVPLVESMMAAGLPGTVTAKALL
DAPA_CUTAK       LVGTSTHFTGRRMHEVIDAYVDGRID---EALSTYREILPVLTGVF--AAQGATMVKAGL
DAPA_CORA7       VISVIGHIAPRALADLYVAFDEGDIA---RAREINAKTLSPLVEAQG-RLGGVTLVKAAL
DAPA_CORDI       FISVIGHLAPQLLREMYTNFNQGNLE---KAREINAQ-LAPLVAAQA-RLGGVSLAKAGL
DAPA_CORJK       FISVIGHVATRQLKQLRDAFDAGDIA---TARSIAVQ-LQPLQKAQA-RLGGVTFAKAAL
DAPA_MYCGI       FISVWGHLAASQLRDMLSAFASGDVA---TARKINVA-LGPLSAAQS-RLGGVTLSKAGL
DAPA_BIFA0       IISVVAHAAAKPMRELAEAFDRGDIA---KAQGLANRIAPVIEAMNG-TGFQAVMAKAAL
DAPA_CHLMU       LVSVLSNVWPELARDYVAQCR------------SIDAWKKTCSWLEL--SVNPLGIKALM
DAPA_CHLTR       VISVLANVWPELARDYVAQGR------------PIEAWKKVCSWLNL--STNPLGIKALM
DAPA_CHLAB       LISVLSNIWPKEAREWVEDPH----H-----QYRADLWREVSSWLNQ--TTNPIAIKALL
DAPA_CHLFF       LISVLSNSWPKEAHNYVEDPF----N-----KNNSLLWCELVSWINQ--TTNPISIKAML
DAPA_CHLPN       LISVLSNAWPEEAREYVLNPQ----E-----QDYRSLWMETCRWVYT--TTNPIGIKAIL
DAPA_WOLPP       LVSVAANVWPSVVHEYVKQCMSG--E-----NPQADSWQQACKTLFT--ASNPIPTKALL
DAPA_FRAP2       LVSVISNIWPEQTKEYVKQSLAHQIA-----ITDKVIWEVATRSCFS--VTNPIPVKAWL
                    .  :                                                 .   

DAPA_AZOPC       NVMGFI-ENKLRLP-LVPVLE--------ATYERIKKALLM-------FRTQ--------
DAPA_BACV8       NVMGLI-ENKLRLP-LVPTRI--------TTFEKMRAILNE-------LKIKC-------
DAPA_PORG3       YQKGLIRHNILRLP-LVSASD--------STSTLIARVRNQ-------IEQR--------
DAPA_FLAJ1       QALGIT-ENTVRLP-LVSVDE--------SLAERINDFVKN-------SIK---------
DAPA_GRAFK       AKKGII-SNTLRLP-LVEATE--------TLQSKINSFVDN-------F-----------
DAPA_SULMW       KIKGLC-NKYVRLP-LLKGSK--------TLEKKLYIEYNN-------MLKTQ-------
DAPA_CYTH3       ELMGIC-SSEVRLP-LVKASG--------ELIHKIEQAHVK-------ITREYANH----
DAPA_KORVE       AMMGRI-EENYRLP-MVPMRP--------ENRAKLEKIAAE-------AGVLKNATVAQ-
DAPA_ACIC5       AMMGRI-EERYRLP-MTPVSS--------ATRARLERLAGE-------LGLLVETPVPQR
DAPA_CHLP8       SLMGMV-EEAYRLP-LVPMSD--------ADKATMKAELEQ-------LGLI--------
DAPA_CHLPB       SLMGMI-EEVYRLP-LVALQP--------ENKEKIKEELRN-------LGLVS-------
DAPA_CHLCH       ARMGMI-EENYRLP-LVPLSA--------ESKRAMDEELTL-------LGLV--------
DAPA_CHLT3       AKMGLI-EEVYRLP-LVPLSS--------SSKAKLDAELVQ-------LGLVEASATA--
DAPA_SALRD       AALGWM-EPHVRLP-LTPMDE--------RSPVRQRVLSAF-------DDLIDVTVA---
DAPA_PARUW       SLSKLP-AGSCRLP-LCDLSQ--------NHSQKLAQILNE-------LPQEWISHG---
DAPA_ARCB4       YLSGLLDSLEFRLP-LTNPSA--------ETMQKLEKILIK-------YEVIK-------
DAPA_SULDN       YIAGLIDTLEYRLP-LVAPSV--------ENMKKIESVMKN-------YEIKGL------
DAPA_CAMHC       YIAGLIETLEYRLP-LCEPSK--------ENYKKIEETIKK-------YKIKGL------
