CLUSTAL format seed alignment for MF_00428

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F4KQZ2_HALH1          --------------MAETMTKTAAE--KEKLEWFGPKERKLITDPLNDDNPVTVQILGVC
H6KZK0_SAPGL          --------------MAQDTQQLAEAEKKEPAFGFGKEERQLLTDPLNDNNPITVQVLGIC
G0L9T4_ZOBGA          ------------------------------MALLTKKDASLITDPLADNNPITIQVLGIC
G2PLL2_MURRD          ------------------------------MALLSKKDANLIKDPLADNNPITIQVLGIC
K4IGG0_PSYTT          MSSETNQNSKTEAEKKKVEMLLFLSSSEEKEHFLSKANRKILKDPLNDNNPITVQVLGIC
Q8A8L0_BACTN          -----------------------------MGQLFSKKNKEVFSAPLGIDNPVTVQVLGIC
E6SVY7_BACT6          -----------------------------MGQLFSKKNKEVFSTPLGLNNPVTVQVLGIC
A6LB21_PARD8          -----------------------------MG-LLSEKNKEVLLGPLSANNPVVVQMLGIC
NQRD_PSEAE            ------------------------------MMAAQPTIREVLFNPVFQNNPIGLQILGIC
NQRD_SHEPC            -------------------------------MSDAKELKQVLTGPIVNNNPIALQILGVC
NQRD_SHEON            -------------------------------MSDAKELKQVLTGPIVNNNPIALQVLGVC
NQRD_SHEDO            -------------------------------MADVKELKQVLTGPIINNNPIALQILGVC
NQRD_SHEPA            -------------------------------MADAKELKQVLIGPIVSNNPIALQILGVC
NQRD_PSET1            -------------------------------MADTKEMKAVLFGPVLANNPIALQVLGIC
Q5QYQ6_IDILO          -------------------------------MANVKEMKSVLFGPIFANNPIALQILGIC
NQRD_PSEA6            -------------------------------MADTKEMKKVLFGPILDNNPIALQILGVC
Q604Z8_METCA          ---------------------------------MNEESKKVLIEPLVDNNPITLQVLGIC
NQRD_VIBCH            -------------------------------MSSAKELKKSVLAPVLDNNPIALQVLGVC
NQRD_ALIF1            -------------------------------MASAKDIKKSILAPVLDNNPIALQVLGVC
NQRD_VIBCB            -------------------------------MSSAQNIKKSIMAPVLDNNPIALQVLGVC
NQRD_YERPE            -------------------------------MADSKEIKRVLLSPLFDNNPIALQILGVC
NQRD_PHOLL            -------------------------------MADSKEIKRVLLGPLLDNNPIALQVLGIC
NQRD_HAEDU            --------------------------------MANNNLKKLLLSPISDNNPIALQILGIC
NQRD_HAEIN            -------------------------------MSGKTSYKDLLLAPIAKNNPIALQILGIC
NQRD_NEIMB            -------------------------------MADMKRLKHLMFSPFIDNNPIALQVLGIC
NQRD_NEIG1            -------------------------------MADMKRLKHLMFSPFIDNNPIALQVLGIC
Q7UWS2_RHOBA          --------------------------------MAAPKVGKVLFGPVIDNNPIALQILGIC
C6BWF5_MARSD          ----------------------------------MAKFKEVLLKPLLEDNPIAVQILGIC
Q8EID7_SHEON          -------------------------------MSNSLSMRDMLAGPVFANNPVAMQVLGVC
B8CPN5_SHEPW          ------------------------------MSTQTASTRDILTSPIFSNNPVAMQVLGVC
