CLUSTAL format seed alignment for MF_00430

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NQRF_PSEAE            -----------------MIGFEIFLAIGMFTAIVLGLVAIILVARAKLVSSGDVTIQING
R9S508_SIMAS          ------------------MDITIIAGVVMFTVIVLLLVAVILSARAKLVNSGDVTIIVND
NQRF_PSYA2            -----------------MDYFTAIGGVAMFTLIIMSFVAIILAARSRLVSSGDVTIHIND
NQRF_VIBAL            --------------------MDIILGVVMFTLIVLALVLVILFAKSKLVPTGDITISVND
NQRF_VIBCB            --------------------MDIILGVVMFTLIVLALVLVILFAKSKLVPTGDITISVND
NQRF_VIBVY            --------------------MDIILGVVMFTLIVLALVLVILFAKSKLVPTGDITISING
NQRF_VIBC3            -------------------MSTIIFGVVMFTLIILALVLVILFAKSKLVPTGDITISING
NQRF_VIBCH            -------------------MSTIIFGVVMFTLIILALVLVILFAKSKLVPTGDITISING
K6WZS4_9ALTE          -------------------MLDIYLGVGMFIAIVLALVLIIMFAKSKLVPEGEVTISING
NQRF_SHEDO            -------------------MLEVYLGVGMFTAIVLVLVLVILFAKSKLVASGDIIIGING
NQRF_HAES1            --------------------MEITLGIAMFTVIVLALAVLILFAKSKLVNSGDITIEIND
NQRF_PASMU            --------------------MEITLGIAMFTVIVLALAVIILFAKSKLVNSGDITIEIND
NQRF_HAEIN            ----------------MSDSVILALGIAAFTVIVLVLVAIILFAKSKLVDSGDITIDIND
NQRF_NEIMA            --------------------MEIILGIVMFTVIVLVLALMILFAKSKLVSEGDITIKVNG
NQRF_NEIMB            --------------------MEIILGIVMFTVIVLVLALMILFAKSKLVSEGDITIKVNG
NQRF_NEIG1            --------------------MEIILGIVMFTVIVLALALMILFAKSKLVSEGDITIKVND
NQRF_YERP3            --------------------MEIILGVVMFTLIVLALTVMILFAKSKLVNTGDITVEINE
NQRF_YERPS            --------------------MEIILGVVMFTLIVLALTVMILFAKSKLVNTGDITVEINE
NQRF_YERE8            --------------------MEIILGVVMFTLIVLALTVMILFAKSKLVNTGDITIDINE
NQRF_SERP5            --------------------MEIILGVAMFTGIVMVLVLLILFAKSRLVNTGDIAVEVNG
NQRF_KLEP7            --------------------MEIILGVVMFTLIVLVLSGLILAARSKLVNAGDVVIEINN
C6BWF7_MARSD          -------------------MVEIILGVVMFTGVVLALCVFILLARAKLVPSGEVNIEIND
D4H1M0_DENA2          -------------------MMLLLLGITSFTVVILLLVGIIINARKALVASGSVTVNING
A8ZWL4_DESOH          --------------------MIYVVSFSVFSSVIMVLVAMLLVLEATLVRKGTVHIVIND
K0NQ76_DESTT          ---------------------MYFLSILVFSGVIFILVSVLLFVESKVTSKGEFEITIND
I3Z1U5_BELBD          ------------------MGSVIITSIVAFTLIILLLVFILLFAQSKLVNSGDVKIIIN-
H6KZK2_SAPGL          ----------------MEIIIPIILAVIVFSVLILFMSAGLISARKKLLPQGDVKIKVN-
G0L1Y1_ZOBGA          ------------MLLAASTGGTILITVVAFLILLMILVALLLFTKEKLSPSGPVTITIN-
E6SVY5_BACT6          -------------------MNMILASIGVFLVVILLLVVILLVAKQILVPSGNVKLTIN-
Q64UR6_BACFR          ------------------MTSLILASIGVFLVVIILLVIILLVAKSYLSPSGEVTITMN-
F2KWV8_PREDF          ------------------MGQFITTSIAVFLITILVLVILLLVAKKYLSPSGKVTITIN-
F4KLK7_PORAD          ---------------MDQMTLIIVSSVAVFLLVVLLLVVVLLVAKSKLIPSGNVHINVN-
I3YQE3_ALIFI          ------------------MELTIIVAIIAFLAVTLLLVGLLLFAKAKLTSSGEVTIDIND
NQRF_CHLTR            -------------MTWLSGLYSIFVASAAFCSLGLILVAVILLSRKFLIKVHPCKLKINN