DAPA_HELHP       FLAGLLKNLEYRLP-LVPPSK--------ENMAKIQQILEK-------YEVKE-------
DAPA_WOLSU       YLAGLTPTLEYRLP-LVSPSQ--------ENMRMIEETLKD-------YEVKA-------
DAPA_HELAH       HLAGLIENPSYRLP-LVAPSK--------ETIKLLEKTLQQ-------YEVIA-------
DAPA_ACICJ       SLL-GFGSEFCRLP-LAPLAE--------ATKAQMRAAMTG-------LGLLA-------
DAPA_GLUDA       SLL-GLAGETCRLP-LAPLAE--------DSRMRVREALTG-------AGLLN-------
DAPA_GLUOX       SRL-GLCNATLRLP-LVEPQE--------ETRRAIDAALRS-------LELLD-------
DAPA_AGRFC       SKT-RGGNRRVRSPLMSTLEP--------ATEAAIDAALKH-------AGLMN-------
DAPA_BRUAB       SRL-GRIENVLRSP-MVTIEA--------ATAEKIDHAMKH-------AVLIN-------
DAPA_BARBK       AKL-GFCRDTVRLP-LVPLKD--------TTKEIIDAALQH-------AGLIKE------
DAPA_METRJ       SRL-GHMTDELRLP-LVPVTE--------PTKRIVDDALRH-------AGLLVD------
DAPA_NITHX       KLL-GRLDEVVRLP-LLPVTP--------PTGKVIRDAMVH-------AGLLN-------
DAPA_PARL1       NLL-GLCANELRLP-LVPASA--------AAEQKVLGAMRS-------AGLLN-------
DAPA_DINSH       SLL-GKCSEDVRLP-LLGLSD--------GTKVLIKDAMIH-------AGILG-------
DAPA_RHOCS       SLL-GKCAEDMRLP-MVPPTQ--------ATRDVVRAALVK-------TGLLT-------
DAPA_PELUB       KLL-GLCDDEVRLP-LVKVTD--------PTKDIVKEALVS-------ANLL--------
DAPA_CAUVC       AQL-GLCTEDVRLP-ITACAE--------GVRPAILEAMRE-------AGLR--------
DAPA_HYPNA       SRM-GLCGPEVRLP-LTAPDA--------AAEAMIDAAMAL-------AGLNT-------
DAPA_NOVAD       SRVFADINEDLRLP-MVPCNE--------AARKAVDAALVH-------AGLLELA-----
DAPA_SPHAL       SRVHDWFSPEVRLP-IIPASG--------ASRAVVDAALAS-------AGVI--------
DAPA_SPHWW       TRTYRDFPADLRLP-MTWPSE--------ASRAAVDAALAH-------AGIA--------
DAPA_ZYMMO       SRLYSDFSPELRLP-LVQPSD--------HSKALVDAALSH-------ARLI--------
DAPA_ANAMF       SLM-GKMRPKVRLP-LVELTS--------SGQTAVKNVLET-------LDLLRQQKAMHS
DAPA_EHRCR       SLI-KNISPAVRLP-LVELTQ--------ENKLKVEKTLKE-------LKLI--------
DAPA_ACIF2       HEMGRM-ESVLRLP-LTTLSS--------VHHERLRESLRR-------AQCI--------
DAPA_LEGPC       KKMGLI-GGELRLP-MTELSE--------KHHQALEKVLKN-------LELI--------
DAPA_ACISJ       QRMGLC-GGALRLP-MTPLSQ--------GNEAVVEAALRA-------AGLL--------
DAPA_BORPE       AQMGHT-ALGYRLP-MVELSE--------QYHSLVRTALQE-------VGLL--------
DAPA_POLAQ       HEMGKI-TAGIRLP-LTPLSS--------SLREPLKAALKQ-------ANLL--------
DAPA_RALSO       QAMGKM-AGGIRLP-LTPLAA--------QYQEVVRASLQD-------AGLLS-------
DAPA_HERAR       AEIGLI-PSGMRLP-IVPLAA--------EYHDIVRAAMRE-------SGVLQ-------
DAPA_AZOSB       QRMGLV-EGGLRLP-LTPLAE--------SFHDRVLTAMRQ-------AGIQA-------
DAPA_NITMU       AQMGLI-GEGLRLP-LTPLSN--------RYHQTLREAMSE-------AGIDLAISV---