B4S5U2_PROA2          --------------------------------MVDKKTLKTLTEPVGMSNPITKQVLGIC
B3EPP0_CHLPB          --------------------------------MAIKKAFDTFAGPLAKSNPITTQVLGIC
A8ZWL2_DESOH          ------------------------------MKLTKTQAFKTLAQPVWENNPINIQMLGIC
NQRD_CHLTR            -------------------------------MTTNKSYLTYFTDALWINNQPLIAILGIC
NQRD_CHLMU            -------------------------------MTTNKSSLSYFTDALWINNQPLVAILGIC
NQRD_CHLCV            -------------------------------MAANKSYKSYFLDPLWGNNQPLIAILGIC
A0A0E2JC11_CHLPS      -------------------------------MAANKSYKSYFLDPLWNNNQPLIAILGIC
NQRD_CHLFF            -------------------------------MADNKPYKSYFLDPLWNNNQPLIAILGIC
NQRD_CHLPN            -------------------------------MTSKKSYKSYFFDPLWSNNQILIAILGIC
                                                               .  ..  .*     :**:*

F4KQZ2_HALH1          SALAVTTMLKPALIMAIAVTLVTGFSNLVISLMRNGIPKQIRMIVQLVVIAFLVTIVEQV
H6KZK0_SAPGL          SALAVTSQVYPSLIMAVALIFVTSFSNLIISMLRNSIPGSIRMIVQLLVIAGLVQVVEIV
G0L9T4_ZOBGA          SALAITAELKASVVMAVSVLFVLALGNVVISLMRNIIPSKIRIIVQLIVVATLVIIVDQV
G2PLL2_MURRD          SALAITAELKASVVMAISVLFVMGVGNVVISLIRNIIPSKIRIIVQLVVVAALVIIVDQV
K4IGG0_PSYTT          SALAITVQLKPAIVMSLAVVFVMAFSNVIISLLRNSIPSRIRIIVQLVVVAAMVILVDQI
Q8A8L0_BACTN          SALAVTAKLEPAIVMGLSVTVITAFANVVISLLRKTIPNRIRIIVQLVVVAALVTIVSEI
E6SVY7_BACT6          SALAVTAKLEPAIVMGLSVTVITAFSNVVISLLRKTIPNRIRIIVQLVVVAALVTIVSEI
A6LB21_PARD8          SALAVTSKLEPAIVMGISVTAVVAFANVIISLMRNTIPNRIRIIVQLVVVAALVTIVSEV
NQRD_PSEAE            SALAVTSNLKTATVMAIALTLVTGFSNLFISMIRRQIPSSIRMIVQMVIIASLVIVVDQV
NQRD_SHEPC            SALAVTSKLETALVMALALTAVTAFSNLFISLIRNHIPSSVRIIVQMTIIASLVIVVDQL
NQRD_SHEON            SALAVTSKLETALVMALALTAVTAFSNLFISMIRNHIPSSVRIIVQMTIIASLVIVVDQL
NQRD_SHEDO            SALAVTSKMETALVMSLALTVVTAFSNLFISLIRNHIPSSVRIIVQMTIIASLVIVVDQV
NQRD_SHEPA            SALAVTSKMETALVMTIALTAVCALSNLFISLIRNHIPSSVRIIVQMTIIASLVIVVDQV
NQRD_PSET1            SALAVTSSLKNALIMSIALTLVTAFSSFFISTIRNQIPSSVRIIVQMTIIASLVIVVDQV
Q5QYQ6_IDILO          SALAVTSKMSNTLVMCIALTAVVACSNLFISIIRNHIPSSVRIIVQMTIIASLVIVVDQI
NQRD_PSEA6            SALAVTTKLETALVMSLALTAVTAFSNLFISMIRSQIPSSVRIIVQMTIIASLVIVVDQI
Q604Z8_METCA          SALAVTSQLSTALIMSLALTSVTACSSAGIALIRNHIPSSVRIIAQMVIIASLVIVVDQL
NQRD_VIBCH            SALAVTTKLETAFVMTLAVMFVTALSNFFVSLIRNHIPNSVRIIVQMAIIASLVIVVDQI
NQRD_ALIF1            SALAVTTKLETAFVMTLAVMFVTALSNLFVSLIRNHMPNSVRIIVQMAIIASLVIVVDQV
NQRD_VIBCB            SALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRIIVQMAIIASLVIVVDQV
NQRD_YERPE            SALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIASLVIVVDQV
NQRD_PHOLL            SALAVTTKLETALVMTIAVTLVTAFSSFFISLIRHYIPGSVRIIVQMAIIASLVIVVDQI
NQRD_HAEDU            SALAVTTQLQTAFVMAIAVSLVTAFSSMFISMIRNYIPNSIRIIVQMAIIASLVILVDQI
NQRD_HAEIN            SALAVTTKLETAFVMAIAVTLVTGLSNLFVSLIRNYIPNSIRIIVQLAIIASLVIVVDQI
NQRD_NEIMB            SALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIASLVTLVDQL
NQRD_NEIG1            SALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIASLVTLVDQL
Q7UWS2_RHOBA          SALAVTTSIQVSIVMALAVIAVTGCSNAAVSSIRHYIPGSIRIIVQMTVIASLVIVVDQV
C6BWF5_MARSD          SALAVTTKLETAFVMSLAVIFVTAASNVSVSSIRQHIPSSIRIIVMMTIIATLVIIVDQF
Q8EID7_SHEON          SALAVSNSMQTAVVMTLAVTFVLVFSNLIISAIRNFIPNSVRIIAQMTVIASLVIIVDMV
B8CPN5_SHEPW          SALAVSNSMQTALVMTLAVTFVLVFSNLIISTIRSLIPNSVRIIAQMTVIASLVIIVDMV
B4S5U2_PROA2          SALAVTVKMDTALVMSAALIFVLVGSNAIVSAFRNLIPSRVRIIVMLTIIATLVIFIDQL
B3EPP0_CHLPB          SALAVTVKMDTALVMSAALIFVLVGSNTIVSALRNLIPSRVRIIVMLTIIATLVICIDQI
A8ZWL2_DESOH          SALAVTVQLKTALVMGLAMTFVVSFSSLIISALRNLIPRNIRIIVELAVISSLVILCDEF
NQRD_CHLTR            SALAVTTTVTTALTMGFAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIISLFVILIDQF
NQRD_CHLMU            SALAVTTTVTTALTMGLAVSFVTGFASFVVSLLRKITPESVRMIAQLIIISLFVILIDQF
NQRD_CHLCV            SALAVTTTVNTAITMGLAVSFVTGCSSFFVSLLRKATPDSVRMITQLIIISLFVIVIDQF
A0A0E2JC11_CHLPS      SALAVTTTVNTAITMGLAVSFVTGCSSFFVSLLRKVTPDSVRMITQLIIISLFVIVIDQF
NQRD_CHLFF            SALAVTTTVKTAITMGLAVSFVTGCSSFFVSLLRKITPDSVRMITQLIIISLFVIVIDQF
NQRD_CHLPN            SALAVTTTVQTAITMGIAVSIVTGCSSFFVSLLRKFTPDSVRMITQLIIISLFVIVIDQF
                      ****::  :  :  *  ::  :   ..  :: .*   *  :*:*. : ::: :*   . .

F4KQZ2_HALH1          LKAYSYPVWKQLSVFIGLIITNCIVMGRLEAYAMANPPWRSLLDGLGNGAGYGLILIAVA
H6KZK0_SAPGL          LGAFAYSAYESLAVFIGLIITNCIVMGRLEAFAMANKPWRSFLDGLGNGIGYGVVLVAMA
G0L9T4_ZOBGA          LKAFAYELSKTLSVFVGLIITNCIIMGRFEAFALGNGPWRSFLDGIGNALGYGVILVIVG
G2PLL2_MURRD          LKAFAYNLSKTLSVFIGLIITNCIIMGRFEAFALGNGPRRAFLDGIGNALGYGVILVIVG
K4IGG0_PSYTT          LKAYAFDVSKQLSIFIGLIITNCIIMGRLEAFALGNGVYKSFLDGIGNAAGYGLILIVIA
Q8A8L0_BACTN          LKAFAYDVSVQLSVYVGLIITNCILMGRLEAFAMQNGPWESFLDGVGNGLGYAKILVIVA
E6SVY7_BACT6          LKAFAYDVSVQLSVYVGLIITNCILMGRLEAFAMQNGPWESCLDGIGNGLGYAKILIIVA
A6LB21_PARD8          LKAFAYDVNKQLSVFVGLIITNCILMGRLEAFALGNGPWESFLDGIGNGLGYAIILIIVG
NQRD_PSEAE            LKAYAYSLSKQLSVFVGLIITNCIVMGRAEAFAMANPPLVSFFDGIGNGLGYSAMLLVLG
NQRD_SHEPC            LQAYAYQISKQLSVFVGLIITNCIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGVILLAVG
NQRD_SHEON            LQAYAYQISKQLSVFVGLIITNCIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLAVG
NQRD_SHEDO            LQAYAYEIAKQLSVFVGLIITNCIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLGVG
NQRD_SHEPA            LQAYAYDVAKQLSVFVGLIITNCIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGAILLSVG
NQRD_PSET1            LQAFSYATAKELSVFIGLIITNCIVMGRAEAYAMKSPPLMSFLDGIGNGLGYSVVLLTVG
Q5QYQ6_IDILO          LKAYAYSISKELSVFVGLIITNCIVMGRAEAYAMKSTPFMSFLDGLGNGLGYSVVLLVVG
NQRD_PSEA6            LKAYSYEISKQLSVFVGLIITNCIVMGRAEAFAMKSPPFISFLDGIGNGLGYSFVLIVIG
Q604Z8_METCA          LKAFAYEISKQLSVFVGLIITNCIVMGRAEAYAMKNPPWESFLDGIGNGLGYSLILVTVA
NQRD_VIBCH            LKAYLYDISKQLSVFVGLIITNCIVMGRAEAFAMKSEPIPSFIDGIGNGLGYGFVLMTVG
NQRD_ALIF1            LKAYLYDISKQLSVFVSLIITNCIVMGRAEAFAMKSAPFPSFIDGIGNGLGYGFVLMTVA
NQRD_VIBCB            LKAYLYDISKQLSVFVGLIITNCIVMGRAEAFAMKSAPVPSLIDGIGNGLGYGFVLITVG
NQRD_YERPE            LRAYAYEISKQLSVFVGLIITNCIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVG
NQRD_PHOLL            LQAYAYEISKQLSVFVGLIITNCIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVG
NQRD_HAEDU            LRAYVYDLSKQLSVFVGLIITNCIVMGRAEAFAMKSAPLESFVDGIGNGLGYGAMLVIVA
NQRD_HAEIN            LKAYAYGLSKQLSVFVGLIITNCIVMGRAEAFAMKSPPVESFVDGIGNGLGYGSMLIIVA
NQRD_NEIMB            LQAFAYELSKQLSVFVGLIITNCIVMGRAEAFAMKEPPLESLIDGIGNGAGYGIMLLVVA
NQRD_NEIG1            LQAFAYELSKQLSVFVGLIITNCIVMGRAEAFAMKEPPLESLIDGIGNGAGYGMMLLVVA
Q7UWS2_RHOBA          LKAYMYEISKQLSVFVGLIITNCIVMGRAEGFAMKNGVWISFLDGIGNGLGYGLVLIVVA
C6BWF5_MARSD          LKAFAYGISKQLSVFVGLIITNCIVMGRAEAFAMQNTPKMSLADGIGNGLGYGLILIIVA
Q8EID7_SHEON          LQDVAYELSKQLSVFVGLIITNCIIMGRAEAFAMKYPPHLAVVDAVGNAAGYGLVLISVA
B8CPN5_SHEPW          LQDVAYELSRQLSVFVGLIITNCIIMGRAEAFAMKNPPHLAVVDAVGNAMGYGVILLGVA
B4S5U2_PROA2          LKAYLFDISKQLSVFVGLIITNCIVLGRAEAFALKNGVWPSMLDGLGNGLGYGMILLFVS
B3EPP0_CHLPB          LKAFLFDISKQLSIFVGLIITNCIVLGRAEAFALKNTIGESALDGLGNGIGYGLILLLVA
A8ZWL2_DESOH          LKAFMYDTSKQLSVFVGLIITNCIVLGRAESFALANPPHLAFLDGLGNGAGYASVLIIVA
NQRD_CHLTR            LKAFFFTISKTLSVFVGLIITNCIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCIS
NQRD_CHLMU            LKAFFFNISKTLSVFVGLIITNCIVMGRAESMARHISPIPAFLDGLGSGLGYGWVLVCIS
NQRD_CHLCV            LKAFFFTISKTLSVFVGLIITNCIVMGRAESLARNVPPIPAFLDGLASGLGYGWVLVTVS
A0A0E2JC11_CHLPS      LKAFFFNISKTLSVFVGLIITNCIVMGRAESLARNVPPIPAFLDGFASGLGYGWVLVAVS
NQRD_CHLFF            LKAFFFNISKTLSVFVGLIITNCIVMGRAESLARNVPPIPAFLDGLASGLGYGWVLVFVS
NQRD_CHLPN            LKAFFFDISKTLSVFVGLIITNCIVMGRSESLARHVTPIPAFLDGFASGLGYGWVLLVIG
                      *    :     *::::.*******::** *. *       :  *..... **. :*: :.