NQRF_CHLTA            -------------MTWLSGLYSIFVASAAFCSLGLILVAVILLSRKFLIKVHPCKLKINN
A0A0H3MJX9_CHLT2      -------------MTWLSGLYSIFVASAAFCSLDLILVAVILLSRKFLIKVHPCKLKINN
NQRF_CHLMU            -------------MSWLSSLYPIFIASTAFCALGLLLVAIILLSRKFLIKVHPCKLRINN
NQRF_CHLFF            -------------MTWLSGLYFISIASLVFCVIGLILSGVILISRKLLVKIHPCKLKINN
NQRF_CHLPN            -------------MTWLSGLYFICIASLIFCAIGVILAGVILLSRKLFIKVHPCKLKIND
F8KWJ9_PARAV          MFNLSHLSLTLLANFFGIDPILSLYAIAAFVLIGVGLTSLILFTKAKFVNSEECEIKVNS
D6YTY0_WADCW          ------------MTLFGIDLLLCLYAMIAFVAIGVALAGMILFTKAKFVSTDLCKIYINN
F8L6E4_SIMNZ          ------------------MIELTVFAIVSFILIGILLSGMILYAKKRLISTKPCKIGINH
                                                   *    . :   ::  .  .       : :* 

NQRF_PSEAE            --E-HSLTVPAGGKLLQTLAANNVFLSSACGGGGTCAQCKCVVVEGGGEMLPTEESHFTR
R9S508_SIMAS          --E-KTITVPAGGKLLQTLAGSGLFLPSACGGGGSCAQCKCIVNEGGGEMLPTEESHFTK
NQRF_PSYA2            NPD-NDVVTPAGGKLLQTLASEGIFLSSACGGGGTCAQCRCRVIEGGGSILPTEEGYFTQ
NQRF_VIBAL            DPS-LAIVTQPGGKLLSALAGAGVFVSSACGGGGSCGQCRVKVKSGGGDILPTELDHITK
NQRF_VIBCB            DPS-LAIVTQPGGKLLSALAGAGVFVSSACGGGGSCGQCRVKVKSGGGDILPTELDHITK
NQRF_VIBVY            DAD-KSIVTSPGGKLLSALAGAGVFVSSACGGGGSCGQCRVKVKSGGGDILPTELDHITK
NQRF_VIBC3            DPE-KAIVTQPGGKLLTALAGAGVFVSSACGGGGSCGQCRVKIKSGGGDILPTELDHISK
NQRF_VIBCH            DPE-KAIVTQPGGKLLTALAGAGVFVSSACGGGGSCGQCRVKIKSGGGDILPTELDHISK
K6WZS4_9ALTE          DPD-KAITAQPGDKLLGALANSGIFVSSACGGGGSCGQCRVDIKDGGGEILPTELDHISK
NQRF_SHEDO            DAD-KAITTGAGGKLLSVLADNGIFVSSACGGGGSCGQCRVNIKSGGGDILPTELDHISK
NQRF_HAES1            DPG-KAINLPAGGKLLGALANKGIFVSSACGGGGSCGQCIVKVTEGGGDILPTELSHISK
NQRF_PASMU            DPS-KAIHLPAGGKLLGALASQGIFVSSACGGGGSCGQCIVKVTEGGGDILPTELSHISK
NQRF_HAEIN            DPE-KAITLPAGGKLLGALASKGIFVSSACGGGGSCGQCIVKVKNGGGEILPTELSHINK
NQRF_NEIMA            E---KELTMPAGGKLLGALANEGIFIPSACGGGGSCGQCRVVVKSGGGDILPTELSHISK
NQRF_NEIMB            E---KELTMPAGGKLLGALANEGIFIPSACGGGGSCGQCRVVVKSGGGDILPTELSHISK
NQRF_NEIG1            E---KELTMPAGGKLLGALASQGIFVPSACGGGGSCGQCRVVVKSGGGDILPTELSHISK
NQRF_YERP3            DED-KSFTAPAGDKLLNMLSSHGIFVSSACGGGGSCGQCRVTIKEGGGDILPTELSHISK
NQRF_YERPS            DED-KSFTAPAGDKLLNMLSSHGIFVSSACGGGGSCGQCRVTIKEGGGDILPTELSHISK
NQRF_YERE8            DAD-KSFTAPAGDKLLNMLSSHGIFVSSACGGGGSCGQCRVTIKEGGGDILPTELSHISK
NQRF_SERP5            DLD-KSFTAPAGDKLLNMLSSQGIFVSSACGGGGSCGQCRVVIKEGGGDILPTELSHINK
NQRF_KLEP7            EAD-KQIRTPAGDKLLNTLSSNGIFVSSACGGGGSCGQCRVTVKEGGGDILPTELSHITK
C6BWF7_MARSD          DPE-KTIEVRPGTKLLGALAEKEIYVPSACGGGGSCGQCKCKVFEGGGDILPTETSHVSK
D4H1M0_DENA2          E---KDIETGVGKKLLGVLADNGIFVSSACGGGGSCGQCRVKVLEGGGDILPTEESHISR
A8ZWL4_DESOH          DAD-KALETPVGGTLLSALAGADIFLPSACGGGGSCGQCRCTVEEGGGDILPTELSHLSR
K0NQ76_DESTT          NTD-EPIKISGNPSLLSALSQKEIFLPSACGGSGSCGMCKCEVTDGGGSILPTELAHLTR