DAPA_THIDA       AELGLI-PPGLRLP-LTPLSG--------GQHEVVRAAMRH-------AELI--------
DAPA_LARHH       ERMGRI-PAGIRLP-LTRLSD--------AGQSKVEAALKA-------ANLI--------
DAPA_MARHV       YRMGMI-GEGIRLP-LTPLSE--------KFHGEVEDALKA-------SGVL--------
DAPA_CHRSD       HRMGLA-EQGIRLP-MTWLSD--------KYHSTVSEALQL-------AGVTEG------
DAPA_ALCBS       FEMGLI-DAGIRLP-LVPMSE--------AAQPRLRETMRQ-------CGLLEVK-----
DAPA_METCA       HEMGLI-QEGIRLP-LTWLAA--------SCREAVRQAMRQ-------AGVL--------
DAPA_PSEAE       HEMGLI-PEGIRLP-LTWLSP--------RCHEPLRQAMRQ-------TGVLA-------
DAPA_NITOC       YEMGLI-AQGIRLP-LTVLSE--------RYHELLRQALRQ-------EQILQ-------
DAPA_THISH       EQMGLI-PPGIRLP-LTRLSE--------RFHAPVREALAA-------AGITLNA-----
DAPA_ALKEH       SQMGLC-GPSIRLP-LTELSE--------QHHETVRQAMKL-------AGSL--------
DAPA_HALHL       EELGMA-GSGMRLP-MTRLTE--------AGQARVRQAMQD-------AGLL--------
DAPA_SACD2       AKMGLM-PNGIRLP-LTPLDA--------KYHLQVEQALRA-------ANLL--------
DAPA_TERTT       ARMGFL-DGALRLP-LTPLNA--------VYHAQLEAAMLS-------AGAI--------
DAPA_RUTMC       FKMGKC-NNGIRLP-LMILSQ--------QAQAMLEQDLSN-------LGII--------
DAPA_COXBU       SQMGVI-PKGIRLP-LTPLSE--------RYHAKVRESLQQ-------VGIKC-------
DAPA_DICNV       QRMGKI-AAGIRLP-LMPLDE--------RWHESLTAALVA-------AGITIQTH----
DAPA_ALISL       HRLGMITHPDIRLP-LTELSH--------SAQPVVEQALIR-------AGVLK-------
DAPA_VIBCH       HKMGLIANGDLRLP-LTQLSE--------PARPIVAQALSE-------ACIY--------
DAPA_HAEDU       YKLGLISEPSLRLP-LTPLSE--------TAQPTILKALQK-------AGLI--------
DAPA_HAEIN       YRLGLIKSPHLRLP-LTTLSE--------EIQPKVGDALKI-------AGLL--------
DAPA_EDWI9       KVLGLIATDTLRLP-LTPLSA--------SARPAVERALQH-------AGVL--------
DAPA_ECOLI       KELGLVATDTLRLP-MTPITD--------SGRETVRAALKH-------AGLL--------
DAPA_BLOPB       KELGLISHYVLRLP-MTVLSE--------VHRDVLKQALID-------SGLFYNQSNYK-
DAPA_BUCAI       KKIGLIKSDTLRLP-MTPVLD--------STRFQLEKAIQY-------ANLKIS------
DAPA_BUCCC       KYIGLIETDKIRLP-MTQLLD--------KNKKNLKKIINL-------LQLNKNKFL---
DAPA_PSYIN       AEMGLLPSADCRLP-LMMLDK--------KYQPIVRNALIE-------AKLIS-------
DAPA_SHEB5       HRMGLIECGHIRLP-LTELSE--------QCHGLLIEAMTR-------AQIEVK------
DAPA_PSEA6       YKMGLIQSAFLRLP-LIESEL--------DSQNHIEQVMRN-------SGVLS-------
DAPA_IDILO       ALMGWV-SANYRLP-LTPPEE--------SNQQLIESVLQK-------ANLLNIQES---
DAPA_NEIG1       SALGRC-GPHVRLP-LVPLTE--------GGQAKVRAALKA-------SGQL--------
DAPA_PSYWF       NKMGKI-EKGIRLP-MVWLNE--------KFHDQVDAGLRA-------AGLID-------
DAPA_SORC5       AALGRM-SAAVRLP-LVPAGE--------ATRQQIAEAMRR------LEARREAS-----
