CLUSTAL format seed alignment for MF_00425

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NQRA_CHLT2        -----------------MKIVVSRGLDLSLKGAPK--------ESGFCGKVDPTYVSVDL
NQRA_CHLTB        -----------------MKIVVSRGLDLSLKGAPK--------ESGFCGKVDPTYVSVDL
NQRA_CHLTR        -----------------MKIVVSRGLDLSLKGAPK--------ESGFCGKVDPTYVSVDL
NQRA_CHLMU        -----------------MKIIVSRGLDLSLKGAPK--------ESGFCGKVDPAFVSVDL
F8KVC4_PARAV      ----------------MTQINITKGLDIPIKGKPSGEIKPLIASGEAGVAHQPVLISLNL
D6YT60_WADCW      ----------------MVHIKVTKGLDIPISGKPAGSIQPLTLSGEAKQNKTPKTLSLNL
NQRA_VIBC3        ------------------MITIKKGLDLPIAGTPSQVI---------SDGKAIKKVALLG
NQRA_VIBCH        ------------------MITIKKGLDLPIAGTPSQVI---------SDGKAIKKVALLG
NQRA_VIBPA        ------------------MITIKKGLDLPIAGTPSQVI---------NDGKTIKKVALLG
NQRA_VIBAL        ------------------MITIKKGLDLPIAGTPSQVI---------NDGKTIKKVALLG
NQRA_PSYIN        ------------------MITIKKGLDLPIAGTPEQVI---------HDGPSITEIAILG
NQRA_YERPE        ------------------MIKIKKGLDLPIAGAPVQTI---------QDGPAIHHVALLG
NQRA_KLEP7        ------------------MIKITKGLDLPIAGMPLQQI---------SPAPAVKRVALLG
NQRA_NEIMF        ------------------MIKIKKGLNLPIAGRPEQVI---------YDGPAITEVALLG
NQRA_NEIG1        ------------------MIKIKKGLNLPIAGRPEQVI---------YDGPAITEVALLG
NQRA_ACTP2        ------------------MITIKKGLDLPIAGTPAQVI---------HNGNTVNEVAMLG
NQRA_HAEDU        ------------------MITIKKGLDLPIAASPAQVI---------HNGNTVNEVAMLG
NQRA_HAEPS        ------------------MITIKQGLDLPIAGKPEQVI---------HNGNTVNEVAVLG
NQRA_HAEIG        ------------------MITIKKGLDLPIAGKPAQVI---------HSGNAVNQVAILG
NQRA_HAEIE        ------------------MITIKKGLDLPIAGKPAQVI---------HSGNAVNQVAILG
NQRA_HAEIN        ------------------MITIKKGLDLPIAGKPAQVI---------HSGNAVNQVAILG
C7R8J8_KANKD      ------------------MIKIKKGLDLPLEGQPEQTI---------SAGATVKTVAILG
NQRA_ALCBS        ------------------MIKIRKGLDLPIAGAPRQAI---------EEGHQVRSVAVLG
E1VB38_HALED      ------------------MIEVKKGLDLPITGAPEQRI---------EDARPVRHVAVLG
NQRA_SACD2        ------------------MIKIRRGLDLPITGSPRQSI---------EDGPAIRSVALIG
NQRA_TERTT        ------------------MIKIRRGLDLPITGEPRQSI---------EDGPSIRSVAVIG
NQRA_MARMS        ------------------MYKITKGLDLPISGAPNQVI---------ETAAAAKTVAVIG
NQRA_PSEAE        ------------------MIKIKRGLDLPISGAPEQRI---------EAARPVRSVALIG
F6AIY5_PSEF1      ------------------MIKIKRGLDLPIAGAPAQQI---------DTSRPVRSVAVIG
C7RRE9_ACCPU      --------------MLQPITTIRRGLEIPVAGEPAQQIP--------EAVCFPPAVALLG
D5V826_MORCB      ------------------MITIKKGLDLPITGEPSKQI----------SEHTPTKVALVG
E1X4A4_HALMS      ------------------MIRIKKGLDVPLTGIPKQTI---------EAGPQVKRVALTG
C6BWF2_DESAD      ------------------MIKLKKGLDIPISGEPALDI---------FEEKSPSTVAVLG
NQRA_RHOBA        ------------MATTQSVTRIKKGLDLPITGCPEQHME--------A-GPAIRQVALLG
A1S9X7_SHEAM      -----------MADYSEAIITVKKGLDVPIAGAPRQEID--------I-AAKPSQLALLG
Q82SE3_NITEU      -----------------MFIKLNKGLDLPISGEPEQCVY--------A-ATAVRHIAVAG
Q604Z5_METCA      -----------------MVIKLKKGLDLPITGAPEQVIH--------ADGGAVKSVALIG
Q1GLS7_RUEST      ----------------MQQHTLKKGLDVPVLGAPDTKIE--------D-AAKVRTVAIIG
G8PNM3_PSEUV      -------------------MKITKGLDLPITGAPNQEIH--------K-GQEVRRVAVNG
A5EUU8_DICNV      ------------------MILIKKGIDLPISGAITDFSI--------RSFVPQNTVAVIG
Q6AM94_DESPS      ----------------MKTFCIKKGLNIPIKGVAGPQI---------RQGKVVDKIALIA
D6Z599_DESAT      --------------MESMELTIARGLDIPISGAPRQVI---------EPAGRVGHVALLA
F8E4B2_FLESM      ----------------MKTIHIKKGCDIPLKGVPVQEI---------RDEAAASEYAVLG
D4H1M5_DENA2      ----------------MTLIKIRKGLKLPVKGAPEGDI---------VNIDNITESAILG
S5YJM2_PARAH      ------------------MIPLIGAWCPRLTGGLVENV------------SSDSPLGITG
D3P9H9_DEFDS      ----------------MKEIKIKRGLELPFGKVCDFK-----------GEKLSREIGFVG
E4TFZ4_CALNY      -------------------MIFEKELNLPFKKEISGEI----------TPHKCNEFGIVS
I3YQD8_ALIFI      ---------------MSKIITLRKGLDINLRGKAQESLAD------APL---ASEYALSP
F9Z516_ODOSD      ---------------MSKVIKLKKGLDIKLNGEAEKVVQP------AGK---ITSCALKP
X5E439_9BACT      ---------------MSEVIKLRKGLNIKLKGSAEKALDK------LPV---PATVALKP
U5Q9K5_9BACT      ---------------MSNHIRLSKGLDIPLKGNASNQITK------TIS---SDILAVKP
E4TPF6_MARTH      ---------------MSHTIKLKKGFDINLAGKAENKISN------APK---PETFAIKP
L0G061_ECHVK      ---------------MSKLVKLKKGFDIKLEGKAEKKTEA------FPP---AQTFAIKP
I4ALH2_BERLS      -----------------MNIKTRKGFDINLAGKAALQVGA------VDQ---SETFAIKP
G8R5N5_OWEHD      ---------------MSETIKIKRGVDIKLQGTAEQIYAN------AEM---PKTFAIKP
I3ZXR4_ORNRL      ---------------MSKDIRISKGLDIKLVGEADKIVSE------AAE---SKEYAIVP
A3UAF5_CROAH      ---------------MSKDITIKKGLDIRLVGSADKVLVD------APK---SKTCTIQP
K4IK22_PSYTT      ---------------MPTDVKIKKGLKLNLKGEATETFEQ------GEN---TKTVALRP
L7WA36_NONDD      ---------------MSKDIKIRKGLDLKLKGEASNTIVT------ASK---SSIYAIKP
D5ESG1_PRER2      ------------------MIKLRKGLDITLEGKAEEKKIQ------LKS---NGKFALVP
A6L599_BACV8      ---------------MANVIKLHKGLNINLKGKPAQEFFD------VKQ---PDIYAIVP
F4KLL2_PORAD      ---------------MARTITIKRGLDLKLHGTAPRTLLT------TPSGGASSTYAWVP
F5HFB1_PORGI      ---------------MAKVIKTKKGLALNLKGKPLPEMLA------EPA--QSPTYAVVP
F4KQY9_HALH1      MEIRTAETPIADNAEGDALKKLKRGFDVRLHGEAEKVINN------QVQ---VNTFAVQP
B3EPP3_CHLPB      ----------------MDVIRLKKGHDLALQGQPEKQLFS------AGR---STLLKIRP
C0QJ16_DESAH      ----------------MEKIKISKGFTTPLAGMPDIGIIELS---------DPRTLGLSA
I5AYN3_9DELT      ----------------MKKLKIFRGFDLNVPEEPDLSCVPLA---------LPTSLGCCA
                                               .                              