F4KQZ2_HALH1          AIREFFGRGALMGYKILGATDEFLLNTSKHWWLSWYQPNGLMVIPASAIFLVGIFIWIQR
H6KZK0_SAPGL          IVRELFGKGSFMGWKVMPDA---------------YIANNLMVLPAASLFIIGIFIWIQR
G0L9T4_ZOBGA          FFRELLGSGTLFGYPVLGNP-----IEKTGLYSIGYENNGFMIIPPAALIVVGIIIWVQR
G2PLL2_MURRD          FFRELLGSGTLFGIKVLGDP-----IAKTGLYSIGYENNGFMIIPPAALIVVGIIIWVQR
K4IGG0_PSYTT          FFRELFGSGKLLGYEVLGHKG-VTLAESTGLYGLGYEDNGFFLLSPMALIVVGIIIWVQR
Q8A8L0_BACTN          FFRELLGSGTLLGFN---------ILNYEPIQNIGYVNNGLMLMPPMALIIVACIIWYQR
E6SVY7_BACT6          FFRELLGSGTLLGFN---------ILNYDCLKNLGYVNNGLMLMPPMALIIVACIIWFQR
A6LB21_PARD8          FFRELLGSGTLLGFQ---------VIP-QAFYDLGYVNNGLMILPPMALIVIAVIIWVHR
NQRD_PSEAE            FVRELFGAGKLYGISVLPTVN----------DGGWYQPNGLLLLPPSAFFLIGLIIWALR
NQRD_SHEPC            FVRELFGNGSLFGVQILHKIS----------EGGWYQPNGMLLLPPSAFFLIGILIWIIR
NQRD_SHEON            FVRELFGNGSLFGVQILHKIS----------DGGWYQPNGLLLLPPSAFFLIGMLIWIIR
NQRD_SHEDO            FFRELFGNGSLFGIEILSKIS----------DGGWYQPNGLLLLPPSAFFLIGGLIWVIR
NQRD_SHEPA            FVRELFGNGSLFGIEILSKIS----------DGGWYQPNGLLLLPPSAFFLIGALIWIIR
NQRD_PSET1            FIRELFGKGSLFGVDIIPLVQ----------NGGWYQPMGLLILPPSAFFIIGLFIWVLR
Q5QYQ6_IDILO          FIRELFGSGSLFDVQILPLAS----------QGGWFEPVGLLLMPPSAFFIIGGFIWVLR
NQRD_PSEA6            TIKELFGFGTILGFEILPLIQ----------NGGWYQGNGLLILPFSSFFLIGGLIWFIR
Q604Z8_METCA          TIRELLGSGKLLGIDVLPLVK----------DGGWYVPNGLLLLPPSAFFLIGLLIWAIR
NQRD_VIBCH            FFRELLGSGKLFGLEVLPLIS----------NGGWYQPNGLMLLAPSAFFLIGFMIWAIR
NQRD_ALIF1            FFRELLGSGKLFGVEVLPLVS----------NGGWYQPNGLMLLAPSAFFLIGFMIWAIR
NQRD_VIBCB            FFRELFGSGKLFGMEVLPLVS----------NGGWYQPNGLMLLAPSAFFLIGFLIWVIR
NQRD_YERPE            FVRELVGSGKLFGVTVLETVQ----------NGGWYLPNGLFLLAPSAFFIIGLLIWGLR
NQRD_PHOLL            FLRELFGSGKLFGITVMESVQ----------NGGWYQPNGLFLLAPSAFFIIGMLIWGLR
NQRD_HAEDU            FLRELIGSGKIFGVTVLQTIQ----------DGGWYQANGLFLLAPSAFFIIGFVIWAIR
NQRD_HAEIN            FFRELIGSGKLFGMTIFETIQ----------NGGWYQANGLFLLAPSAFFIIGFVIWGLR
NQRD_NEIMB            TVRELIGSGKLLGYTVFQTVQ----------DGGWYQTNGLFLLAPSAFFIIGFLIWGLR
NQRD_NEIG1            TVRELIGSGKLLGYTVFQTVQ----------DGGWYQTNGLFLLAPSAFFIIGFLIWGLR
Q7UWS2_RHOBA          FFRELFGSGSLLGFELFQLDR----------NGGWYNPNNLMLLPPSAFFIIGFMIWVIR
C6BWF5_MARSD          FLREFFGSGKIFGLSVFKLTS----------EGGWYEPNGLMLLPPSAFFIIGLLIWSVN
Q8EID7_SHEON          FVRELLGTGNLFGHSVLTTVE----------NGGWYLPNEMFKLPPSAFFLIGLLIWSIN
B8CPN5_SHEPW          FVRELLGSGTLFGHEVLKTVE----------NGGWYLANEMFKLPPSAFFLIGLMIWSIN
B4S5U2_PROA2          AMRELFGSGTMLGFQIVPDIL-------YVENGGWYMNNGLMLLAPGAFFVLGLLIWLQR