DAPA_THERP       ELLGLC-SATVRLP-LAPLAP--------ANRERLLAALASCPHTASLLARPMGEAA---
DAPA_ANAD2       ALLGRS-GGELRLP-LAPVSE--------ASLAKVRDAMVR-------FGLKLA------
DAPA_AQUAE       WMLGMCEK-EFRLP-LTEMSP--------ENENKLREVLKK-------YNLPLKN-----
DAPA_HYDS0       SLMGMVKK-EFRLP-LCEMLP--------QNEEKLKEVLKK-------YNLI--------
DAPA_PERMH       YLMGLIDDIEMRLP-LYYMKP--------ENEEKLKSVLKD-------YGLIR-------
DAPA_THET2       SWMGLLEK-EWRPP-LGPTTP--------EVEERLRRMAER-------YGLLPKEKEAA-
DAPA_GEOBB       SLMGKC-SSEVRLP-LAPLME--------ANLAKLTAIMKE-------YKLI--------
DAPA_PELCD       ALMGLC-GDHLRLP-LVELLP--------ENLASLKKVLSG-------YGLIQA------
DAPA_SYNFM       AMMNKIPSDELRLP-LAPMSP--------ANRLRLRQDLQA-------YGLI--------
DAPA_SYNAS       ALMGKI-SEDVRLP-LYRMTE--------TSREKLKRVMQN-------YGLIG-------
DAPA_THEYD       AMMGKI-KEEFRLP-LCEMSQ--------TNKEKLAEVLRS-------AGLIK-------
DAPA_DESPS       ELMGVIREGLPRIP-MTPIDD--------DNLANLKLAMKG-------LNLI--------
DAPA_DESAG       SMMGRL-SLELRLP-LVPMQP--------QNEKYLRGILSL-------AGLV--------
DAPA_DESAD       GMMGKF-ETSFRLP-LVPLME--------ASKAKLEAQLKA-------SGLI--------
DAPA_LAWIP       SLMEKL-ELEFRLP-LTELSP--------INFTKLESTLKN-------IGIISK------
DAPA_LEPBA       SWFGYC-SNELRLP-MTSLSEGTAS----ESFKKIVFQLKE-------EGIV--------
DAPA_LEPIN       CWFGHC-GPEIRLP-LTPLSQNETS----SKFKKVLEGLKE-------KGYE--------
DAPA_ENDTX       SLLGMC-SADLRLP-MCEMEE--------PNRLKLEKALKD-------FGLLK-------
DAPA_MAGMM       AMLGLC-HNELRLP-MTAMSE--------ANQAKLHRAMVK-------LNLLEE------
DAPA_HALMA       RIRGYG-PAHLRSP-LTRLSD--------EHLDHLRDVLAT-------LETEDLEDEYAE
DAPA_NATPD       DMRDIH-SSTMRSP-LNPLQP--------EHREQLREVLAD-------LER---------
DAPA_METBU       NLVGLN-AGHLRPP-LAPISA--------ENNKLLANCLKE-------LGCLQ-------
DAPA_METAC       ELIGLA-SGHLRLP-LAPMSD--------ANQLKLVTELKK-------LGVMK-------
DAPA_METTP       RMLGMA-AGPLRLP-LAPMSD--------ENEAKLRDVLTK-------MSDLTGDMR---
DAPA_METMJ       ELLGMA-AGPVRLP-LDELDE--------AKTEQLRKVLVN-------HG----------
DAPA_METHJ       EILGMA-AGPLRLP-LDEASE--------QTTERLKEVLSR-------YD----------
DAPA_METLZ       EIRGLINSGNVRLP-LDSLGE--------QNTAILRGVLSR-------YD----------
DAPA_METJA       NMMGRP-AGELRLP-LCEMSE--------EHKKILENVLKD-------LGLI--------
DAPA_METKA       ELVGMA-SSPPRPP-LKEARE--------DTKELLRRELKK-------LGLLPEGG----
DAPA_METTH       NMMGKA-RGSCEDA-PGTPAG--------CKP----------------------------
DAPA_METST       NLMGMD-VGGLRMP-INEICD--------ENEVILKEILKE-------NNLI--------
DAPA_METS3       NIMGLP-AGPLRAP-LTDMKD--------ENVEILKNALKE-------ADLI--------
DAPA_ARCFU       QLMGLA-AGKPRLP-LVELSE--------EKTQKVKEVLKS-------LELIS-------