NQRA_CHLT2        RPFAPL--PLEVKVTPGDQVTAGSPLAEYKLFSGVFITSPVDGEVVEIRRGNKRALLEIV
NQRA_CHLTB        RPFAPL--PLEVKVTPGDQVTAGSPLAEYKLFSGVFITSPVDGEVVEIRRGNKRALLEIV
NQRA_CHLTR        RPFAPL--PLGVKVTPEDQVTAGSPLAEYKLFSGVFITSPVDGEVVEIRRGNKRALLEIV
NQRA_CHLMU        RPFAPL--PLGVKVSPGDQITAGSPLAEYKSFPGVFITSSVDGEVIEIRRGSKRALLDIV
F8KVC4_PARAV      KPFEET--KFRLLAKVDEKVKIGQPLAEDKEATGRMFVSPAAGVIKEIRRGLKRRLLDIV
D6YT60_WADCW      DPFKGI--RFKLLAKRGDRVKIGQPLVEDKLTEGRVFVSPAGGTIAEVRRGLKRRLIDII
NQRA_VIBC3        EEYVGM--RPTMHVRVGDEVKKAQILFEDKKNPGVKFTSPVSGKVVEINRGAKRVLQSVV
NQRA_VIBCH        EEYVGM--RPTMHVRVGDEVKKAQILFEDKKNPGVKFTSPVSGKVVEINRGAKRVLQSVV
NQRA_VIBPA        EEYVGM--RPTMHVRVGDEVKKAQILFEDKKNPGVKFTAPAAGKVIEVNRGAKRVLQSVV
NQRA_VIBAL        EEYVGM--RPTMHVRVGDEVKKAQVLFEDKKNPGVKFTAPAAGKVIEVNRGAKRVLQSVV
NQRA_PSYIN        EEYVGM--RPFMAVKVGDIVKKGQILFSDKRNSGVHFTSPASGTVKAINRGAQRVLQSVV
NQRA_YERPE        EEYVGM--RPSMLVQEGDQVKKGQALFEDKKNPGVLFTAPASGKISAINRGERRVLQSVV
NQRA_KLEP7        EEYVGM--RPAMAVKEGDRVKKGQILFEDKKIPGVCFTAPASGIVSAIHRGERRVLQSVV
NQRA_NEIMF        EEYAGM--RPSMKVKEGDAVKKGQVLFEDKKNPGVVFTAPASGKIAAIHRGEKRVLQSVV
NQRA_NEIG1        EEYVGM--RPSMKIKEGEAVKKGQVLFEDKKNPGVVFTAPASGKIAAIHRGEKRVLQSVV
NQRA_ACTP2        EEYVGM--RPSMKVREGDVVKKGQVLFEDKKNPGVVFTAPASGTVVTINRGEKRVLQSVV
NQRA_HAEDU        EEYVGM--RPSMKVREGDLVKKGQVLFEDKKNAGVVFTAPASGTVVAINRGEKRVLQSVV
NQRA_HAEPS        EEYVGM--RPSMKVREGDVVKKGQVLFEDKKNAGVVFTAPASGTIVAINRGEKRVLQSVV
NQRA_HAEIG        EEYVGM--RPSMKVREGDVVKKGQVLFEDKKNPGVIFTAPASGTITAINRGEKRVLQSVV
NQRA_HAEIE        EEYVGM--RPSMKVREGDVVKKGQVLFEDKKNPGVIFTAPASGTITAINRGEKRVLQSVV
NQRA_HAEIN        EEYVGM--RPSMKVREGDVVKKGQVLFEDKKNPGVIFTAPASGTITAINRGEKRVLQSVV
C7R8J8_KANKD      EDYVGM--KPTMHVQEGDTVKKGQLIFEDKKTPGVKYTAPAAGTIKAINRGNKRKLLSVV
NQRA_ALCBS        GDYVGM--KPTMEVREGDVVKKGQLIFTDKKTEGVKYTSPAAGKVIAINRGHKRVLQSVV
E1VB38_HALED      TDYIGM--KPTMEVREGDKVKLGQLLFTDKKIEGVRFTAPAAGEVVAINRGEKRKLLSVV
NQRA_SACD2        FDYHGM--KPTMNVQVGDKVKLGQVLFTDKKTVGVKYTSPAAGTVSAINRGERRVLQSVV
NQRA_TERTT        FDYHGM--KPTMAVQEGDKVKKGQLLFTDKKTEGVRYTAPASGTVSAVNRGYQRVLQSVV
NQRA_MARMS        PDFHGM--KPTMLVKEGDKVKKGQIIFTDKKTEGVNYTAPASGTVIEINRGERRVFQSLV
NQRA_PSEAE        FDYHGM--KPTMAVQVGDRVKLGQVLFTDKKNPSVSYTAPGAGVVSAIHRGEKRVLQSVV
F6AIY5_PSEF1      FDYHGM--KPTMAVQVGDRVKLGQVLFSDKRSEGIHYTAPGAGVVSAIHRGEKRVLQSVV
C7RRE9_ACCPU      ADCHGL--RPALAVREGERVEAGQVLFSDKDRPGVVFTAPCAATVAEIRRGAQRVFQALV
D5V826_MORCB      YDYVGM--RPTMHVKEGDKVTKGQVLYEDKKRAGVLYTAPVGGTVVAVNRGERRVFESLV
E1X4A4_HALMS      PDYVGM--KPSMKVQIGDTVKAGQVLFECKKNEGLAFTSPANGKVVEVNRGAKRAFQTIV
C6BWF2_DESAD      GDYVGM--KPSMAVAEGDTVKLGQPIFADKKIDGVVFTAPGAGKVLAVNRGERRTLQSVV
NQRA_RHOBA        DDYIGM--KPTMLVSAGDRVVLGQPVFEDKKTPGVIYTAPASGTVVDVVRGAKRKFEAVV
A1S9X7_SHEAM      KEYVGL--KPSMLVEEGERVIKGQALFEDKSNPGVRFTAPCAGIVSAIHRGDKRLLLSVV
Q82SE3_NITEU      VDYIDL--KPTMKVTEGDRVRLGQPLFEYKKLPGVVFTAPGAGRIVAINRGTRRILLSVV
Q604Z5_METCA      PDFVGL--KPTMQVAEGDRVKLGSVLFTDKQNPGVNFTSPGAGVVKAINRGERRVLQSVV
Q1GLS7_RUEST      QDYIGL--KPRLSVQEGDVIAAGAPVLAHKDTPEVQVTAPVSGRVKAINRGARRVLVSVE
G8PNM3_PSEUV      GDYNGL--KPRMLVAEGDRVVKGQPLFIDKRSPEINYVAPGAGVVEAVNRGARRVLETIV
A5EUU8_DICNV      SDYLGL--KPTMFVAEGELVKKGQALFEDKKNPNVVVCAPVSGRIQSIKRGERRKLLSVI
Q6AM94_DESPS      DDYVGL--RPTMKVEVGDKVICGQLLFTDKQTPGIRFTAPAAGTISAINRGGKRKFLSLV
D6Z599_DESAT      DDYPGL--RPSMEVREGDRVAAGQVLFTDKQNPGVNFTAPAAGVVSAINRGARRRLQSVV
F8E4B2_FLESM      DDFIGL--KPRFLVSEGDFVKKGDALFLHKKNERIKFTSPVAGEVKRINRGEKRKFLSIV
D4H1M5_DENA2      DDFPSM--KPSMLVKEGDHVRKGQPVFVDRKNQEITYTAPVTGTVKSVRRGAKRKFLSMV
S5YJM2_PARAH      SDLQQL--RPALMVKANQKVAAGDILFRDRKRSWITAVAPAAGRVSKLELGARRSLSELE
D3P9H9_DEFDS      DDFTGL--KVKFLVNEGDKVSTGSPIFINRKDEDVVFVSPVNGVVKNIVRGEKRKFLYLS
E4TFZ4_CALNY      DDYVSL--KPKFEKNPGDLIKPGDLLFYDSKNRGIRFYSFVNGEVCEITRGEKRRFISYT
I3YQD8_ALIFI      LDFEGV--TPKLLVKVGDEVKAGTPLFFNKYSERILFTSPVSGTVAAVNRGEKRKILSVT
F9Z516_ODOSD      TDFRAM--TPKLAVKVGDEVKAGDVLFIDKTHPEIKFTTPVSGTIEAINRGERRKLLEVV
X5E439_9BACT      TDFPGL--TPKLSVKVDAEVKAGDALFYDKYHPEILFTAPLGGKVVSINRGERRKILEVV
U5Q9K5_9BACT      SDFRTL--NPKLLVKEGDAVKAGSPILADKTNLSIQICSPVSGVVKEIVRGEKRKLLAVL
E4TPF6_MARTH      TDFPAIT-RPKLLVEEGDTVKAGSPLIYDKMAPDVLYCSPVSGEVAEIKRGEKRKLLELR
L0G061_ECHVK      TDFVGMQ-RPKVTVKEGDTVKAGTPILFDKKLESVLYAAPVSGEIVEIKRGEKRKLLEIK
I4ALH2_BERLS      TDFVGMH-RPKVVVREGDVVKAGTPLFFDKKLEKALYTSPVSGEVVEVKRGDKRKLLEIK
G8R5N5_OWEHD      TDFLGA--RLKLAVKEGDEVKAGSPILFNKDREAVKFCSPVSGEIAEIVRGEKRKLLEIR
I3ZXR4_ORNRL      DDFHGI--IPRLIKREGDQVKAGEAVFHSKMDDKILFPSPVSGTVKEVRRGEKRKILAIV
A3UAF5_CROAH      ADFHLT--IPKMVVKEGAKLRAGDELFYSKTQDSIKVVSPIAGTLKEITRGAKRVITHIV
K4IK22_PSYTT      ANFYSL--VPKMVLKEGAKLKAGDEVFFSKYSAKTRVVSPVSGTLKEVRRGAKRKILDVI
L7WA36_NONDD      ADFHAV--VPKLILKEGAAVEAGEPLFYSKYDEKVKFVAPVSGTITEILRGAKRRILEVK
D5ESG1_PRER2      DDFEGV--TPKVVVKEGDHVKAGDALFVNKQYPEVKFASPVSGTVREVVRGERRKVLCVR
A6L599_BACV8      DDFHGV--TPKVVVKEQEYVTAGGTLFVDKNHPEVKFVSPVSGVVTSVERGERRKVLSIS
F4KLL2_PORAD      DDVPGL--TPKMKVHVGDHVEAGDPIVYDKQYPEIWVTAPVSGELIAINRGAKRKIMSVE
F5HFB1_PORGI      DDFEGV--IPKVTARPGDKVRAGSALMHHKAYPEMKFTSPVSGEVIAVNRGAKRKVLSIE
F4KQY9_HALH1      PNFAGISPMPKLEVQEGQHVKAGDALFFDKRNPDLIHVAPISGEVIAINRGERRAIQEVV
B3EPP3_CHLPB      ADFRGV--KLKLMVKEGDHVRTGAPVLYSKTHPDLFFTSPGSGRISRIVSGERRVINEIV
C0QJ16_DESAH      MDVPHI--RAKLMVKEGDRVQTGAPLFYDKRDKSVQYVSPGTGVIQKIVYGERRRLHEVV
I5AYN3_9DELT      ADIPHI--RPKLLIKEGWRVKTGQSLFTDKRDTSIQYVSPGTGRVEKVVYGHRRRLMEVV
                             .       :  .  :            :   . :  :  * :* .    