B3EPP0_CHLPB          AARELLGSGTMLGIQIVPRFL-------YVDQGGWYVNNGFMLLAPGAFIILGLLVWVQR
A8ZWL2_DESOH          AIRELLGAGKLLGVQVIPGAA-------YSAG---YEDAGFMLLAPAAFIIIGLLVWLQK
NQRD_CHLTR            IIRELFGFGTILGFRVIPEIL-----YTSAAHPDGYENLGLMVLAPSAFFLLGIMIWIVN
NQRD_CHLMU            IIRELFGFGTILGFHIIPKIF-----YASAAHPDGYENLGLMVLAPSAFFLLGIMVWLVN
NQRD_CHLCV            IVREFFGFGTILGLQLIPKCF-----YASETHPDGYENFGLMVLAPSAFFLLGIMIWGVN
A0A0E2JC11_CHLPS      IIREFFGFGTILGIQLIPKCF-----YASEAHPDGYENFGLMVLAPSAFFLLGIMIWGVN
NQRD_CHLFF            IIREFFGFGTLLGLQLIPKCF-----YASEAHPDGYENFGLMVLAPSAFFLLGIMIWVVN
NQRD_CHLPN            VIRELFGFGTLMGFRIIPQFV-----YASETHPDGYQNLSLMVLAPSAFFLLGIMIWLVN
                        :*:.* * : .                      :    :: :.  :::::. .:*  .

F4KQZ2_HALH1          SRNPKLVDVS--------------
H6KZK0_SAPGL          SLNPKLVDVS--------------
G0L9T4_ZOBGA          SRNPALVEDH--------------
G2PLL2_MURRD          SRNRALIEEA--------------
K4IGG0_PSYTT          SGNRKLIEEN--------------
Q8A8L0_BACTN          ARHKELQEESN-------------
E6SVY7_BACT6          ARNKELQEK---------------
A6LB21_PARD8          AKNKELQEN---------------
NQRD_PSEAE            TWKKDQVEAPTYKMAPQVSSKEAY
NQRD_SHEPC            TYKPEQVEAKG-------------
NQRD_SHEON            TYKPEQVEAKG-------------
NQRD_SHEDO            TYKPEQVEAKG-------------
NQRD_SHEPA            VMKPEQVEAKG-------------
NQRD_PSET1            TYKKDQVEAKA-------------
Q5QYQ6_IDILO          TFRTEQVEPKE-------------
NQRD_PSEA6            TIKPEQVEPKE-------------
Q604Z8_METCA          SWKTQQVEKADFVIATAHGEAH--
NQRD_VIBCH            TFKPEQVEAKE-------------
NQRD_ALIF1            ILKPEQVEAKE-------------
NQRD_VIBCB            ILKPEQVEAKE-------------
NQRD_YERPE            TLKPAQIEKE--------------
NQRD_PHOLL            TLKPAQVEKE--------------
NQRD_HAEDU            TWKPEQVEK---------------
NQRD_HAEIN            TWKPEQQEK---------------
NQRD_NEIMB            TWKPEQAEE---------------
NQRD_NEIG1            TWKPEQAEE---------------
Q7UWS2_RHOBA          LNKPEQIEEA--------------
C6BWF5_MARSD          VYEKRKNKR---------------
Q8EID7_SHEON          VIQRKRG-----------------
B8CPN5_SHEPW          VIQRKRG-----------------
B4S5U2_PROA2          TLTGYTEE----------------
B3EPP0_CHLPB          TITGYTEE----------------
A8ZWL2_DESOH          SLKKE-------------------
NQRD_CHLTR            IIRAPKTKR---------------
NQRD_CHLMU            IVRASKTKR---------------
NQRD_CHLCV            ILRSKKAKR---------------
A0A0E2JC11_CHLPS      ILRSKKERR---------------
NQRD_CHLFF            ILRSKKAKR---------------
NQRD_CHLPN            IRDSKKRKR---------------