DAPA_RICM5       HYLGLCENE-IRPPLTEASDS---------AKKQIENIITSLSIKI--------------
DAPA2_CLOAB      SKTGVIASEALRLPLVPISEN---------LKEKLNKFL---------------------
DAPA_WIGBR       NFLGLIKTKYIRLPMIGLNKK---------EIFMFKKILNKIKLKSKINCI---------
DAPA_ACHLI       EHLG-FEVGKPRLP-LTKLGA--------KHNRMLLKVLRD-------YKLVDND-----
DAPA_BDEBA       QLMGILESAELRLP-LVELGA--------ENTAKLQAEMKK-------VGVL--------
DAPA_FERNB       NLLG-IIKNELRLP-LVPAKQ--------STVELLEKVMKK-------VGVLS-------
DAPA_THEMA       NLMG-FIENELRLP-LVPASE--------KTVELLRNVLKE-------SGLL--------
DAPA_THEAB       SIMG-FINNELRLP-LVPASE--------STMKIITETLKG-------CGVI--------
DAPA_THEM4       NIMG-LIENELRLP-LYPANK--------ETKNILEKILKE-------CKII--------
DAPA_KOSOT       HLLG-FGSETLRLP-LTEASK--------RTREVVKKAMQD-------CGVLR-------
DAPA_ALKOO       SALG-YIENELRLP-LTPMEE--------VNRKKLMDEMKK-------QNII--------
DAPA1_CLOAB      NLLN-FNAGPLRLP-LCSMDE--------KNLNTLKTDLKG-------YGLIK-------
DAPA_CLOPE       NLMN-FNCGPLRLP-LCEMED--------SNLIILEENLKA-------NGLIK-------
DAPA_CLONN       NLKG-MDVGALRLP-LCDMEE--------NNLEVLKNALEN-------YNKTSREA----
DAPA_CALBD       NMMG-FNVGKPRLP-LTTMTE--------KNREILKKALVD-------YGISVKE-----
DAPA_THEP3       NLMG-FNVGPLRLP-LVEMSD--------KNLEYLKSVLSK-------YGLLKEAN----
DAPA_HUNT2       NLMG-MEVGKCRLP-LTDMTE--------KNFEILKQTLKD-------YGLI--------
DAPA_LACP7       NLMG-FEVGPLRSP-LTEMED--------AHAKILADEMKK-------VGLI--------
DAPA_BRAHW       NIMG-FNVGECRSP-LGPLSE--------KNREHVKNIINK-------YGLKK-------
DAPA_EXIS2       EEIGLA-VGAPRLPLVRQSE---------AGHAHLLETMRS-------YKGVVG------
DAPA_EXISA       QARGFE-VGAPRLPLVPMSA---------TAEAKLLSAMEQ-------FNEVRQ------
DAPA_XANAC       QRAGIG-HGL-RLPLLPLSAAHQPAADRLAADAIALEALSS-------REMLAA------
DAPA_STAAB       SYLGFG-NYELRLPLITLED---------TDTKVLREAYNI-------FKAGENE-----
DAPA_STAS1       AVEGFG-NYEVRLPLVTLED---------SDRQKLEQAYEQ-------FKVGGNS-----
DAPA_MACCJ       AYIGYA-NGELRLPLVPMLE---------QDTKQLIELYNR-------IAKGSDLS----
DAPA_ACAM1       QLQGWQ-VGSTRLP-LPEAPD--------PIIQKLKNTLTDLALL---------------
DAPA_THEEB       SLQGWS-VGEPRLP-LTSASD--------AVISQLKAVLDDLGLLKS-------------
DAPA_NOSS1       KLQGWE-VGSTRPP-LSDADA--------EVSQKLEAVMKHLDLI---------------
DAPA_MICAN       NLVGWE-VGGLRLP-LCSLSP--------ELEEGLAKIMQELALI---------------
DAPA_SYNY3       GLQGWP-VGSFRPP-LCALSP--------GHTEQLRDVLRDLALLP--------------
DAPA_SYNE7       ELLGWS-IGLPRLP-LVPASA--------EIRQALASCLTELGLYTA-------------
DAPA_SYNJB       EMQGWR-VGRARLP-LAPLQP--------SSLQVLRQVLEEMGLLAESKGSEQMATKVS-