NQRA_CHLT2        IKK-KPGI-------SQTKFSYDLQSLTQKDLLEVFKKEGLFALFKQRPFDIPALPTQSP
NQRA_CHLTB        IKK-KPGI-------SQTKFSYDLQSLTQKDLLEVFKKEGLFALFKQRPFDIPALPTQSP
NQRA_CHLTR        IKK-KPGI-------SQTKFSYDLQSLTQKDLLEVFKKEGLFALFKQRPFDIPALPTQSP
NQRA_CHLMU        IKK-KPGV-------SQTKFSYDLHALSQKELLEVFKKEGLFTLFKQRPFNIPALPTQSP
F8KVC4_PARAV      IEVAKEEE-------YQTYSPLDLDKASKEDIIERLKVGGLFAYIRSRPFNTLANPEKVP
D6YT60_WADCW      IELDSEEQ-------EINHGSIDVASASKEQLVDRFLRSGIFTRIRQRPFNLLADPAKTP
NQRA_VIBC3        IEVA-GDD-QVTFDKFEA---NQLASLNRDAIKTQLVESGLWTAFRTRPFSKVPAIDSTS
NQRA_VIBCH        IEVA-GDD-QVTFDKFEA---NQLASLNRDAIKTQLVESGLWTAFRTRPFSKVPAIDSTS
NQRA_VIBPA        IEVA-GEE-QVTFDKFEA---AQLSGLDREVIKTQLVESGLWTALRTRPFSKVPAIESAT
NQRA_VIBAL        IEVA-GEE-QVTFDKFEA---AQLSGLDREVIKTQLVDSGLWTALRTRPFSKVPAIESST
NQRA_PSYIN        IAIE-GKE-SISFPKYTS---TELKNVGRAEIVKNLIDSGAWTALRTRPFSKIPAVDAEP
NQRA_YERPE        IEVE-GDE-QIPFEHYAA---EELNQLSDEQVQHHLLTSGLWTALRTRPFSKTPVPGSRP
NQRA_KLEP7        IDIE-GND-AVAFTRYAA---DALAELPRDTVQQQLLASGQWTALRTRPFSKTPLPGSTP
NQRA_NEIMF        IAVE-GND-EIEFDRYAP---DALAKLSGKEVRRNLIQSGLWTALRTRPFSKIPAVDAEP
NQRA_NEIG1        IAVE-GND-EIEFERYVP---EALAKLSSEKVRRNLIQSGLWTALRTRPFSKIPAVDAEP
NQRA_ACTP2        IKVE-GDE-QITFTRYEA---AQLASLSAEQVKQNLIESGLWTAFRTRPFSKVPALDAIP
NQRA_HAEDU        IKVE-GDE-QITFTRYEA---AQLASLSAEQVRANLIDAGLWIAFRTRPFSKVPAVDATP
NQRA_HAEPS        IKVE-GDE-QVTFERYNA---SELSSLTADQVKQNLVNSGLWTAFRTRPFSKVPALDAVP
NQRA_HAEIG        INVE-GDE-KITFAKYST---EQLNTLSSEQVKQNLIESGLWTALRTRPFSKVPSIESEA
NQRA_HAEIE        INVE-GDE-KITFAKYST---EQLNTLSSEQVKQNLIESGLWTALRTRPFSKVPSIESEA
NQRA_HAEIN        INVE-GDE-KITFAKYST---EQLNTLSSEQVKQNLIESGLWTALRTRPFSKVPSIESEA
C7R8J8_KANKD      VEVAEQEE-AVNFNKFSP---EQLSGLSREAIVEQMVESGMWTALRKRPYSKVPAIDSET
NQRA_ALCBS        IEVADQED-EVTFASYSA---DQLRSLDRDAVQQQLVDSGEWTLLRTRPFGKVPAPGSTP
E1VB38_HALED      IKVDDTEE-AVSFTAHGR---DKLASLERQTVVDQLVESGLWTALRTRPYSRTPALDAKP
NQRA_SACD2        IDIEGDE--AESFKTFSE---AEIASADRQALVDNLVDSGLWTALRTRPYSKVPQLDSVP
NQRA_TERTT        IDVEGGE--AETFAKYSE---SDLANLARQQVVDNLNDAGLWAAIRTRPFSKAPALDAVP
NQRA_MARMS        IRVEGDE--SETFTSYSG---SELKSLERSKVVDNLVNSGLWTSFRTRPFSKVPEIASVP
NQRA_PSEAE        IDLDGDE--QLEFARYPA---DKLATLSAEQVRDNLLQSGLWTALRTRPFSKVPDPESSP
F6AIY5_PSEF1      IDLDGDE--QETFAHYPA---AQLASLDGAQIRENLQQSGLWTALRTRPFSKVPAVDAVP
C7RRE9_ACCPU      LETNASA--SDGPALGPAREDAELAVLDPAVVRAQLLASGLWTALRTRPYSLLPAADATP
D5V826_MORCB      IAVDPNASEEITFNAYRS---EDLSMLDRKTVVEQLVASGEWTALRTRPFSRTPEINSIP
E1X4A4_HALMS      IEVTGTEQ--VEFSSYKQ---KSVSDLSFDEVKRLLLESGLWTSLRMRPFSKVAMLEDKP
C6BWF2_DESAD      IELDDAAG-EVEFPAYDS---DKLLGLDREKVVDNLVKSGLWTAFRTRPFSKTPAPESEP
NQRA_RHOBA        IDVDNDSTETTTIDGIAG---SDPISIAREKLVDGLVQIGLWSAFRTRPFGKVPTIESRP
A1S9X7_SHEAM      IDCDGS---DESIDFGVE---ANLAALSREQVQDKLLQSGLWTALRTRPFSRAPKPGSAP
Q82SE3_NITEU      LQLDEQE-DEETFIKYAP---DELSNLADEQVKENLLISGLWTTLRTRPYSKVPDPATRP
Q604Z5_METCA      IELDGK--DEVTFASYKA---VELAGLSETQVRENLLASGLWTFLRTRPYSKVPNPDTRP
Q1GLS7_RUEST      IEVDEAAAEPVDFSTIGD---DS----SAEGLRTRLCASGLWTSFRTRPYSKVPAPDTAP
G8PNM3_PSEUV      IKLDDGNEEQVAFSKFEA---GALATLDATVVREQLAKSGLWTSFRTRPYSKVPVFETQP
A5EUU8_DICNV      IEVQHDDE-AVPFKSFSV---NELQELPEDVIREQLRLSGQWVNIRQRPFDKIPRFDATA
Q6AM94_DESPS      IDLAKDLA--CTFLHPE-------DVYTSESIGDILIQSGLWTCFRTRPYGKIPGIETSP
D6Z599_DESAT      IALEGDEQ--RSFAVGGG------EGRSPEKIRRVLVDSGLWTAFKTRPYGKVASPSASP
F8E4B2_FLESM      IRKSGDDS--VTFNKYS-----NLNNIPAEDVRNQLLESGLWTSFVSRPYGKIADPEAES
D4H1M5_DENA2      FEKSSGDA--VRFNTRV-----TDR----QSVYELLKESGLLASFRERPFAKCPSAQRKP
S5YJM2_PARAH      ILPEGDAVRQFTTDVADR-----------AQLIDLMIASGLWTALRTRPFGRIPDPSTQP
D3P9H9_DEFDS      IEVED----------HTSVEAIDFK-DNNLNYKYILLKYGFWPYFRKRPFDKIPSSTSKP
E4TFZ4_CALNY      LKGEPSVY-----NYPENLSKISLKKENRDKIIDIIINSGFWISIRQRPFDRVANPDVVP
I3YQD8_ALIFI      VTPASVQS----YEEFAKP---DLQKASREEIVELLLKSGLWPMIVQRPYGVIADPNDTP
F9Z516_ODOSD      VKADAETR----YRDFGKT---EVSKLNRDEIIDRLLESGVWPLIKQRPYDIIADPMSTP
X5E439_9BACT      IATDEKIG----SAEFKKA---DPSTLSAEEVKEQILKSGLWPFIKKRPYGIIANPEEKP
U5Q9K5_9BACT      IHNDKKYE----HIQFNVP---NPKTAIKEEIVNVLLESGLWPVIKQRPYGITPNPAIEP
E4TPF6_MARTH      ILADKENE----FEDYGKHSKSDLKSLDAQKAKETMLKSGVWPNIIQRPYGIVANPEDSP
L0G061_ECHVK      IMADKEIS----YEEFSKFSESDLKSLTKEQATDALLKGGVWPQIIQRPFGIVANPEDEP
I4ALH2_BERLS      ILADKQIE----YENFTKYSVSDMANLKGEDVKESLLKSGAWINIIQRPYGVVANPDETP
G8R5N5_OWEHD      ILADKEVK----YENFGAA---DPKSLDAKAVKEKMLASGCWPFITQRPYNVVANPERSP
I3ZXR4_ORNRL      VEPDGANT----SLEFTPL---DLSKATAEEVKQRLLEGGCWPFVKQRPYDVIANPEETP
A3UAF5_CROAH      IEADGSNE----SRDFGAV---NVASADAEVLRARFLESGLWPFIKQRPYDVIANPTSEP
K4IK22_PSYTT      IEADETQV----YKDFGVM---DPLKSDSTEVKDRIFSTGLGIFLNQRPYNIPANADDTP
L7WA36_NONDD      ITANGTSE----AINHGKV---DVSNATADQVKSMLLESGCWPFIIQRPYSVIANSEDTP
D5ESG1_PRER2      VDADEQQE----FTDFGKK---DVSKLVDEQVINALLEAGIFGYINQLPYAVSTNPSVKP
A6L599_BACV8      IAAAKEQD----YEEFGKK---DVSTLTGEQVKAALLEAGLFSFIIQRPYIVVADPNAKP
F4KLL2_PORAD      IRPDECQT----QRAFAVE---GLLDGEVSKLQALLLESGLWTLIRQRPYDRIANPTIAP
F5HFB1_PORGI      VKPDGLNE----YESFPVG---DPSALSAEQIKELLLSSGMWGFIKQRPYDIVATPDIAP
F4KQY9_HALH1      ILADRTIQ----YRTYAAVP--NVENSSREALVAFLLESGAWPLIRQRPYNVLADQNAVP
B3EPP3_CHLPB      IDLDKTDS----FEAFERFNEQSIASLSSERIKGQLLRSGLWPAIRQRPFSTVANPDIVP
C0QJ16_DESAH      ISLEGAED----FVEFDPISLSALGEVSRQVLVERLKQGGMWQALRQFPAMDTADASHTP
I5AYN3_9DELT      IATEPEDE----YVEYDPVTLAGIVGMPRDALVTNLKNGGLWQGLRQFPALDVADPDHSP
                  .                                  :   *    .   *    .     .

NQRA_CHLT2        RDVFINLADNRPFTPSVEKHLSLFSSKEDGYYIFVVGVQAIAKLFG--LKPHIISTDRLT
NQRA_CHLTB        RDVFINLADNRPFTPSVEKHLSLFSSKEDGYYIFVVGVQAIAKLFG--LKPHIISTDRLT
NQRA_CHLTR        RDVFINLADNRPFTPSVEKHLSLFSSKEDGYYIFVVGVQAIAKLFG--LKPHIISTDRLT
NQRA_CHLMU        RDVFINLADNRPFTPSVEKHLSLFSSKEDGYYIFVVGVQAIAKLFG--LKPHIVSTDRLS
F8KVC4_PARAV      RAIFVKAVESAPFVPPAELQIQGHEKD------FQTGLNALAKLTS--GKVHLVYKEDTP
D6YT60_WADCW      RNIFVKAVESAPFVPPAEMQVEGKEKE------FQAGLTALSKMTD--GKVHLIYRKGTE
NQRA_VIBC3        EAIFVTAMDTNPLAAEPTVVINEQSEA------FVAGLDVLSALTT--GKVYVCK-KGTS
NQRA_VIBCH        EAIFVTAMDTNPLAAEPTVVINEQSEA------FVAGLDVLSALTT--GKVYVCK-KGTS
NQRA_VIBPA        KAIFVTAMDTNPLAAKPELIINEQQEA------FIAGLDILSALTE--GKVYVCK-SGTS
NQRA_VIBAL        KAIFVTAMDTNPLAAKPELIINEQQEA------FIAGLDILSALTE--GKVYVCK-SGTS
NQRA_PSYIN        VSIFVTAMDTNPLAADAELIINTNKQA------FTDGLALLEQLTA--GKVYVCK-GETN