I3Z1U5_BELBD          GDESNPIVTSAGSTLLNTLGNKKIFLPSACGGGGTCAMCKCVIEDGGGEVLPTEEGHLSR
H6KZK2_SAPGL          GEK--TFEAKPGGTLLGVLSSQSVFLPSACGGGGTCAMCRCQVDNGGGDILPTELNHISR
G0L1Y1_ZOBGA          GEK--KIEVGSGSSLLSTLGNQKIFLPSACGGGGTCIQCECHVLSGGGEALPTETPHFSK
E6SVY5_BACT6          GEK--DLDVASGSTLLNTLSVNGVFLSSACGGKGSCGQCKCQVLEGGGEILPSEVPHFSR
Q64UR6_BACFR          GEQ--QLKTSQGGTLLGTLSANNVFLSSACGGKGSCGQCRCQVLEGGGEILPTETGFFSR
F2KWV8_PREDF          GDR--QLTVDQGSSVMATLNENGVFLPSACGGKASCGQCKVQVVEGGGEILDSERPHFSR
F4KLK7_PORAD          DVK--DLEVPMGGTLLTTLQNEGIFLSSACGGSGSCGQCRCRVVEGGGEILATEKGFFSR
I3YQE3_ALIFI          GEK--VITAESGSTLLSTLANNKVFLPSACGGGGSCGMCKCQVLEGGGDILPTETGFISR
NQRF_CHLTR            DDS-LTKTVDSGKTLLSSLLDSGIAIPSPCGGKAACKQCKVRITKNADEPLETDRSTFSK
NQRF_CHLTA            DDS-LTKTVDSGKTLLSSLLDSGIAIPSPCGGKAACKQCKVRITKNADEPLETDRSTFSK
A0A0H3MJX9_CHLT2      DDS-LTKTVDSGKTLLSSLLDSGIAIPSPCGGKAACKQCKVRITKNADEPLETDRSTFSK
NQRF_CHLMU            DDS-LTKTVDSGKTLLSSLLDSGIAIPSPCGGKAACKQCKIRITKNVDEPLETDRSTFSK
NQRF_CHLFF            DDS-LTKTVDSGHSLLSSLLDSGIPIPSPCGGKATCKQCKVKIVKGADQPLETDRATFSK
NQRF_CHLPN            NEE-LTKTVESGQTLLVSLLSSGIPIPSPCGGKATCKQCKVRVVKNADEPLETDRSTFSK
F8KWJ9_PARAV          DPK-LTKQVLGGSTLLQALSSNGIPVPSPCGGKATCKQCRVRIVEGADEPLETDRGTFNK
D6YTY0_WADCW          DDG-LTKSVPGGGTLLQSLMSQGITIPSPCGGKATCKQCRVQIVEGVDPPLETDKSTFSR
F8L6E4_SIMNZ          NED-LSKFVEGGRTLLVTLAEQGIALPSPCGGKATCKQCKVQVLEGGGDILETDRSSFSP
                                 . .::  *    : :.*.*** .:*  *   : .. .  * ::   .. 

NQRF_PSEAE            RQAKEGWRLSCQTPVKQDMQIRVPEEVFGVKKWECTVESNPNVATFIKELTLRLPDGESV
R9S508_SIMAS          REAKEGWRLSCQTPVKQDMKVHVEEDVFGVKQWECVVESNPNVATFIKELTLRLPEGENV
NQRF_PSYA2            GEIRNHMRLACQVAVKQDMKIEIDPEFFDVQKWECEVISNDNVATFIKELVLKIPEGEEV
NQRF_VIBAL            GEAREGERLACQVAMKTDMDIELPEEIFGVKKWECTVISNDNKATFIKELKLQIPDGESV
NQRF_VIBCB            GEAREGERLACQVAMKTDMDIELPEEIFGVKKWECTVISNDNKATFIKELKLQIPDGESV
NQRF_VIBVY            GEAREGERLACQVAVKTDMDIELPEEIFGVKKWECTVISNDNKATFIKELKLQIPDGESV
NQRF_VIBC3            GEAREGERLACQVAVKADMDLELPEEIFGVKKWECTVISNDNKATFIKELKLAIPDGESV
NQRF_VIBCH            GEAREGERLACQVAVKADMDLELPEEIFGVKKWECTVISNDNKATFIKELKLAIPDGESV
K6WZS4_9ALTE          REAKEGCRLSCQVSIKQDMDIELPEEIFGIKKWDCEVISNDNKATFIKELKLKIPNGESV
NQRF_SHEDO            GEARGGCRLSCQVNVKSDMEIELDEEIFGIKKWECDVISNDNKATFIKELKLQIPDGESV
NQRF_HAES1            REAKEGYRLSCQVNVKNSMKIELPEEVFGVKKWECTVISNDNKATFIKELKLQIPEGEEV
NQRF_PASMU            REAKEGYRLSCQVNVKNSMKVELPEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEV
NQRF_HAEIN            REAKEGYRLACQVNVKGNMEVELPEEIFGVKKWECTVISNDNKATFIKELKLAIPEGEEV
NQRF_NEIMA            REAREGCRLSCQVNVKTDMDIEVPEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEV
NQRF_NEIMB            REAREGCRLSCQVNVKTDMDIEVPEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEV
NQRF_NEIG1            REAREGCRLSCQVNVKTDMDIEVPEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEV
NQRF_YERP3            REAKEGCRLACQVNVKQNLKIELPEEIFGVKKWTCEVISNDNKATFIKELKLKIPDGDVV
NQRF_YERPS            REAKEGCRLACQVNVKQNLKIELPEEIFGVKKWTCEVISNDNKATFIKELKLKIPDGDVV
NQRF_YERE8            REAKEGCRLACQVSVKQNLKIELPEEIFGVKKWECEVISNDNKATFIKELKLKIPDGEVV
NQRF_SERP5            REAKEGCRLACQVNVKQNLKIELPEEIFGVKKWECEVISNDNKATFIKELKLKIPDGEDV
NQRF_KLEP7            RDAKAGCRLACQVAVKQNMKIELPEEIFGVKKWECEVISNDNKATFIKELKLRIPEGEVV
C6BWF7_MARSD          REAREGVRLACQVNVKQDMKIEVPAEIFDIKKWECTVKSNIPRATFIKELTLELPAGENV
D4H1M0_DENA2          REEREGMRLSCQVAVKQDMKIELEPEVFAAKSFDCEVISNNNVATFIKEFVLKVP--EKV
A8ZWL4_DESOH          QEQNDNVRLACQLKVREDMRIRIPEAIFSIRKYTATVVSNKNVATFIKELVLRIDNDETI
K0NQ76_DESTT          KDKLAGKRLSCQLKIKNNLKIKVPESIFGIKKVDATVISNHNVATFIKELVIKPEI--PI
I3Z1U5_BELBD          AEKQGNVRLSCQVKVKQDMKIRIPEEIFGIKKWECEVISNYNVSTFIKEFKVKLPEGENL
H6KZK2_SAPGL          KDAQDNWRLACQVKVRGDMEIRVPEEIFGIQKWECTVVSNYNVASFIKEFVVRLPEGEEM
G0L1Y1_ZOBGA          RELNAGARLACQVKVKQDMEITIPEEVFGIKKWPAKVVRNYNVASFIKEFVVEIPE--DM
E6SVY5_BACT6          KQQKDHWRLGCQVKVKGDMAIKVPESVLGVKEWECEVISNKNVATFIKEFIVALPKGEHM
Q64UR6_BACFR          KEQADHWRLGCQVKVKQDMSIKIDESILGVKEWECEVISNKNVATFIKEFIVALPPGEHM
F2KWV8_PREDF          KEIKDHWRLGCQCKVKGDMALKVPESVMGVKEWECTVISNKNVSSFIKEFKVALPPGEHM
F4KLK7_PORAD          KEQMAHWRLGCQTKVKEDLKVIVPESVFGVKEWECEVISNKNVATFIKEFVVKLPEGEHM
I3YQE3_ALIFI          KLAKDHWRLGCQVKVKENLRIKVPEAVLGVKKWECTVVSNRNISTFLKEFVVKLPEGENL
NQRF_CHLTR            QQLEQGWRLSCQTKVQHDLCLEVEERYFNASSWEGTVVSNENVATFIKELVLSVDPSRPI
NQRF_CHLTA            QQLEQGWRLSCQTKVQHDLCLEVEERYFNASSWEGTVVSNENVATFIKELVLSVDPSRPI
A0A0H3MJX9_CHLT2      QQLEQGWRLSCQTKVQHDLCLEVEDRYFNASSWEGTVVSNENVATFIKELVLSVDPSRPI
NQRF_CHLMU            QQLEQGWRLSCQTKVQHDMNLEIEERYFNASSWEGTVVSNENVATFIKELVLSVDPARPI
NQRF_CHLFF            RQLEQGWRLSCQTKVQHDMNLEIEERYLNASSWEGTVVSNDNVATFIKELVVSVSPEHPI
NQRF_CHLPN            RQLEEGWRLSCQCKVQHDMSLEIEERYLNASSWEGTVISNDNVATFIKELVVAVDPNKPI
F8KWJ9_PARAV          KELKEGWRLSCQAKVKHDLHILVDEHSLAVKEWKATVVSNKNVATFIKELIVEIPEGEEV
D6YTY0_WADCW          KELKEGWRLSCQSKLKHDISVHVEESCLDVKEIDAKVVSNENVATFIKELVVEVPE--EI
F8L6E4_SIMNZ          KQLKEGWRLSCQCKVKNDLELKVPESLLTLREFTAKVISNENVATFIKELVLEIPSSEEI
                             **.**  :: .: : :    :   .    *  *   ::*:**: :       :

NQRF_PSEAE            DFRAGGYVQLECPPHV-----VEYKDFDIQ-----PEYRGDWDKFNMWRYVSK---VDET
R9S508_SIMAS          DFRAGGYVQLEAPPHH-----VKFKDFDIE-----EKFRGDWEHFGFFNLESK---VTEP
NQRF_PSYA2            NFRAGGYVQLEAPPHE-----VHYKDFDIA-----EEYQDDWNNFGIFKYVSK---VDEP
NQRF_VIBAL            PFRAGGYIQIEAPAHH-----VKYADYDIP-----EEYREDWEKFNLFRYESK---VNEE
NQRF_VIBCB            PFRAGGYIQIEAPAHH-----VKYADYDIP-----EEYREDWEKFNLFRYESK---VNEE
NQRF_VIBVY            PFRAGGYIQIEAPAHH-----VKYADFDVP-----EEYRGDWDKFNLFRYESI---VKED
NQRF_VIBC3            PFRAGGYIQIEAPAHH-----VKYADFDVP-----EKYRGDWDKFNLFRYESK---VDEP
NQRF_VIBCH            PFRAGGYIQIEAPAHH-----VKYADFDVP-----EKYRGDWDKFNLFRYESK---VDEP