DAPA_PROMA       ELIGWP-VGAPRSP-LLPLEN--------QMKNELMKTISALLQT---------------
DAPA_SYNR3       ELQGWP-VGAPRLP-LMPADS--------SVRDTLSTLMAALRPT---------------
DAPA_PROM5       ELTGWQ-VGSPRNP-LTPLIK--------EKKDNLFQIIQNLSL----------------
DAPA_DESAP       GMLGLN-VGPPRLP-LVEATE--------QEKEKLRVLLREAQLL---------------
DAPA_DESRM       NLKGLA-VGGVRLP-LVEATA--------KEIETVKNIMNNLHLL---------------
DAPA_HELMI       NLLGRP-VGGVRLP-LVEAND--------QEVAAMRQLIESYGLDASCQETVA-------
DAPA_MOOTA       QMLGLP-AGPVRLP-LVGATR--------EEKEKIAAALKETGLL---------------
DAPA_SYMTH       RLTGFP-VGPVRLP-LVDATE--------EQEEALREVLAEAGVL---------------
DAPA_DEHM1       NYLGFE-VGGLRLP-MTEADE--------KTAALIRESLKGYTIDLPIK-----------
DAPA_NATTJ       NTHLMQ-VGSVRPP-LYDLSE--------KELEQLSEVYKWSVGKY--------------
DAPA1_BACHD      ELKGLP-VGHVRLP-LVPLTA--------EEQRQLELAINPQFNMFVS------------
DAPA2_BACHD      QIKGFD-TGGVRLP-LVPPTS--------EQRQHLQFLIE---QLKVS------------
DAPA_BACSU       QLRGLD-VGSVRLP-LVPLTE--------DERLSLSSTISEL------------------
DAPA_OCEIH       NLQSVP-VGKVRLP-LIELTD--------EQLQNLQSVLSDFEHSKMI------------
DAPA_LISIN       NQQGIS-VGPVRLP-LVDLNA--------EQGTKLQAILEGLSK----------------
DAPA_LACLM       NNKGYA-VGGLRLP-LVACTD--------QEAKIIIEQIEN-------------------
DAPA_STRGC       NYLGFA-AGPTRLP-LVPAPE--------EDAKRIIKVVVDGDYQATKETVKGVLRPDY-
DAPA_ENTFA       NHLGIP-VGNLRLP-LVACTP--------EEEQRIIRTLEI-------------------
DAPA_LACAC       NAQGLN-VGGCRLP-LVELND--------EEKITLAQRLGLDDNALMQK-LPLDLGKELE
DAPA_LACRD       NAQGFN-VGSCRLP-ILPLNE--------EEKRKLETALSLPTNSLTAKNLPLNLGE---
DAPA_LACF3       AAQGLA-TDHCRLP-ICDLTA--------EEKEQLATALGLPSDALAGQ-LPTDLGEGLT
DAPA_PEDPA       NAQNWS-VGSPRLP-ILPLNQ--------KEKLNLAHQLGVNHLADVQLHY---------
DAPA_LACP3       NALGFQ-VGSPRLP-LLPLNA--------SQQQELAHLLGVPELSAIEAEVLA-------
DAPA_OENOB       KRSGID-VGIPRLP-ILPLDK--------AQTDGIMQVLKL-------------------
DAPA_LACS1       NKIGYN-VGGCRLP-IVSLDK--------NEENELFKKLKI-------------------
DAPA_LEUCK       HDLDMV-ENLTRQP-ILPLNV--------AEKKALDKLLEDM------------------
DAPA_LEUMM       AEKGFV-REAVRLP-LIPLSD--------AEKLHLNELLEK-------------------
DAPA_ACIC1       RLAG-LPGGPVRPPLVDATAE---------QVARLREDMAAAGFTEFAEGAEERRG----
DAPA_KINRD       ELTGVLSGRAVRPPLLPATPE---------EVAALAADLALAGLAPAPLDA---------
DAPA2_STRCO      ALQG-LPAGPLRAPMVGLTPE---------ETEQLKIDLAAGGVQL--------------
DAPA1_STRCO      GALG-LPAGPVRAPLRSADRE---------TTAGLLAAYGELAADAGQSQA---------
DAPA_CUTAK       AHQG-FTVGRVRPPQTMPTPE---------QAETFFGVLDRTQL----------------