NQRA_YERPE        RAIFISAMDTQPLAADPQVIIATESEA------FNHGLTVLTRLTD--GKVHVCHAAGQA
NQRA_KLEP7        AAIFVNAMDTNPLAAEPQPIILAERAA------FDAGLTVLTRLTD--GKVHVCQPSGGK
NQRA_NEIMF        FAIFVNAMDTNPLAADPVVVIKEAAED------FRRGLLVLSRLTE--RKIHVCKAAGAD
NQRA_NEIG1        FAIFVNAMDTNPLAADPTVIIKEAAED------FKRGLLVLSRLTE--RKIHVCKAAGAD
NQRA_ACTP2        SSIFVNAMDTNPLAADPEVVLKEYETD------FKDGLTVLTRLFNGQKPVYLCKDADSN
NQRA_HAEDU        ASIFVNAMDTNPLSADPAVIINEYKND------FEYGLTVLIRLG---VKVNLVKAAGVN
NQRA_HAEPS        SSIFVNAMDTNPLATDPEVVLNEHKQD------FVDGLTVLSRLFDGQKIIHLCRAPDSN
NQRA_HAEIG        SSIFVNAMDTNPLAADPSVVLKEYSQD------FTNGLTVLSRLFP-SKPLHLCKAGDSN
NQRA_HAEIE        SSLFVNAMDTNPLAADPSVVLKEYSQD------FTNGLTVLSRLFP-SKPLHLCKAGDSN
NQRA_HAEIN        SSIFVNAMDTNPLAADPSVVLKEYSQD------FTNGLTVLSRLFP-SKPLHLCKAGDSN
C7R8J8_KANKD      QAIFVSAMDTNPLAADPEVIISEQNEA------FNYGLDILAQLSG--DKVFVATGPNSS
NQRA_ALCBS        NSVFVSILDTNPLALDPAVVIKENEQA------FRHGLTVLSRLTD--GPVWVCRGPNTD
E1VB38_HALED      ENIFVTAIDTHPLSPDPAGIINEQAEA------FEDGLKVLTRLTE--GKVFLCTAPQAS
NQRA_SACD2        NSIFVTAMDTNPLAADPQLVIGEKSAA------FALGLAVLAKLTE--GKVFVCHADGAS
NQRA_TERTT        AAIFVSAMDTNPLAADPTLIINERPQS------FINGLVVLSKLTE--GKLFVCHAEGAS
NQRA_MARMS        NSIFVTAIDTNPLAASPEVVLADQAEA------FADGLTVLTRLTE--GKVFLCKASGAK
NQRA_PSEAE        SSIFVTAIDTQPLAADPQVVIAEQGEA------FQAGLTVLGRL----ARVFLCKAEGVS
F6AIY5_PSEF1      SSIFVTAIDTHPLAADPAPIIAEHAAD------FESGLKVLARL----GKVFLCKAPGVS
C7RRE9_ACCPU      RSIFVTAIDTHPLAADPQLIIAAHADD------FRRGIVALSRL----ARVFVAVPVTGD
D5V826_MORCB      SAIFVTATDTNPLAVDPATVLFEEIQA------FNDGLAILSTLS---PKTYVCHGDIVP
E1X4A4_HALMS      HSVFINAMDTNPLSPNPEQVIGQYTED------FMAGVEVLSKLTE--GKTFVAKASGSK
C6BWF2_DESAD      RSIFVTAMDTNPLAMDPAPVIWKESDA------WLDGLRILTCLND---TINVCVTGGTA
NQRA_RHOBA        HSIFVTAIDTNPLAADPAVVLADRKDQ------FVIGLQALTRLTD--GAVHLCQ-AEKA
A1S9X7_SHEAM      AGLFVTAVDTNPLAADPRIIINTDVDA------FAAGMQVLTHLTD--GPVFLCQDGNHE
Q82SE3_NITEU      AAIFITAIDSNPLAADPVPIITAEMES------FNHGLRILSRLTD--GPLWVCQ-SPQA
Q604Z5_METCA      HSIFVTAIDTNPLAARPDVVIQGRAED------FRNGLAVISKLTE--GKVYLCK-APAQ
Q1GLS7_RUEST      AAIYVTAMDSEPLSGDAATIINDQAEA------FARGLQAVTLLTE--GKTYLCQ-DSGA
G8PNM3_PSEUV      RSIFVTAMDTNPLAADAGVIINANAGA------FEAGLQVVSKLTD--GRTFVCH-SPKD
A5EUU8_DICNV      FAIFINAMDTNPLSFDPLLALSGREED------YQMGLAVISKLTA--GNVHVCFKEGGA
Q6AM94_DESPS      HSLFITASDSAPLAPLPQSIIAEYSDE------YSEGLRQLRAYFS--CPIYYCTNQEAL
D6Z599_DESAT      AALFVTAIDTRPLAAEPAVVIAEASED------FRAGLQLLATLAP--KTYLCTSPPAAP
F8E4B2_FLESM      PDIFITAADTRPLAPRVVNVIGDNYDS------FYDGVDVISSLTK--SKVFVCIDDENF
D4H1M5_DENA2      QAVFINCMDTRPLAPDMSILLKGFEDY------FRKGAEALTKLS---DKTFICKG-VDL
S5YJM2_PARAH      EALFVTLTEGAPGMPDPAAILPDLMDW------FTRGLSALTMLSD--GPVNLCHPPDLA
D3P9H9_DEFDS      VAIFVTAIDTRGFAPEPNFIIEKEKEN------FIKGVNVLKEAFGVKTFLCVDKDFNKS
E4TFZ4_CALNY      DKIFVLLIDTRPYSPEIKTILNGNEEY------LKTGLQIFSILTKTDLYLIKDKRITFD
I3YQD8_ALIFI      KAVFISAFDSAPLAPDYNYVLRAEQKN------LQTGIDVMRKLTS--GKVHLSVRAK--
F9Z516_ODOSD      KAVFVSAFDSAPLAPDYDLILNNQSKD------LQTGIDCLCKLCN--KNVNLGLQEN--
X5E439_9BACT      KAIYISTFDTAPLAPDYNFVIDGQMDT------FQTGVNALAQLTE--GKVNLGVSKD--
U5Q9K5_9BACT      KAIYISGFDSSPLAPDLDFTLKSEKES------LQAGIDVLNLLTK--GGIHLSLHIN--
E4TPF6_MARTH      KAIFISAFDTHPLAPDYNFIYKEEEEA------FAAGLEVIKKFTE--GKVHINISED--
L0G061_ECHVK      KAIFISGFDSHPLAPDYGVLLKGQEKY------FQAGLNTLKKLTS--GKVHLNLDQD--
I4ALH2_BERLS      RAIFISAFDSNPLAPDYDFLYKNEGQY------FQAGIDALKKMVD--VPIHLTTNGK--
G8R5N5_OWEHD      KAIFISCFNSDPISVDVDFAVHGMEKE------FQAGIDALSKLTE--GKIHLGLQGG--
I3ZXR4_ORNRL      KAIFISGYNSAPLAPDADYLVEGKERE------LQAAIDALGKLTS--GKIHLTIGKD--
A3UAF5_CROAH      KAIFISGYASAPLVADLDYTLAKQEEK------LQAAVTALSKMTK--GQVHVTIGKD--
K4IK22_PSYTT      KAIYISAYNTAPLTGSAEFILKARVEF------FQAGINALTKLTG--GKVYLGVDKQ--
L7WA36_NONDD      KAIFVSAYATAPLAGDPEVILADKKEA------FQAGITALSKLTS--GKVHLCVGK---
D5ESG1_PRER2      RAIFVSALRDKPLACDFEYEVEGQIDD------FQTGIDALSRIAT--VYLGVGVGSK--
A6L599_BACV8      KGIFVSAFDTNPLAADFEFVLKGQEKD------FQTGLDALAKMAK--TYLNISVEQK--
F4KLL2_PORAD      RDIFVTAHLTAPLAPEVDYLLEGREEE------LRIGLRALARLTE--GKVFVGVAQN--
F5HFB1_PORGI      RDIYITANFTAPLAPDFDFIVRGEERA------LQTAIDALAKLTT--GKVYVGLKPG--
F4KQY9_HALH1      RDIFISTFDTAPLAPDLNLIVEGKAAV------FQKGLDVLNRLTS--GKVYLGIDGRGI
B3EPP3_CHLPB      KAVFVSAMPTAPFAPDTDYLLEQDDRG------FQSGLSVLKNLTG--RPVHLVIGRN--
C0QJ16_DESAH      SMIIVSLSGNDPFSPDPGVVFEREQTA------LHFGLEVLKRLSDRIVVTVREGSLERL
I5AYN3_9DELT      AMIIVAMDGNDLFSPHPAIILKGNIAA------FEAGMAVLRRFSHQLAVVCRASRVERI
                    : :                               .   .                   

NQRA_CHLT2        LPTQDL-----VSIAHLHTIDGPFPSGSPSTHIHHIARIRNERDVVFTIS-FQEVLSIGH
NQRA_CHLTB        LPTQDL-----VSIAHLHTIDGPFPSGSPSTHIHHIARIRNERDVVFTIS-FQEVLSIGH
NQRA_CHLTR        LPTQDL-----VSIAHLHTIDGPFPSGSPSTHIHHIARIRNERDVVFTIS-FQEVLSIGH
NQRA_CHLMU        LPTQDL-----ISVAHLHTIAGPYPSGSPSTHIHHIARIRNDRDIVFTIS-FQEVLSIGH
F8KVC4_PARAV      SQAFLQ-----AQHVEKHTVKGPHPIGNVSLHIQHIDPIRSPEDILWTLT-AADVAAIGY
D6YT60_WADCW      SRAFTE-----AKDVEKHTGEGPHPLGTHSLHIDRIDPIQGVEDIVWTLN-VHDVVSIGH
NQRA_VIBC3        LP-RS-----QQPNVEEHVFDGPHPAGLAGTHMHFLYPV-SADHVAWSIN-YQDVIAVGQ
NQRA_VIBCH        LP-RS-----QQPNVEEHVFDGPHPAGLAGTHMHFLYPV-SADHVAWSIN-YQDVIAVGQ
NQRA_VIBPA        LP-RS-----SQSNVEEHVFDGPHPAGLAGTHMHFLYPV-NAENVAWSIN-YQDVIAFGK
NQRA_VIBAL        LP-RS-----SQSNVEEHVFDGPHPAGLAGTHMHFLYPV-NAENVAWSIN-YQDVIAFGK
NQRA_PSYIN        LP-KS-----ESVNVEEKLFSGVHPAGLAGTHIHFIDPV-SAVKQVWSIN-YQDVIAFGM
NQRA_YERPE        VT-RH-----TNTQVTYNEFSGPHPAGLVGTHIHFLEPV-SQTKMVWHVG-YQDVIAIGK
NQRA_KLEP7        LG-GH-----PLGQVCFNQFSGPHPAGLPGTHIHFLEPV-SLNKQVWHLN-YQDAIAIGK
NQRA_NEIMF        VP-SE-----NAANIETHEFGGPHPAGLSGTHIHFIEPV-GANKTVWTIN-YQDVIAIGR
NQRA_NEIG1        VP-SE-----NAANIETHEFGGPHPAGLSGTHIHFIEPV-GANKTVWTIN-YQDVIAIGR
NQRA_ACTP2        IPLSP-----AIEGITIKSFSGVHPAGLVGTHIHFVDPV-GATKQVWHLN-YQDVIAIGK
NQRA_HAEDU        IP--------TVDGITVHEFAGKHPAGLVGTHIHFIDPV-NLTKTVWHLN-YQDVIAFGK
NQRA_HAEPS        IP-TA-----EVANVKVTSFAGPHPAGLSGTHIHFIDPV-SVTKSVWYLN-YQDVIAIGK
NQRA_HAEIG        IP-TT-----DLENLQIHDFTGVHPAGLVGTHIHFIDPV-GIQKTVWHIN-YQDVIAVGK
NQRA_HAEIE        IP-TT-----DLENLQIHDFTGVHPAGLVGTHIHFIDPV-GIQKTVWHIN-YQDVIAVGK
NQRA_HAEIN        IP-TA-----DLENLQIHDFTGVHPAGLVGTHIHFIDPV-GIQKTVWHIN-YQDVIAVGK