K6WZS4_9ALTE          PFRAGGYIQIEAPPHH-----VKYKDFDVP-----EEYRGDWERFGFFDIESK---VDDE
NQRF_SHEDO            PFRAGGYIQIEAPAHH-----VKYADFDVP-----AKYRGDWEHFGFFKLESK---VDEE
NQRF_HAES1            PFRAGGYIQIEAEPHT-----VHYKDFDIP-----KEYHEDWDKFDLWRYTSK---VDEH
NQRF_PASMU            PFRAGGYIQIEAEPHT-----VAYKDFDIP-----EEYHEDWDKYNLWRYVSK---VDEH
NQRF_HAEIN            PFRAGGYIQIEAEPHV-----VNYKDFDIP-----EEYHEDWDKYDLWRYVSK---VDEH
NQRF_NEIMA            PFRAGGYIQIEAPPHT-----VAYKDFDIP-----EEYHEDWDKYNLWQYVSK---VDEP
NQRF_NEIMB            PFRAGGYIQIEAPPHT-----VAYKDFDIP-----KEYHEDWDKYNLWQYVSK---VDEP
NQRF_NEIG1            PFRAGGYIQIEAPPHT-----VAYKDFDIP-----KEYHEDWDKYNLWQYVSK---VNEP
NQRF_YERP3            PFRAGGFIQIEAEPHT-----VKYADFDVP-----TEYRGDWDKFNLFRFESV---VTEP
NQRF_YERPS            PFRAGGFIQIEAEPHT-----VKYADFDVP-----TEYRGDWDKFNLFRFESV---ATEP
NQRF_YERE8            PFRAGGFIQIEAEPHT-----VKYADFDVP-----EEYRGDWDKFNLFRFESV---VAEP
NQRF_SERP5            PFRAGGFIQIEAPAHD-----ISYADFDVP-----DEYRGDWDKFNLFRYRSV---VNET
NQRF_KLEP7            PFRAGGYIQIECPPHK-----VAYADFDVP-----DEYRSDWDKFNLFRYVSE---VKEP
C6BWF7_MARSD          DFRAGGYIQIEAPAHT-----VHYKDFEVG-----DKFREDWDKFDLWRYTSV---VKEP
D4H1M0_DENA2          DFRAGGYIQVVIPPYE-----ADFKDFQVE-----DRFRSDWEKFGVFRYHAG---TKEE
A8ZWL4_DESOH          EFEAGQYMQIDIPEYDS----VCFAGFDVA-----DRFTSAWEQFDLTGLCVT---ADEP
K0NQ76_DESTT          DFKAGAYVQIDVPEYD-----LTFKDFHIE-----SKYVSEWKKYNFLELTAK---GIKQ
I3Z1U5_BELBD          DFESGGYIQIDVPAITVNFKDMDITPHPDL-GHPKDVYQSDWDKFGLWDLVMK---NDEE
H6KZK2_SAPGL          NFDPGGYIQIDVPKITVDYKNIDIEAHPEHHGDDPNKFQDEWDTYKLWDLQMV---NDEP
G0L1Y1_ZOBGA          GYKAGGYIQIEIPECEIKYSDIDITAHPEE-HETPDKFQAEWDKFNLWPLVMK---NPET
E6SVY5_BACT6          DFVPGSYAQIKIPKYS-MDYNKDIDKSLIG-----DEYLPAWEKFGLFGLKCT---NTED
Q64UR6_BACFR          DFVPGSYAQIKIPTFS-MDYDKDIDKSLIG-----DEYLPAWEKFGLLGLKCR---NDEP
F2KWV8_PREDF          DFLPGSYAQIKIPAYDCIDYDKDFDKNDIG-----EEYLGPWKKFNILSLKAH---NPEP
F4KLK7_PORAD          DFKSGSYAQIKIPKYE-----VKYSDYEVE-----EQFRGDWDKFNMWSLTAK---NTEE
I3YQE3_ALIFI          KFRSGGYIQIDIPKYD----AIKFSDMDVD-----EKYRADWDKFKMWDLVTT---NPED
NQRF_CHLTR            PFKPGGYLQITVPPYK-----TNTSDWKQT---MDPQYYSDWETFHLFDQIIDNLSLDTD
NQRF_CHLTA            PFKPGGYLQITVPPYK-----TNTSDWKQT---MDPQYYSDWETFHLFDQVIDNLSLDTD
A0A0H3MJX9_CHLT2      PFKPGGYLQITVPPYK-----TNTSDWKQT---MDPQYYSDWETFHLFDQVIDNLSLDTD
NQRF_CHLMU            PFKPGGYLQITVPSYK-----TNTSDWKQT---MDPQYYSDWETFHLFDKVIDHQSLDAN
NQRF_CHLFF            PFKPGGYLQISVPAYK-----TNTSDWKQT---MAPEYHSDWERFNLFNQIIDNSLLESG
NQRF_CHLPN            PFKPGGYLQITVPSYK-----TNSSDWKQT---MAPEYYSDWEHFHLFDQVIDNSQLPAD
F8KWJ9_PARAV          PYQSGGYLQFHVPPFK-----TNTADWKST---MDPMFYADWEKFGLFDKTIDFSHLPTG
D6YTY0_WADCW          PYRSGEYFQFHVPPFK-----TNTSDWKET---MEKKYFEDWEKFKMFDTEIDFSTLGEG
F8L6E4_SIMNZ          HYIPGDYLQFHVPSYD-----TNTDAWKET---IDKMYFEDWERFHLFGVPIQFHATDEE
                       : .* : *.                           :   *. : .             