DAPA_CORA7       RLQG-IEVGEPRLPVTAADAE---------EIEALRHDLEKAGVL---------------
DAPA_CORDI       RLQG-IEVGDPRLPIVAPSES---------EIEDLRRDMNKTGVL---------------
DAPA_CORJK       KLKG-KDVGAPRLPIIEPTAA---------EMDQLAQDLQAAGV----------------
DAPA_MYCGI       RLQG-FEVGDPRLPQIPANDV---------QLQALAADMRAASVLR--------------
DAPA_BIFA0       KVRGIMECTTMRLPNIGPNDE---------QIEVVRDGLRASGLIPE-------------
DAPA_CHLMU       AAQKMIECELVRPPLSIRDFQ---------ERDQLADILACRAILQAELLSVCVQ-----
DAPA_CHLTR       AAQKMIECDAVRPPLSIRDLQ---------RRDELADILACRATLQTELLSVCRQ-----
DAPA_CHLAB       AYKQVIAHNTLRLPLSIQDLQ---------CAESIPEIIKKMAQWKYSCAHV--------
DAPA_CHLFF       AYKQDIAYDILRLPLSIKDLQ---------NKKVLPVLVEKMSQWSQICECVFT------
DAPA_CHLPN       AYKKAITHAQLRLPLSIEDFD---------LENVSPA-VESMLAWPKLRTSVFSYS----
DAPA_WOLPP       HDIGLIEHKTVRLPLSTEDLP---------SIETLRQANKMILGWKELTNS---------
DAPA_FRAP2       AYSGVITTNTLRAPLLANELE---------DLSLLIGADSLVKDWFSHI-----------
                            . .                                              

DAPA_AZOPC       ---
DAPA_BACV8       ---
DAPA_PORG3       ---
DAPA_FLAJ1       ---
DAPA_GRAFK       ---
DAPA_SULMW       ---
DAPA_CYTH3       ---
DAPA_KORVE       ---
DAPA_ACIC5       ---
DAPA_CHLP8       ---
DAPA_CHLPB       ---
DAPA_CHLCH       ---
DAPA_CHLT3       ---
DAPA_SALRD       ---
DAPA_PARUW       ---
DAPA_ARCB4       ---
DAPA_SULDN       ---
DAPA_CAMHC       ---
DAPA_HELHP       ---
DAPA_WOLSU       ---
DAPA_HELAH       ---
DAPA_ACICJ       ---
DAPA_GLUDA       ---
DAPA_GLUOX       ---
DAPA_AGRFC       ---
DAPA_BRUAB       ---
DAPA_BARBK       ---
DAPA_METRJ       ---
DAPA_NITHX       ---
DAPA_PARL1       ---
DAPA_DINSH       ---
DAPA_RHOCS       ---
DAPA_PELUB       ---
DAPA_CAUVC       ---
DAPA_HYPNA       ---
DAPA_NOVAD       ---
DAPA_SPHAL       ---
DAPA_SPHWW       ---
DAPA_ZYMMO       ---
DAPA_ANAMF       QL-
DAPA_EHRCR       ---
DAPA_ACIF2       ---
DAPA_LEGPC       ---
DAPA_ACISJ       ---
DAPA_BORPE       ---
DAPA_POLAQ       ---
DAPA_RALSO       ---
DAPA_HERAR       ---
DAPA_AZOSB       ---
DAPA_NITMU       ---
DAPA_THIDA       ---
DAPA_LARHH       ---
DAPA_MARHV       ---
DAPA_CHRSD       ---
DAPA_ALCBS       ---
DAPA_METCA       ---
DAPA_PSEAE       ---
DAPA_NITOC       ---
DAPA_THISH       ---
DAPA_ALKEH       ---
DAPA_HALHL       ---
DAPA_SACD2       ---
DAPA_TERTT       ---
DAPA_RUTMC       ---
DAPA_COXBU       ---
DAPA_DICNV       ---
DAPA_ALISL       ---
DAPA_VIBCH       ---
DAPA_HAEDU       ---
DAPA_HAEIN       ---
DAPA_EDWI9       ---