C7R8J8_KANKD      LA-KS-----NNAKVNYEEFSGPHPAGLVGTHIHFLYPA-SMDHPVWYIG-YQDVISLAK
NQRA_ALCBS        LPSFA------GGQVREEAFSGKHPAGNVGTHIHYLDPV-GLNKTVWSVG-YQDVIAIGK
E1VB38_HALED      VPGGE------VDGVVTETFSGPHPAGLVGTHIHHLSPV-ALHKSVWHLG-YQDVIAFGK
NQRA_SACD2        VPTSA------AANVEAKAFSGVHPAGNAGTHIHFLDPV-SANKTVWTIG-YQDVIAYGE
NQRA_TERTT        VPQSS------VATYET--FGGVHPAGNVGTHMHFLAPV-SLERQSWSVG-YQDVMAIGD
NQRA_MARMS        IPTTS------DVTVEE--FSGVHPAGLAGTHIHFLDPV-NDKKTVWSIN-YQDVVAIGK
NQRA_PSEAE        LPGEA------LSGVTAQAFSGPHPAGLPGTHIHFLDPV-GAGKSVWNLN-YQDVIAIGK
F6AIY5_PSEF1      LPGEQ------VEGVRSKAFAGPHPAGLPGTHIHFLDPV-SVSKSAWTIN-YQDVIAVGK
C7RRE9_ACCPU      APSPAAEAAAGLANVHCAAFAGPHPAGLPGTHIHYLDPA-SATRTVWHLH-YQSCIAIGR
D5V826_MORCB      ETLSKTAD---GNDTIYEGFTGVHPAGNAGTHIHFLHPL-ARGSLVWTIN-YQDVIAIGK
E1X4A4_HALMS      VQAPS--------CASVHEFAGPHPAGLVGTHIHHLDPV-HEAKVVWHAG-YQDVIAIGK
C6BWF2_DESAD      LPLIQ--------EVKMHMFSGPHPAGLPGTHIHFVDPV-GPSKTVWHIG-YQDVIAIGK
NQRA_RHOBA        SIPGGDV-----AGVQSASFAGPHPAGLPGTHIHHLDPV-SLNKTVWYIG-YQDVIAIGS
A1S9X7_SHEAM      LLPGAEL-----PRVQTHRFQGVHPAGLVGTHIHMLMPV-SMERQVWHIG-YQDVMAVGR
Q82SE3_NITEU      KLSLPEDL----PQLQQARFAGPHPAGLPGTHIHFLQPV-SAYKTVWYLN-YQEVIAIGK
Q604Z5_METCA      AVPSIDD-----GKVEVAEFDGPHPAGLAGTHIHHLDPV-GPSKCVWYLD-YQSVIAIGA
Q1GLS7_RUEST      TIPGADL-----ASVTAVGFAGPHPAGLAGTHMHFLEPP-TAEKTVWTIG-YHDVIAIGH
G8PNM3_PSEUV      KLPGADV-----ADVQMESFEGKHPAGNSGTHIHFLDPV-NENKTVWTIG-YQDVIAIGN
A5EUU8_DICNV      LPAVE------NEKVKYHTFSGVHPAGLVGTHIHFIEPV-GSQKTVWHLG-LQDLLAIGH
Q6AM94_DESPS      LPAEE------LEGLDYNCFLGPHPAGLASTHIHFLDSA-SEDKTVWNIS-YQDVISIGY
D6Z599_DESAT      LPGED------LPGITVARFSGPHPAGLPSTHIHFLDPV-GPGKEVWQIG-YQDVMAIGH
F8E4B2_FLESM      YIPSD-----LPDNVEIVRFDGPHPAGLAGTHIHFLSPA-SREKSVWQIG-YQDVIAAGK
D4H1M5_DENA2      NLPDV-----RDADVRI--FDGPHPAGLSGTHVHFLYPA-SMNRTVWTVD-MQSVIDIGY
S5YJM2_PARAH      LPEVL------------GIRTHPFRGGLASAHIHTLHPV-THGGMVWQIH-WQEVAALGH
D3P9H9_DEFDS      MLSEDNL-------LEVAVFHGPHPAGLAGTHIDYLRKP-TMEEEVWYID-YQAVIDIGY
E4TFZ4_CALNY      VELEN---------LKIIDVSGHHPAGLVGTHINNLYPL-NRKRSIWYID-YQDIIAIGK
I3YQD8_ALIFI      --AEGQ--MTALKGAETHAFAGKHPVGNVGVQIHHIDPV-NKGEVVWTVN-IQDLAIIGR
F9Z516_ODOSD      TPSASV--FTKLQHVDINYFAGPHPAGNVGVQIHHLNPI-NKGEQVWVVN-IQDVAIIGR
X5E439_9BACT      ----SA--FTSLKNVVVNTFEGPHPAGNVGIQIANTSPI-NKGEVVWTIN-VQDVLFIGR
U5Q9K5_9BACT      NHAGSP--FHRLERVIFHTIEGPHPAGNVGIQINNIDPV-NKGEVVWTID-MYGVAAIGK
E4TPF6_MARTH      KEMLKM--FSQAEGVQINKFSGKHPSGNVGVQIHHIDPI-NKGDIAWTVK-PYGVIQIGK
L0G061_ECHVK      SEVSPV--YAGAQGVEVNKFSGPHPAGNVGVQIHHLDPI-NKGEVAWTIN-PYGVVQIGK
I4ALH2_BERLS      AEVSAI--FQNVRNVEQHTISGPHPAGNVGVQIHHIEPV-NRGEVVWTIS-PYGIIQIGK
G8R5N5_OWEHD      SNPSSV--FANCTGVEKHSFKGPHPAGNVGVQIHKIDPI-NKGEVVWTVN-PENVIIIGR
I3ZXR4_ORNRL      SG-ASA--FSKLNGVELHKAYGPHPVGNVSTQIAKVDPI-NKGERIWVVK-PEDLVTIGD
A3UAF5_CROAH      S--VSP--FENLKDITLHKITGPHPAGNVGTQISKIDPV-NKGEVVWTVN-AQDLIVIGE
K4IK22_PSYTT      S--ASF--LKDIENVEILNISGPHPAGNLGTLIHETEPM-NRGERVWTVN-PEDVAIIGE
L7WA36_NONDD      ---GSS--LKDISNTDVHTVKGPHPAGNVGVQIHKIDPI-NMGERVWTVG-AEDVATIGN
D5ESG1_PRER2      --------LENTKNAEVTVFDGKCPAGNVGVQVNNIAPV-NKGEVVWTIGDPSVVLFIGR
A6L599_BACV8      S---PA--LTNAKNVTVTAFDGPNPAGNVGVQINHISPI-NKGETVWTLR-AEEVIFIGR
F4KLL2_PORAD      S---P---LTLPAEVVRVEVRGPHPAGNVGVLINHTAPV-NKGETVWTLR-ATDVALIGR
F5HFB1_PORGI      S---S---LGLHNAEI-VEVHGPHPAGNVGVLINHTKPI-NRGETVWTLK-ATDLIVIGR
F4KQY9_HALH1      SVPSTV--FTQANGVEKVRFKGKHPAGNVGVQIHHIRPI-RSKEKVWTLG-VQDVLTLGT
B3EPP3_CHLPB      -ASHPL--LTSVKDVVLHAFTGPHPAGNVGIHIHHIAPIRNRDDSVWYLS-LQDVSRIGK
C0QJ16_DESAH      GKVKSSV---------THTVPDIYPAWNPGAVLYHLKKD-SAENSSWCIA-ADHLVMMAR
I5AYN3_9DELT      REIGSSVA-----DQITHTAPDIYPAWQPGAVLYQIKQQ-AAENSSWCIR-LDHLVMMGR
                                               .  :             :           . 

NQRA_CHLT2        LFLKGFVLGQQIVALAGSALPPSQRKYLITAKGASFSDLLPKDIFSSDE-----------
NQRA_CHLTB        LFLKGFVLGQQIVALAGSALPPSQRKYLITAKGASFFDLLPKDIFSSDE-----------
NQRA_CHLTR        LFLKGFVLGQQIVALAGSALPPSQRKYLITAKGASFSDLLPKDIFSSDE-----------
NQRA_CHLMU        LFLKGFFLGQQVVALAGSALPPSQRKYLITAKGASFKDLLPQEIFSSND-----------
F8KVC4_PARAV      FLTNGKILAERVISIAGPGVIDNQIGYYKVRSGYPINRLVAGKIRKGF------------
D6YT60_WADCW      LLKTGKILTERVIGIAGPGIISGRTGYFRVREGFPIEALISNRIKEGY------------
NQRA_VIBC3        LFLTGELYTQRVVSLAGPVVNK--PRLVRTVMGASLEQLVDSEIMP--------------
NQRA_VIBCH        LFLTGELYTQRVVSLAGPVVNK--PRLVRTVMGASLEQLVDSEIMP--------------
NQRA_VIBPA        LFLTGELYTDRVISLAGPVVNN--PRLVRTVMGASLDDLTDSELMP--------------
NQRA_VIBAL        LFLTGELYTDRVVSLAGPVVNN--PRLVRTVIGASLDDLTDNELMP--------------
NQRA_PSYIN        LFTTGELYTNKVISLAGPAVKK--PRLLRTHYGASINQLTKNELID--------------
NQRA_YERPE        LFTRGELCTDRIVALAGPQVNQ--PILLRTRLGASLSELTAGKLKE--------------
NQRA_KLEP7        LFLDGELYCERIIALGGPQVTS--PRLVKTTLGASLEDLLAGELQE--------------
NQRA_NEIMF        LFATGRLNTGRVVALGGSQVNK--PRLLRTVLGAKVSQITAGELVD--------------
NQRA_NEIG1        LFVTGRLNTERVVALGGLQVNK--PRLLRTVLGAKVSQLTAGELVD--------------
NQRA_ACTP2        LFTTGELFTDRIISLAGPQVKN--PRLVRTRLGANLSQLTANELNA--------------
NQRA_HAEDU        LFTTGELFTDRVVALAGPQVKT--PRLVRTRLGANLSQLTTGELNV--------------
NQRA_HAEPS        LFTTGELYTDRVVSLAGPQVKK--PRLVRTQLGANLSQLTAGELAE--------------
NQRA_HAEIG        LFTTGELYSERVISLAGPQVKQ--PRLVRTIIGANLSQLTQNELSA--------------
NQRA_HAEIE        LFTTGELYSERVISLAGPQVKE--PRLVRTIIGVNLSQLTQNELSA--------------
NQRA_HAEIN        LFTTGELYSERVISLAGPQVKE--PRLVRTTIGANLSQLTQNELSA--------------
C7R8J8_KANKD      LFIEGELHTDRVIALGGTMIKK--PRLVRTRVGACINELLAEEEND--------------
NQRA_ALCBS        LFTEGKISSARVVALTGPQAKT--PRALRTRVGASVDDFAQGELKE--------------
E1VB38_HALED      LFAEGKLDVNRVIAVGGPRAKQ--PRLLRTRLGASTEELLNGEVVEP-------------
NQRA_SACD2        LFTSGKLPVDRVVSLAGPQVTD--PRVVRTRLGASLQELTAGQLKD--------------
NQRA_TERTT        LFTSGELASERVVALGGPQMEN--PRLVRTLVGASLEELTAGQLKA--------------
NQRA_MARMS        LFVTGELSVERVISVAGPQVKK--PRLVRTQVGVSLNDLLAGELSE--------------
NQRA_PSEAE        LFTTGQLWTERVIALAGPVVEK--PRLVRTRLGANLDELAAGQLQP--------------
F6AIY5_PSEF1      LFTTGQLWVERVVALAGPVVER--PRLLRTRLGANLTELTAGELAP--------------
C7RRE9_ACCPU      LFASGRPWCERIVSLAGPGVVS--PRLLRTLPGADLLALTAGSLHP--------------
D5V826_MORCB      LFTTGRIYTERLISLAGPAVAN--PRLVRTTRGADLTELTQGELNG--------------
E1X4A4_HALMS      LFTTGKLWTERVIAVAGPKAKN--PRLLTTQLGANILDIVANETLE--------------