NQRF_PSEAE            ---VIRAYSMANYPEEKGVVKFNIRIASPPP-------------GSDLPPGQMSSWVFNL
R9S508_SIMAS          ---VIRAYSMANYPEEKGIVKFNIRIATPPPR------------TQGLPPGQMSSYVFSL
NQRF_PSYA2            ---VIRAYSMANYPDEKGLIKFNIRIASPPPRG-----------PDGIPPGKMSSWTFSL
NQRF_VIBAL            ---TIRAYSMANYPEEHGIIMLNVRIATPPPN------------NPDVPPGIMSSYIWSL
NQRF_VIBCB            ---TIRAYSMANYPEEHGIIMLNVRIATPPPN------------NPDVAPGIMSSFIWSL
NQRF_VIBVY            ---IIRAYSMANYPEEFGIIMLNVRIATPPPN------------NPDVAPGQMSSYIWSL
NQRF_VIBC3            ---IIRAYSMANYPEEFGIIMLNVRIATPPPN------------NPNVPPGQMSSYIWSL
NQRF_VIBCH            ---IIRAYSMANYPEEFGIIMLNVRIATPPPN------------NPNVPPGQMSSYIWSL
K6WZS4_9ALTE          ---TIRAYSMANYPEEEGIIMLNVRVASPPPN------------NLSLPAGKMSSYIWSL
NQRF_SHEDO            ---TIRAYSMANYPEEFGIIMLNVRIATPPPR------------NLSLPCGKMSSYIWSL
NQRF_HAES1            ---IIRAYSMASYPEEKGIIMLNVRIATPPPR------------NPDVPPGQMSSYIWSL
NQRF_PASMU            ---IIRAYSMASYPEEKGIIMLNVRIATPPPN------------NPDAPPGQMSSYIWSL
NQRF_HAEIN            ---IIRAYSMASYPEEKGIIMLNVRIATPPPR------------QPDAPPGQMSSYIWSL
NQRF_NEIMA            ---ILRAYSMASYPEEKGIIMLNVRIATPPPR------------VPDAPPGQMSSYIWSL
NQRF_NEIMB            ---ILRAYSMASYPEEKGIIMLNVRIATPPPR------------VPDAPPGQMSSYIWSL
NQRF_NEIG1            ---ILRAYSMASYPEEKGIIMLNVRIATPPPR------------VPNAPPGQMSSYIWSL
NQRF_YERP3            ---TVRAYSMANYPEEHGIILLNVRIATPPPS------------VPDAPPGIMSSYIWSL
NQRF_YERPS            ---TVRAYSMANYPEEHGIILLNVRIATPPPS------------VPDAPPGIMSSYIWSL
NQRF_YERE8            ---TVRAYSMANYPEEHGIIMLNVRIATPPPS------------VPDAPPGIMSSYIWSL
NQRF_SERP5            ---TVRAYSMANYPDEKGIIMLNVRIATPPPR------------DPDVPPGIMSSYIWSL
NQRF_KLEP7            ---TLRAYSMANYPEEKGIIMLNVRIATPPPK------------VPDAPPGIMSSYIWSL
C6BWF7_MARSD          ---IVRAYSMANYPEEEGIIMLNVRVCPPPPF------------APDSPPGQMSSFIYSL
D4H1M0_DENA2          ---VQRAYSMANYPEEEGIVKLNVRIATPPPN-------------KNVPPGVGSSYIWSK
A8ZWL4_DESOH          ---VFRAYSLANPPYE-ELLRFTIRIATPPPG------------TDDIPPGIGSSYVFNL
K0NQ76_DESTT          ---GFRAYSLANPPHDNETMMMNVRIATPPPG------------TEGIPPGFGSSYVFGL
I3Z1U5_BELBD          ---LFRAYSMANHPAEGNIVMLTIRIATPPWD-------RANNKWMDVNPGVCSSYVFAQ
H6KZK2_SAPGL          ---QFRAYSMANHPAEGNIVMLNIRIATPPFKFKQVDGKRVWDGYQDINPGVCSSYIFNQ
G0L1Y1_ZOBGA          ---VERAYSMASYPAEGREIMLNVRIATPPWD-------RAKNGWMDVNPGVASSYIFSL
E6SVY5_BACT6          ---TIRAYSMANYPAEGDRIMLTVRIATPPFK-----PREQGPGFQDVMPGIASSYIFTL
Q64UR6_BACFR          ---TIRAYSMANYPAEGDRIMLTVRIATPPFK-----PKDQGPGFMDVMPGIASSYIFTL
F2KWV8_PREDF          ---TVRAYSMANYPAEGDIIMLTVRIASTPFL-----PRPQ-VGFQDVPTGIGSSYIFSL
F4KLK7_PORAD          ---TVRAYSMANYPAEGNIITLNVRIATPPMD-----RVTH--TWQKVPAGIASSYIFSL
I3YQE3_ALIFI          ---TFRAYSMANHPAEGNIIMLNIRIATPPFD-----KATG--GFMKVNPGICSSYVFSR
NQRF_CHLTR            --SANKAYSLASYPAELPLIKFNVRIATPPFV--------DQAPDPTIPWGVCSSYIFSL
NQRF_CHLTA            --SANKAYSLASYPAELPLIKFNVRIATPPFV--------DQAPDPTIPWGVCSSYIFSL
A0A0H3MJX9_CHLT2      --SANKAYSLASYPAELPLIKFNVRIATPSFV--------DQAPDPTIPWGVCSSYIFSL
NQRF_CHLMU            --SANKAYSLASYPAELPLIKFNIRIATPPFI--------NKSPDPTIPWGVCSSYIFSL
NQRF_CHLFF            --SANKAYSLASYPAELPVIKFNIRIATPPFI--------NNAPSPNIPWGVCSSYIFSL
NQRF_CHLPN            --SANKAYSLASYPAELPTIKFNIRIATPPFI--------NGKPNSEIPWGVCSSYVFSL