DAPA_ECOLI       ---
DAPA_BLOPB       ---
DAPA_BUCAI       ---
DAPA_BUCCC       ---
DAPA_PSYIN       ---
DAPA_SHEB5       ---
DAPA_PSEA6       ---
DAPA_IDILO       ---
DAPA_NEIG1       ---
DAPA_PSYWF       ---
DAPA_SORC5       ---
DAPA_THERP       ---
DAPA_ANAD2       ---
DAPA_AQUAE       ---
DAPA_HYDS0       ---
DAPA_PERMH       ---
DAPA_THET2       ---
DAPA_GEOBB       ---
DAPA_PELCD       ---
DAPA_SYNFM       ---
DAPA_SYNAS       ---
DAPA_THEYD       ---
DAPA_DESPS       ---
DAPA_DESAG       ---
DAPA_DESAD       ---
DAPA_LAWIP       ---
DAPA_LEPBA       ---
DAPA_LEPIN       ---
DAPA_ENDTX       ---
DAPA_MAGMM       ---
DAPA_HALMA       AER
DAPA_NATPD       ---
DAPA_METBU       ---
DAPA_METAC       ---
DAPA_METTP       ---
DAPA_METMJ       ---
DAPA_METHJ       ---
DAPA_METLZ       ---
DAPA_METJA       ---
DAPA_METKA       ---
DAPA_METTH       ---
DAPA_METST       ---
DAPA_METS3       ---
DAPA_ARCFU       ---
DAPA_RICM5       ---
DAPA2_CLOAB      ---
DAPA_WIGBR       ---
DAPA_ACHLI       ---
DAPA_BDEBA       ---
DAPA_FERNB       ---
DAPA_THEMA       ---
DAPA_THEAB       ---
DAPA_THEM4       ---
DAPA_KOSOT       ---
DAPA_ALKOO       ---
DAPA1_CLOAB      ---
DAPA_CLOPE       ---
DAPA_CLONN       ---
DAPA_CALBD       ---
DAPA_THEP3       ---
DAPA_HUNT2       ---
DAPA_LACP7       ---
DAPA_BRAHW       ---
DAPA_EXIS2       ---
DAPA_EXISA       ---
DAPA_XANAC       ---
DAPA_STAAB       ---
DAPA_STAS1       ---
DAPA_MACCJ       ---
DAPA_ACAM1       ---
DAPA_THEEB       ---
DAPA_NOSS1       ---
DAPA_MICAN       ---
DAPA_SYNY3       ---
DAPA_SYNE7       ---
DAPA_SYNJB       ---
DAPA_PROMA       ---
DAPA_SYNR3       ---
DAPA_PROM5       ---
DAPA_DESAP       ---
DAPA_DESRM       ---
DAPA_HELMI       ---
DAPA_MOOTA       ---
DAPA_SYMTH       ---
DAPA_DEHM1       ---
DAPA_NATTJ       ---
DAPA1_BACHD      ---
DAPA2_BACHD      ---
DAPA_BACSU       ---
DAPA_OCEIH       ---
DAPA_LISIN       ---
DAPA_LACLM       ---
DAPA_STRGC       ---
DAPA_ENTFA       ---
DAPA_LACAC       DD-
DAPA_LACRD       ---
DAPA_LACF3       ND-
DAPA_PEDPA       ---
DAPA_LACP3       ---
DAPA_OENOB       ---
DAPA_LACS1       ---
DAPA_LEUCK       ---
DAPA_LEUMM       ---
DAPA_ACIC1       ---
DAPA_KINRD       ---
DAPA2_STRCO      ---
DAPA1_STRCO      ---
DAPA_CUTAK       ---
DAPA_CORA7       ---
DAPA_CORDI       ---
DAPA_CORJK       ---
DAPA_MYCGI       ---
DAPA_BIFA0       ---
DAPA_CHLMU       ---
DAPA_CHLTR       ---
DAPA_CHLAB       ---
DAPA_CHLFF       ---
DAPA_CHLPN       ---
DAPA_WOLPP       ---
DAPA_FRAP2       ---