C6BWF2_DESAD      LFTTGRLATERYVALSGPMVNR--PRIIKTRLGANLDEMLSGELKD--------------
NQRA_RHOBA        FLQTGQLDTRRVISLAGPKVNQ--PRLIETRLGACIDELIDGEVDTS-------------
A1S9X7_SHEAM      LFTTGQLDNRRIVSLAGPNVLK--PRLIATVLGAKVSDLVKGELKDE-------------
Q82SE3_NITEU      LFVTGRLWTERIVALGGPGVKK--PRLLRTRLGASLEELLAGELVES-------------
Q604Z5_METCA      LFTTGRIDVERIVSLAGPGVAR--PRLLRTRLGACLCDLTAGQTVAD-------------
Q1GLS7_RUEST      LLLTGRINSERVIALSGPKCSR--PRLVRTLNGASMTDLCAEDLGGE-------------
G8PNM3_PSEUV      LFLTGELDVSRVVSVAGPLATK--PRLVTTRVGADLTELLAGETLPG-------------
A5EUU8_DICNV      LFRTGTLDTQRIVAIAGPGVKK--PELVRTVKGANLDELLEDNLLS--------------
Q6AM94_DESPS      LFRTGRLMTERIIAITGPSARQ--PSLLRTHIGADIHQLCRDE----------------G
D6Z599_DESAT      LFRHGRLASSQVVALAGPGMAN--PRLVRTARGAALPELLRDELVTGALPPETSPENLQG
F8E4B2_FLESM      LFRTGEIYTKRVISIAGEGVRE--PSLIRTDIGADIFDILKSKLVNDNK-----------
D4H1M5_DENA2      LLTHGELNETTRVALCG-GFEK--PCYVETLKGAPVAELVKGRVQNSG------------
S5YJM2_PARAH      LLKTGTIWPRRIVALTGSAMAR--PGLIAAPIGARLHDLAAGRLKD--------------
D3P9H9_DEFDS      FFNTGKINPYKYVSIAGYGFQE--NGIFKILKGSRLDNIQDLSKDY--------------
E4TFZ4_CALNY      LFKDNIIDNQKVISVGGEGVK---NSLYRVYNYASLDMLVPFNDDI--------------
I3YQD8_ALIFI      LFNEGRVDMTKIIAVAGSEIE--KPQYCRIIAGAKVDSI---LKGN--------------
F9Z516_ODOSD      LFNEGRFDARKIIALAGSEVT--KPQYYHSILGASIQDL---TAGK--------------
X5E439_9BACT      LFETGKVDFTKAVALTGSEVK--TPKYYQTTLGAPVATI---VGGK--------------
U5Q9K5_9BACT      LFTKGIYDIKKTIAITGPRCV--NPSYVECLPGMCMSDIKEYAGHI--------------
E4TPF6_MARTH      LFLTGKYDASKKVALTGSEVS--EPQYYQTYVGASIKNI---------------------
L0G061_ECHVK      LLLEGIYDASKVVAITGSEAK--KAVYAKTYQGACVDKL---------------------
I4ALH2_BERLS      LFLDGRYDASKKIAIVGSEVT--TPQYYETYIGANVDKF---------------------
G8R5N5_OWEHD      LFLEGKFDASINIAVAGAEVE--KPRYHKTIIGANIQGL---------------------
I3ZXR4_ORNRL      FLLTGKLNLTKLIAVNGGQVE--NPKYVRAKAGAKLEDVLAQ------------------
A3UAF5_CROAH      SLLTGHFNSERQIAVAGSSVK--APKYFRTHIGADLEGILNE------------------
K4IK22_PSYTT      QFKTGKYNAQRTVAVTGTSAK--NRKYFKTIAGAEVKSILK-------------------
L7WA36_NONDD      LFLTGEFHAERTVALVGTDAKEADRKYYRTIIGANVSSIIG-------------------
D5ESG1_PRER2      LFNTGKVDLHRTVALCGSEVK--NPAHVDMLVGEELSTLL-----S--------------
A6L599_BACV8      LFNTGRVDLTRTIALTGSEVK--KPAYCKLKVGALLTDIF-----A--------------
F4KLL2_PORAD      LLMTGHVDYSRRIAITGSHAT--EHGYMDLLPGCRIES-------L--------------
F5HFB1_PORGI      FLLTGKADFTRMIAMTGSDAA--AHGYVRIMPGCNVFASF-----P--------------
F4KQY9_HALH1      LFLEGKYDASRIVALTGAALD--KPAYVKTCIGANIGDLL--------------------
B3EPP3_CHLPB      LFLTGKYPVEKIITVGGSSVE--KRLYMKVRQGMMLGDILR-------------------
C0QJ16_DESAH      FLMTGRYPTQKIITVTRGREHR---PHILTRQGAPVKALIGDFIDR--------------
I5AYN3_9DELT      FLLSGRYPVDKIVTITRPGDRR---PHMRVRQGMPLSSLAGQIPVQ--------------
                   :  .       : :                                             

NQRA_CHLT2        -----------ITLISGDPLTGRLCKKEENPCLGMRDHTITLLPNPKT---RESFSFLRL
NQRA_CHLTB        -----------ITLISGDPLTGRLCKKEENPCLGMRDHTITLLPNPKT---RESFSFLRL
NQRA_CHLTR        -----------ITLISGDPLTGRLCKKEENPCLGMRDHTITLLPNPKT---RESFSFLRL
NQRA_CHLMU        -----------VSLISGDPLTGRLCNKEENPCLGMRDHTITILPNPKT---REMFSFLRL
F8KVC4_PARAV      -----------NRFISGDPLMGERAEADD--FLGFYHHALSIVPENTT---REFLHFFRL
D6YT60_WADCW      -----------VRLISGDPLTGKKVESED--YLGFYHYAFCAIPESTK---REFLHFFRL
NQRA_VIBC3        ---------GEVRIISGSVLSGTKA-TGPHAYLGRYHLQVSVLREGRD---KELFGWAMP
NQRA_VIBCH        ---------GEVRIISGSVLSGTKA-TGPHAYLGRYHLQVSVLREGRD---KELFGWAMP
NQRA_VIBPA        ---------GEVRVISGSVLTGTHA-TGPHAYLGRYHQQVSVLREGRE---KELLGWAMP
NQRA_VIBAL        ---------GEVRVISGSVLTGTHA-TGPHAYLGRYHQQVSVLREGRE---KELFGWAMP
NQRA_PSYIN        ---------DEVRVISGSVLCGVTA-TAAHAYLGRYHNQISVLAEGYE---KELFGWGVP
NQRA_YERPE        ---------GDNRIISGSVLSGTAF-SATHGYLGRFHQQVSVIREGRE---KELFGWVMP
NQRA_KLEP7        ---------GENRVISGSVLSGARA-HGPHAFLGRFHLQVSVVKEGRE---KELFGWVMP
NQRA_NEIMF        ---------ADNRVISGSVLNGAIA-QGAHDYLGRYHNQISVIEEGRS---KELLGWVAP
NQRA_NEIG1        ---------ADNRVISGSVLNGAIA-QGAHDYLGRYHNQISVIEEGRS---KELFGWVAP
NQRA_ACTP2        ---------GENRVISGSVLSGATA-AGPVDYLGRYALQVSVLAEGRE---KELFGWIMP
NQRA_HAEDU        ---------GENRIISGSVLSGATA-SGPVDFLGRYALQVSVLLEGCE---KELLGWVMP
NQRA_HAEPS        ---------GENRVISGSVLSGAKA-VGVHDYLGRYALQVSVIAEGRE---QEFLGMIAP
NQRA_HAEIG        ---------GKNRVISGSVLCGQIA-KDSHDYLGRYALQVSVIAEGNE---KEFFGWIMP
NQRA_HAEIE        ---------GKNRVISGSVLCGQIA-KDSHDYLGRYALQVSVIAEGNE---KEFFGWIMP
NQRA_HAEIN        ---------GKNRVISGSVLCGQIA-KDSHDYLGRYALQVSVIAEGNE---KEFFGWIMP
C7R8J8_KANKD      ---------ADNRHISGSVLSGFNA-IDGRGYLGRYHNQVTVIREGRD---KEFFGWAMP
NQRA_ALCBS        ---------GDNRLISGSVLNGHNA-RGPVAWLSRTTNQLTALREGHE---RELLGYISP
E1VB38_HALED      ---------EDTRVISGSVFSGMTC-EGSLRYLGRFYNQLSLLEEGNK---RSFLGWLSP
NQRA_SACD2        ---------GENRIISGSVFSGRKT-SSPTAYLGRFHNQVSVLLEGRD---RPFLHYLVA
NQRA_TERTT        ---------GENRMISGSVFGGRNA-YGPTAFLGRYHNQVSVLAEGRE---RPFMHFVVP
NQRA_MARMS        ---------GDNRVISGSVLSGRKA-FGPFAYLGRYHNQVSVLLEGRE---RQMMHYLRA
NQRA_PSEAE        ---------GNNRLISGSVLGGRTA-HGAYAYLGRYHLQLSCLKEGDQ---REFLHYLRA
F6AIY5_PSEF1      ---------GENRVISGSVLGGRTS-RGACAYLGRYHLQVSCLAEGND---REMLHYLRA
C7RRE9_ACCPU      ---------GRQRIVSGSLLGGRAV-SAQTAFLGGLHLQVSVLPEGDD---REFMHYLRA
D5V826_MORCB      ---------DDNRVISGSVLSGRTA-VGATAFLGRFHNQVSVLTEGRE---RPALHFFTP
E1X4A4_HALMS      ---------GELRIVSGSVLNGRKV-EDSFLYLGRYHNQISILAEGRE---REFLGWQAP
C6BWF2_DESAD      ---------GAVRAISGSVLTGTKA-EGPLAFLGRFHNQVSALTEGGE---SELLGWLAP
NQRA_RHOBA        ---------VKLRVISGSVLNGHIA-TAPHQFLGRYDNQVSVIEEGDH---REFLGWQKP
A1S9X7_SHEAM      ---------VHSRVVSGSVLSGHTA-RGAFDFLGRFHPQISVVTEDDS---EQFLPWVRL
Q82SE3_NITEU      ---------MDKRVISGSVWSGRKA-VDELAFLGRHHLQVTVIGEKSE---REFLGWLNP
Q604Z5_METCA      ---------KELRVISGSVLYGREA-TAWGCYLGRYHNQVSVVEEGRA---RELMGWILP
Q1GLS7_RUEST      ---------DPIRVISGSILSGRAG-EGTTAYLGRYARQITLIKEDRE---QIPMGWIRP
G8PNM3_PSEUV      ---------VPARVVSGSILSGTIA-EDQFAFLGRYHTQVTLMEEDRK---QDVVGWVRP
A5EUU8_DICNV      ---------GAQRIISGSVFSGRRS-LVSCNYLGNYDQQISVLPEGRD---SVFLEFMRL
Q6AM94_DESPS      -------SGAGVRTISGSVLAGRQV-TDEEHFLGRYHNQICMLEESAD---RSPFNWAMP
D6Z599_DESAT      GGQAAALPGRLYRLISGSVLDGHHA-HGPFAYLGRYHQQICALPEDDG---SCLFGWARP
F8E4B2_FLESM      -----------YRVISGSPLYGKTC-DEPVNFLGKFDYQVSVIPEGGD---RELFGWLIP