F8KWJ9_PARAV          SNEIIRAYSMASYPAEGRKLMFNIRIATPPFV--------GGKISDSIPWGICSAYTFSL
D6YTY0_WADCW          --EVIRAYSMASYPAEGKKVMFNIRIATPPFE--------GKELSKTIPWGICSSYTFGL
F8L6E4_SIMNZ          ---VIRAYSMASYPAEKNRLKFNIRIATPPFV--------KGEVAKDIPWGICSAYIFQL
                           :***:*. * :   : :.:*:....                    *  *:: :  

NQRF_PSEAE            KPGDKVTVYGPFGEFFAKDT---EAEMVFIGGGAGMAPMRSHIFDQLRRLKSN-RKISFW
R9S508_SIMAS          KPGDKITVYGPFGEFFAKET---DAEMIFVGGGAGMAPMRSHIFDQLRRLKSK-RKISFW
NQRF_PSYA2            KPGDKVTVSGPYGEFFAKKT---EAEMIFVGGGAGMAPMRSHIFDQLKRLNSD-RKISFW
NQRF_VIBAL            KEGDKCTISGPFGEFFAKDT---DAEMVFVGGGAGMAPMRSHIFDQLKRLHSK-RKMSFW
NQRF_VIBCB            KEGDKCTISGPFGEFFAKDT---DAEMVFVGGGAGMAPMRSHIFDQLKRLHSK-RKMSFW
NQRF_VIBVY            KEGDKCTISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLKSK-RKMSYW
NQRF_VIBC3            KAGDKCTISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLKSK-RKMSYW
NQRF_VIBCH            KAGDKCTISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLKSK-RKMSYW
K6WZS4_9ALTE          KEGDKATISGPFGEFFAKKT---DAEMVFIGGGAGMAPMRSHIFDQLRRLKTD-RKISFW
NQRF_SHEDO            KAGDKVTISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHLFDQLKRLKSK-RKMSFW
NQRF_HAES1            KEGDKVTISGPFGEFFAKET---DNEMVFIGGGAGMAPMRSHIFDQLKRLKSK-RKMSFW
NQRF_PASMU            KAGDKVTISGPFGEFFAKET---DAEMVFVGGGAGMAPMRSHIFDQLKRLKSK-RKMSFW
NQRF_HAEIN            KAGDKVTISGPFGEFFAKET---DAEMVFIGGGAGMAPMRSHIFDQLKRLHSK-RKMSFW
NQRF_NEIMA            KPGDKVTISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLNSK-RKITFW
NQRF_NEIMB            KPGDKVTISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLNSK-RKITFW
NQRF_NEIG1            KPGDKVTISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLHSK-RKITFW
NQRF_YERP3            KPGDKVVISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLHSK-RKISFW
NQRF_YERPS            KPGDKVVISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLHSK-RKISFW
NQRF_YERE8            KPGDKVVISGPFGEFFAKDT---DAEMVFIGGGAGMAPMRSHIFDQLKRLHSK-RRISFW
NQRF_SERP5            KAGDKVTISGPFGEFFAKDT---DAEMIFIGGGAGMAPMRSHIFDQLNRLKSK-RKITFW
NQRF_KLEP7            KPGDKVTISGPFGEFFAKET---DAEMVFIGGGAGMAPMRSHIFDQLKRLHST-RKISFW
C6BWF7_MARSD          NPGDKVTISGPYGEFFARDT---DAEMIFIGGGAGMAPMRSHIFDQLKRLSTT-RKVSYW
D4H1M0_DENA2          KPGDKVTITGPFGEFFAQDT---ENEMVFIGGGAGMAPLRSIVFDQLKRLNSK-RKISYW
A8ZWL4_DESOH          KPGDRVTLSGPYGDFLVKPT---GREMCFVGGGAGMAPMRSHILHQLNTEQTK-RPITFW
K0NQ76_DESTT          KPGDKLTVSGPYGDFMAKET---DNEMCFVGGGAGMAPLRSHILHQLDGIHTK-RKISFW
I3Z1U5_BELBD          KPGDKVTISGPYGEFHINPT---DREMIYIGGGAGMAPLRSHIFHLFHTEKT-DRKVSYW
H6KZK2_SAPGL          KPGDKVVVSGPYGEFHIKPT---KKEMVYIGGGAGMAPLRSHLFHLFHTLKTTDRKVSFW
G0L1Y1_ZOBGA          KPGDDVVISGPYGEFFINES---DAEMLYVGGGAGMAPMRSHLYHLFKTLKT-NRKVTYW
E6SVY5_BACT6          KPGDKVIMSGPYGDFHPLFD--SKKEMMWVGGGAGMAPLRAQIMHMTKTLKTTDRKMSYF
Q64UR6_BACFR          KPGDKVTMSGPYGDFHPILD--SKNEMMWIGGGAGMAPLRAQIMHLTKTLHITDRTMNYF
F2KWV8_PREDF          KPGDKVMMSGPYGDFHPNFT--SGKEMIWIGGGAGMAPLRAQIMHMTKTLHVRDREMHFF
F4KLK7_PORAD          KPGDKVTMSGPYGDFHIHED--SDAEMLYIGGGAGMAPLRAQLLHLFLTEHTT-RKVSFW
I3YQE3_ALIFI          KPGDKITISGPYGEFFLPDDLPDTQELIFIGGGAGMAPMRSHLMHLFKTEKTK-RPVSFW
NQRF_CHLTR            KPGDKVMVSGPYGESFMKED---NRPVIFLIGGAGSSFGRSHILDLLLNKHSD-RELTLW