D4H1M5_DENA2      -----------VRLILGSILYGLTV-EEGVEHLSSCFPQVTAIPELQD---RYLFGWTTP
S5YJM2_PARAH      --------------TTLRLLAGGEN-GSPATFLRPGIRQISAVPHERA---DHRKGW---
D3P9H9_DEFDS      ------------RYISGCYLYGRKI-DENAPFVGFYDNQVSIIKEGGE---KRLFGWISP
E4TFZ4_CALNY      ------------RIIYGSPLYGRKA-TNKTNYTNRYINIVSSLKEANK---REFMGWLKP
I3YQD8_ALIFI      --VKPQKEGDHVRIISGNVLTGTKT-VADG-FIGFYANQLTVIPEGD---KFELLGWAMP
F9Z516_ODOSD      --LKNAVEQ---RIISGNVLTGTRV-VPEG-HLGYYDNQITVIPEGN---NYEFLGWAAP
X5E439_9BACT      --LVEADYNQ--RIISGNVLTGTKV-SEKS-YVGFYDSHISVIPEGD---EYEFLGWADP
U5Q9K5_9BACT      --AKSAGDELPVRWISGNVLTGTNV-GAEG-FLGFYHNQITLISEGN---YYEMFGWIKP
E4TPF6_MARTH      --IKDNISGDHVRYISGNPLTGERI-EADG-YIGYYDEQITVVPEGD---FEELLGWIKP
L0G061_ECHVK      --VAGNTKSDHFRVVSGNVLTGERI-NHDG-YLGYYDHQITLLPEGD---YYEFMGWAKP
I4ALH2_BERLS      --LKNNLKQDHVRVISGNILTGTAI-TKDS-YVGFYDNMVTILPEGDKPRFFLSDGWLAP
G8R5N5_OWEHD      --VEGNVSQNNNRYISGGVYTGTKI-KSDG-YLGFYDRQVSVLPEGD---QAEFFGWIAP
I3ZXR4_ORNRL      ----VTIKGDNNRIIKGNPISGEKA-TAQD-YVGAYTNQVVILEEGN---DYDFFGWALP
A3UAF5_CROAH      ----AGIEA-NSRVITGSVLTGDKT-TAKG-NLGYYHNTVTVIPEGD---DYEFFGWNKP
K4IK22_PSYTT      -----DFE-DNSRIISGNVLTGEKV-EADG-YLNFFANELTVIPEGN---EFRMFGWIPF
L7WA36_NONDD      -----EVDTNNTRIISGDVLTGDKL-ENNQ-FLNFYHNTLTLIPEGN---EYALLGWLPF
D5ESG1_PRER2      --NSYDAQKS-VRIINGNVLTGRPT-TKEG-FLGAHTSEITVIPEGND--ADEMLGWILP
A6L599_BACV8      --GRVNGGKN-LRYINGNVLTGTLV-KPNG-FLGAHATSLTVIPEGDD--RHEFLGFIMP
F4KLL2_PORAD      --GKLAQEECKTRVIAGDVLTGTQL-TEERPFLPMSCDQITVIPDGSD--RDELLGWAMP
F5HFB1_PORGI      --GRLTIKESHERVIDGNVLTGKKL-CEKEPFLSARCDQITVIPEGDD--VDELFGWAAP
F4KQY9_HALH1      ---KGHTLDGNARIISGDVLSGKSK-LPAQ-FLDCYDDQITVIPEGD---DYELFGWLLP
B3EPP3_CHLPB      ----DNRYDENSRLISGDVLTGEIR-MPEE-PLGFYHEILSVIPENS---DRPFIGWLRP
C0QJ16_DESAH      ------------SLITTGRFNGRIV--EPDDHLGFFENTLNLIDTPDG---EELLGFIRP
I5AYN3_9DELT      ------------SIATTGRFNGRIL--EKDAHIGFFENTVNIIEAGPG---EEMFGFVRP
                                       *                 .  :                 

NQRA_CHLT2        G--WNKLTVTRTYLSGFFKRKRVFMDMDTNMHGEKRPIIDAEIYERVSAIPVPVALIIKA
NQRA_CHLTB        G--WNKLTVTRTYLSGFFKRKRVFMDMDTNMHGEKRPIIDAEIYERVSAIPVPVALIIKA
NQRA_CHLTR        G--WNKLTVTRTYLSGFFKRKRVFMDMDTNMHGEKRPIIDAEIYERVSAIPVPVALIIKA
NQRA_CHLMU        G--WNKLTVTRTYLSGFFKRKRVFMDMNTNLHGEKRPIIDSEIYEKVSAIAVPVAPLIKA
F8KVC4_PARAV      G--TDKYSFSRAYASGHFDNSHREYDFTTNRHGEHRAFIDSSLYNKVMPLEVPCMELVKS
D6YT60_WADCW      G--LNKYSYSRAYYSGHIDSTNKQYDFTTSQHGEHRAFIDPTLYDKIMELDVPTMQLVKA
NQRA_VIBC3        G--KNKFSVTRSFLGHLFKG--QVYNMTTTTNGSDRSMVPIGNYEKVMPLDMEPTLLLRD
NQRA_VIBCH        G--KNKFSVTRSFLGHLFKG--QVYNMTTTTNGSDRSMVPIGNYEKVMPLDMEPTLLLRD
NQRA_VIBPA        G--KNKFSVTRSFLGHLFKG--QLFNMTTSTNGSDRSMVPIGSYERVMPLDMEPTLLLRD
NQRA_VIBAL        G--KNKFSVTRSFLGHVFKG--QLFNMTTTTNGSDRSMVPIGNYERVMPLDMEPTLLLRD
NQRA_PSYIN        G--SKKHSVSNAFISAFNRA--KSFAFTTTTGGSKRAMVPIGQYERIMPLDILPTNLLRD
NQRA_YERPE        G--RDKYSITRTTLGHFFKR--KLFAFSTDMHGGERAMVPIGNYERVMPLDILATHLLRD
NQRA_KLEP7        G--KEKFSITRTTLGHFFKR--KRFHFSTDTNGGERAMVPIGNYERVMPLDILPTILLRD
NQRA_NEIMF        Q--PDKYSITRTTLGHFLKN--KLFKFNTAVNGGDRAMVPIGTYERVMPLDILPTLLLRD
NQRA_NEIG1        Q--PDKYSITRTTLGHFLKN--KLFKFTTAVNGGDRAMVPIGTYERVMPLDILPTLLLRD
NQRA_ACTP2        G--SDKFSITRTVLGHFGK---KLFNFTTAVHGGERAMVPIGAYERVMPLDIIPTLLLRD
NQRA_HAEDU        G--SDKYSITRTVLGHFRK---KLFNFTTAVHGGERAMVPIGAYERVMPLDIIPTLLLRD
NQRA_HAEPS        Y--SHKFSITRTVLGAFSK---KLFNFTTAVNGSERAMVPIGSYERVMPLDILPTLLLRD
NQRA_HAEIG        Q--ANKYSVTRTVLGHFSK---KLFNFTTSENGGERAMVPIGSYERVMPLDILPTLLLRD
NQRA_HAEIE        Q--ANKYSVTRTVLGHFSK---KLFNFTTSENGGERAMVPIGSYERVMPLDILPTLLLRD
NQRA_HAEIN        Q--ANKYSVTRTVLGHFSK---KLFNFTTSENGGERAMVPIGSYERVMPLDILPTLLLRD
C7R8J8_KANKD      G--IDKFSVTRAFFGHLFPK--KRFNMTTTTGGSDRSIMPIGNYERVMPLDILPTQLLRA
NQRA_ALCBS        G--ANRFSLMNIYLSKLMPG--KRFNFTTTTNGSERAMVPVGAYEEVMPLDILPTQLLRA
E1VB38_HALED      G--GNRHSVMGIYLSKLKGL--RNYAPTTSTNGSERAMVPVGVYEEVMPLDILPTQLLRS
NQRA_SACD2        G--ANRFSVMPIYLSKLFGG--KKFDFTTSTLGSERAMVPVGAYEKVMPLDILPTQLLRS
NQRA_TERTT        G--SKRFSALPIYISTLMKG--KKYDFTTSCNGSERAMVPTGSYEQVMPLDILATQLLRS
NQRA_MARMS        G--VEKHSIMNVFLSKLTGK--KSFDMTTTTNGSDRTMLPLGNFERVMPLDILPTQLLRA
NQRA_PSEAE        G--VEKHSLLNVFVSRLLGG--KRFAFTTSTNGSPRAMVPVGNYEAVMPLDILPTQLLRY
F6AIY5_PSEF1      G--VNKHSILNVFVSKLNAA--KRFAFSTTTNGSPRAMVPVGNYEEVMPLDILPTQLLRS
C7RRE9_ACCPU      G--VNKHSALRVFASSLFGR--RPLALTTSTQGSPRAMVPVGSYEAVMPLDILPTQLLRA
D5V826_MORCB      G--ANRFSKLPIYISQFFKG--KKYNFTTSTNGSPRAMVPIGLFETVMPQDYLPTQLLRA
E1X4A4_HALMS      G--LNKFSIKRTFVSKFLTPS-KKFDMTTGTHGSPRAMVPVGMYERVMPLDILPTQLLRA
C6BWF2_DESAD      G--CDKFSVKSVFASAFSKKK-KRFDMNTLLGGSHRAIFPTGSYEQVMPLDILPTYLVRA
NQRA_RHOBA        G--FDKFSVSRIFASAMT--PDRKFDFTSSTGGSERAMVPLGTYEKVMPMDILATQLLRA
A1S9X7_SHEAM      G--RDKFSITRTVLSRFL--PKKLYDMTTHTGGAKRAMMAFGQLDRVMPLDILPTLLVRD
Q82SE3_NITEU      G--GNKYSKLNVLFSSFFRKK-RKFEFTASQQGSPRAMIPIDTFEEVMPLDILPAQLLRA
Q604Z5_METCA      S--ASKYSFLNVTLASLPKERGRKFPFTTSTHGSPRAIVPVGVYEDVMPLDILPTQLVRS
Q1GLS7_RUEST      M--PSKYAVQPVLGSAF---SKKLHALTSNLNGGRRAMVPIGTFEQLMPQDFLPTQLLRA
G8PNM3_PSEUV      F--MTKWSNLNVHPSGFF-RSKLKFPFGTNKNGSIRAIVPLGTYEKVMPLDVLPTQLLRA
A5EUU8_DICNV      G--ENRYSKTRAYLGRFLK---KPLPFTTAVQGSARAILPFGIYEEVMPLDILPTLLLKA
Q6AM94_DESPS      G--RDKFSARPIFASLFSKG--KTFSMKTALYGGFRAIYPLGSHEQVMPLDILATPFLQA
D6Z599_DESAT      G--WDRFSLVPAFLSALRR---RPFAMSTATWGGRRAIFPLGTYERVMPLDIIATSLLKA
F8E4B2_FLESM      G--KNKFSVKNAFTGSLF---KKKFSIDTSVGGSKRAIVPIGSYEKVMPLDIIPTYLLRY
D4H1M5_DENA2      R--PDLFSVKNIFSSAFTG--KRKLHFDTALNGAHRPMVPVGTYEKVMPLDILPTHLLRA
S5YJM2_PARAH      --------------------------FMRLTAPRIAALIPNPWDEVTMPPGILAVPLLRA
D3P9H9_DEFDS      S--RKYFTVLGVALSKFIKP--KKYIFDTSMHGSLRPIIPISSYNKVTAIDTEPLALLRA
E4TFZ4_CALNY      G--LNRFSVKNVFLSKLLK---KEITFDTSLNGSFRPMIPVGSYEKVCLLNLPITYFLRS
I3YQD8_ALIFI      --RFNKFSVSRAYFSWLCPK--KEYNLDTNMNGGERPFVVTGLYERYLPMDIYPMYLLKA
F9Z516_ODOSD      --GFNKFSASRLFPSFLCPK--KHYTLDTNYHGERRAFVVTGQYEKVFPMDIYPVYLLKA
X5E439_9BACT      --GFNKFSATKAYFGKLFPK--KEYTMNANIHGGERAFVLSNQYEKLVPMDILPVYLLKA
U5Q9K5_9BACT      F-RSKKFSISHTYFSWLTPK--KSYELDTNTNGAERAFVMTGVYEKVLPMDIYPTYLLKA
E4TPF6_MARTH      TTSKLSIHRAIGLLSFLNKK--KEYVLNTNTNGEERAFVLTGEFEKVLPMDILPNYLFKA
L0G061_ECHVK      TSSKLSFHRALGLLSFLSPN--KEYVLDTNTRGEERAFVQTGVFEQVTPMDIFPIYLLKA
I4ALH2_BERLS      T-SRLSFHRALGLMSFLNPK--KERVIDTSLNGEERAFVETGVMEQVVPMDILPLQLVKS
G8R5N5_OWEHD      GLDKFSMSRT--MFSWMMPN--KKYNLDTGMHGEERAFVVTGEYEKVFPFDIYPVQLLKS
I3ZXR4_ORNRL      R-ANKFSVLRANMFSFLSPN--KKYNLSTNTNGEQRAFVLTGEYEKVFPLDIYPMQLLKS
A3UAF5_CROAH      V-FNKISLTRALTFSWMQPN--KKYDLDTNTNGEHRAFVVTGMYEEVFPLDIYPLQIMKS
K4IK22_PSYTT      I-DNNIHSMSKTSLSWLFPK--RKYEVNTNINGEERALVVTGEMEEVMPLDIFPMQLIKA
L7WA36_NONDD      T-RNNIPSNAGTSFSKLLG---GKREVDTNLNGEDRALVVTGEMEEVMPMDIYPLQLIKA
D5ESG1_PRER2      R--FKQFSVNRSYFSWLCGK--KKYALDARVKGGERHMIMSGEYDKVLPMDIYGEYLIKA
A6L599_BACV8      R--TDQYSANRSYFSWLCGN--KEYTLDARIKGGERHMIMSGEYDKVFPMSIFPEYLIKA
F4KLL2_PORAD      R--IGEFSQSRTYLSWLMPR--KRYTLDARLKGGKRAMIMSHELQSVFPLNIHAEYLLKA
F5HFB1_PORGI      R--LDQYSMSRAYFSWLQGKN-KEYVLDARIKGGERAMIMSNEYDRVFPMDIYPEYLLKA
F4KQY9_HALH1      S--SARPSTSKTFFSSIFSNI-WVYNVNTNTHGEKRAFVMTGQYEDVLPMDIFPQHLLKA
B3EPP3_CHLPB      G--LRNYSVSNLFLSRLLNN--RGAGLDTRMHGSPRVIIPFGNIESVLPMDILPTFLIKM
C0QJ16_DESAH      G--KAKATVSKTFLSCLFPE---PKEVDCTRHGEVRACINCSYCEKICPNDLMPNFIMKA
I5AYN3_9DELT      G--LDKPTLSSTFLSSLFRR---PAKMDCTLHGEARACINCSYCERICPNGLMPSFIMKA
                                                              :           :.: 

NQRA_CHLT2        LETQNFEEACRLGLLEVAPEDFALPTFIDPSKTEMFSIVKESLLRYAKENVVTSS
NQRA_CHLTB        LETQNFEEACRLGLLEVAPEDFALPTFIDPSKTEMFSIVKESLLRYAKENVVTSS
NQRA_CHLTR        LETQNFEEACRLGLLEVAPEDFALPTFIDPSKTEMFSIVKESLLRYAKENVVTSS
NQRA_CHLMU        LETQNFEEACRLGLLEVSPEDFALPTFIDPSKTEMFAIVKEALIRYAKENVLTPL
F8KVC4_PARAV      VLAEDYDLAEILGLLEVDSEDFALPTFVCPSKMEMTEIIKNGLRQYAKELSS---
D6YT60_WADCW      VMSEDFDMAEELGFLAVDGEDFALPSFVCPSKIDMISIIDDGLKAYATEVLE---
NQRA_VIBC3        LCAGDSDSAVRLGALELDEEDLALCTFVCPGKYEYGQLLRECLDKIEKEG-----
NQRA_VIBCH        LCAGDSDSAVRLGALELDEEDLALCTFVCPGKYEYGQLLRECLDKIEKEG-----
NQRA_VIBPA        LCAGDSDSAQALGALELDEEDLALCTFVCPGKYEYGQLLRECLDKIEKEG-----
NQRA_VIBAL        LCAGDTDSAQALGALELDEEDLALCTFVCPGKYEYGTLLRECLDTIEKEG-----
NQRA_PSYIN        LIVGDTEEAQALGCLELDEEDLALCTYVCPGKYDYGSVLRASLSKIEKEG-----
NQRA_YERPE        LLAGDTDSAQALGCLELDEEDLALCTFVCPGKYEYGPVLRDILTQIEQEG-----
NQRA_KLEP7        LLAGDTDSAQALGCLELDEEDLALCTYVCPGKYEYGPALRSVLTRIEQEG-----
NQRA_NEIMF        LIVGDTDSAQALGCLELDEEDLALCSFVCPGKYEYGPLLRKVLETIEKEG-----
NQRA_NEIG1        LIVGDTDSAQALGCLELDEEDLALCSFVCPGKYEYGPLLRKVLETIEKEG-----
NQRA_ACTP2        LAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLRAALEKIEKEG-----
NQRA_HAEDU        LAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLRTALDKIEKEG-----
NQRA_HAEPS        LASGDTDSAQALGCLELDEEDLALCTFVCPGKNNYAPMLRAALDKIEKEG-----
NQRA_HAEIG        LIVGDTDGAQELGCLELDEEDLALCSFVCPGKYEYGSILRQVLDKIEKEG-----
NQRA_HAEIE        LIVGDTDGAQELGCLELDEEDLALCSFVCPGKYEYGSILRQVLDKIEKEG-----
NQRA_HAEIN        LIVGDTDGAQELGCLELDEEDLALCSFVCPGKYEYGSILRQVLDKIEKEG-----
C7R8J8_KANKD      IVTNDTVLAQELGCLELDEEDLALCTYVCPGKYEYGSILRENLTKIEKEG-----
NQRA_ALCBS        LIVGDTDSATALGALELLEEDLSLCTFVCPGKYEYGPILRDNLTTIEAEG-----
E1VB38_HALED      LIVGDIETAMQLGCLELDEEDLALCTYVCPGKYEYGPILRDNLTMIEKEA-----
NQRA_SACD2        IIVGDTEAAQQLGCLELDEEDLALCSFVCPGKYEYGPILRDNLTRIEKEG-----
NQRA_TERTT        LIVGDTEMAQKLGCLELDEEDLALCSFVCSGKYEYGPILRDNLTRIEKEG-----
NQRA_MARMS        LVVNDTEQAQKLGALELDDEDLALCTYSCSGKFEYGPILRDCLTLIEKEG-----
NQRA_PSEAE        LIVGDTEMAQKLGALELDEEDLALCSYVCAGKYEYGPILRDNLARIEQEG-----
F6AIY5_PSEF1      LIVGDTEMAQQLGCLELDEEDLALCTYVCAGKYEYGPILRDCLTLIEKEG-----
C7RRE9_ACCPU      LIVGDTEMAQHLGCMELDEEDLALCTYVCPGKYEYGPILRDVLTRIAKEG-----
D5V826_MORCB      LIVEDIISAVELGALELDEEDLALCTFVSPGKYEFGDILRDNLTRIEQEG-----
E1X4A4_HALMS      LITKDTDLAQQLGCLELDEEDLALCTFASIGKVDFGPVLRENLTTIEKEG-----
C6BWF2_DESAD      MAVMDTDEAQALGCLELDEEDLALLSFVDCGKNDFGLMLREVLTQIEKEG-----
NQRA_RHOBA        LIVRDTDSAQQLGVLELEEEDLALCTFVCPGKYEYGSLIRENLTTIEREG-----
A1S9X7_SHEAM      LVVRDTDEAQLLGALELDEEDLALCTFVCPSKYDFGQELRACLTIIEREG-----
Q82SE3_NITEU      LLVMDTDMAQKLGCLELDEEDLALCSFICVGKHDYGVILRENLRQIEKEG-----
Q604Z5_METCA      LLVGDTDMAQALGCLELDEEDLALCTFVDPGKHDFGPVLRSNLTQIEKEG-----
Q1GLS7_RUEST      LLVMDTDQAQALGALELDEEDLGLCGFACPAKYEYGLALRDSLSKIEREG-----
G8PNM3_PSEUV      LMVLDTDMAQKLGALELDEEDLALCTFICHSKNEYGAALRANLDKIEKEG-----
A5EUU8_DICNV      LVVKDTDTAVQLGALELVEEDVALLTYVDPGKHDFGAILRENLQQIEEES-----
Q6AM94_DESPS      ISNHNTSKAKDLGCLELIEEDLALCSFVCPGKNEFASVLRGVLASIEQGD-----
D6Z599_DESAT      LASGNLERCLELGVLELVEEDLALCSFVCPGKNDFAPLLREMLTRIEEEA-----
F8E4B2_FLESM      LEIGDIEMAEKLGCMELLEEDLSLCTFVCPGKIDHCRNLRDVLTTIEKET-----
D4H1M5_DENA2      LIVGDLETAEKLGCLELSEEDLSLCTYVCPGKIDYAPIIRDVLTTIEKEG-----
S5YJM2_PARAH      LASGDLTAARDLGVLGLIEEDLMALNARLRGHPDYRVLLRQTLDELEATI-----
D3P9H9_DEFDS      VLTKDIDRAIDLGILSLGEEDFSLYTYVCPSKIDFIKHSRELLDTIEKEW-----
E4TFZ4_CALNY      LLVEDIEMAEKLGVLDFGEEDMSVFTFVCVGKYDYAVYLRKILDEIEGEM-----
I3YQD8_ALIFI      CLAGDIDKMENLGIYEVVEEDFALCEFVDPSKIEIQQIIRDGINLMIKEA-----
F9Z516_ODOSD      VLAQDIDRMEQLGIYEVVPEDMALCEFVCTSKTPVQKILSDGIELMMKETN----
X5E439_9BACT      ILVNDLDKMENFGIYEVIEEDFALCEYACTSKIEVQKILREGINTMIKELG----
U5Q9K5_9BACT      ILAEDIDNMEALGIYEVIEEDLALCEFVCPSKIDVQEIVSKGIDLMIKEMS----
E4TPF6_MARTH      IMAEDYDEMEALGIFELVEEDVALCEFIDVSKHELQAILRKGINLMING------
L0G061_ECHVK      IMAEDFDEMEELGIYEIIEEDLALCEFIDVSKHPVQDIVRKGIELIQYS------
I4ALH2_BERLS      IMAEDYDGMESLGIYEVIEEDVALCEFVDVSKHRIQNIVRQGIELLREG------
G8R5N5_OWEHD      IMVSDIEAMENLGIYEVVEEDMALCEVVCTSKIPVQQVLREGLDLMLKELGD---
I3ZXR4_ORNRL      CLYKDLDEMEALGIYEVAPEDFALTEFICVSKIPHQQIIREGLDVMNKEVG----
A3UAF5_CROAH      CLVEDLDAMEQLGMYEVAPEDFALTEFVCVSKQPHQAIIRKGLDVMYKEIG----
K4IK22_PSYTT      CMAGDIEKMESLGIYEVVPEDFALIDYTNTSKIEAQSIIRGGLDIMLTEVG----
L7WA36_NONDD      CMAGNIERMENLGIYEVAPEDFALIDFTNTSKLEAQEVIRLGLDLMLTEVG----
D5ESG1_PRER2      IIAGDIDRQEALGIYEVAPEDFALAEFVDSSKLELQRIVREGLNILRKENA----
A6L599_BACV8      IIAGDIDRMEALGIYEVAPEDFAVCEFVDSSKLELQRIVRQGLDMLRKEMC----
F4KLL2_PORAD      IIAFDIDKMEELGIYEVAPEDFALCEFVDTSKMELQHIVRQGLDLLYKEMN----
F5HFB1_PORGI      IIAFDIDKMEDLGIYEVAPEDFATCEFVDTSKIELQRIVREGLDMLYKEMN----
F4KQY9_HALH1      IITNDIEKIEGLGIHEVVEEDLALCEFACTSKQPLQKILREGMEMMIKEGL----
B3EPP3_CHLPB      IIARDIDEMEKLGIYECDPEDFALCSFVDASKMEISEIIREGLEYVEKNG-----
C0QJ16_DESAH      LLSDEIENALECGLLDCCQ--CGLCSYACPSKIELAQILRHGMDALYKDKQ----
I5AYN3_9DELT      LHAQELEEALALGLMDCCK--CGLCSFACPSKIELTQILSDAMDAYYKDK-----
                      :       *                 .:          :