NQRF_CHLTA            KPGDKVMISGPYGESFMKED---NRPVIFLIGGAGSSFGRSHILDLLLNKHSD-RELTLW
A0A0H3MJX9_CHLT2      KPGDKVMVSGPYGESFMKEN---NRPVIFLIGGAGSSFGRSHILDLLLNKHSD-RELTLW
NQRF_CHLMU            KPGDKVTVSGPYGESFMKED---NRPVIFLIGGAGSSFGRSHILDLLLSKHTN-RELTLW
NQRF_CHLFF            KPGDKITVSGPYGESFMKEN---NRPLIFLIGGAGSSFGRSHILDLLLDKHST-RDITLW
NQRF_CHLPN            KPGDKITVSGPYGESFMKDD---DRPLIFLIGGAGSSFGRSHILDLLLNKHSK-REIDLW
F8KWJ9_PARAV          KPGDNVRLSGPYGESFMIND---NRELIFLIGGAGSSFGRSHILHLFNTEHTQ-RQVSMW
D6YTY0_WADCW          KPGDTVRLSGPFGESYMIDD---NRELVFLIGGAGSSFGRSHIMHLFKTENTK-RKVTLW
F8L6E4_SIMNZ          KAGDTVKLSGPFGESHMIDN---GRELVFLIGGAGSSFGRSHILDLFKDKQTK-RKVTLW
                      : **   : **:*:            : :: **** :  *: : .         * :  :

NQRF_PSEAE            YGARSLREAFYTEEYDQLQAENPNFQWHLALSDPQPEDN-----------WTGLTGFIHN
R9S508_SIMAS          YGARSLRELFYKEDYDMLAAENDNFTWNIALSDPQPEDN-----------WNGLTGFIHN
NQRF_PSYA2            YGARSIREMFYVEDYDQLEADFANFQWHVALSDPQPEDN-----------WTGYTGFIHN
NQRF_VIBAL            YGARSKREMFYVEDFDMLQAENDNFVWHCALSDPLPEDN-----------WDGYTGFIHN
NQRF_VIBCB            YGARSKREMFYVEDFDGLAADNDNFVWHCALSDPLPEDN-----------WDGYTGFIHN
NQRF_VIBVY            YGARSKREMFYVEDFDGLAAENDNFVWHCALSDPLPEDN-----------WDGYTGFIHN
NQRF_VIBC3            YGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDN-----------WTGYTGFIHN
NQRF_VIBCH            YGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDN-----------WTGYTGFIHN
K6WZS4_9ALTE          YGARSLREMFYVEDFDMLQKENDNFNWHVALSDPQPEDN-----------WEGLTGFIHQ
NQRF_SHEDO            YGARSKREMFYVEDFDGLAAENENFQWHVALSDPQAEDE-----------WTGYTGFIHN
NQRF_HAES1            YGARSKREMFYVEDFDMLQAENDNFVWHVALSDPLPEDD-----------WDGYTGFIHN
NQRF_PASMU            YGARSKREMFYVEDFDTLQAENDNFVWHVALSDPQPGDN-----------WDGYTGFIHN
NQRF_HAEIN            YGARSKREIFYQEDFDQLQAENPNFVWHVALSDALPEDN-----------WTGYTGFIHN
NQRF_NEIMA            YGARSKREMFYVEDFDQLAAEFPNFTWHVALSDPLPEDN-----------WDGYTGFIHN
NQRF_NEIMB            YGARSKREMFYVEDFDQLAAEFPNFTWHVALSDPLPEDN-----------WDGYTGFIHN
NQRF_NEIG1            YGARSKREMFYVEDFDQLAAEFPNFTWHVALSDPLPEDN-----------WDGYTGFIHN
NQRF_YERP3            YGARSRREMFYEEDFDQLQAENDNFRWHVALSDPQPEDN-----------WTGYTGFIHN
NQRF_YERPS            YGARSRREMFYEEDFDQLQAENDNFRWHVALSDPQPEDN-----------WTGYTGFIHN
NQRF_YERE8            YGARSRREMFYEEDFDQLQAENDNFRWHVALSDPQPEDN-----------WTGYTGFIHN
NQRF_SERP5            YGARSLREMFYEEDFNQLQAENENFTWHVALSDPQPEDN-----------WTGYTGFIHN
NQRF_KLEP7            YGARSLREMFYDEEFEQLARDNPNFTFHVALSDPLPEDN-----------WTGHTGFIHN
C6BWF7_MARSD          YGARSLREMFYVEEFDKLAEECPNFNWYVALSDPLPEDN-----------WTGYTGFIHQ
D4H1M0_DENA2          YGGRSKKELFYLKDFEELQKEFDNFSWHIALSDPLPEDN-----------WDSYTGFIHK
A8ZWL4_DESOH          YGARSVQEMFYHEEFTKLAEQYDNFSYHVALSDPRPEDN-----------WQGMTGFIHQ
K0NQ76_DESTT          YGARSLKEMFYDDVFKDLERQHDNFTYHVALSNPDEEDR-----------WTGMTGFIHT
I3Z1U5_BELBD          YGGRSKKELFYTPQFRDIEKDFPNFNFHIGLSEPLPEDNWKVKKSLDDREGDGYVGFIHQ
H6KZK2_SAPGL          YGGRTRRELFYIEQFREIEKQFPNFRFYVALDNPLPEDNWQVKENIDAD-GDGFKGFIMP
G0L1Y1_ZOBGA          YGGRSKRELFYIDHFKKLEQEFPNFKFYMALSEPMEEDNWKVKENIDAP-GDGFVGFIHN
E6SVY5_BACT6          YGARALNEVFYLEDFLQIEKDFPNFSFHLALDRPDPAA--------DAAGVKYTPGFVHN
Q64UR6_BACFR          YGARALNEVFYLEDFLQIEKDFPNFKFHLALDRPDPAA--------DAAGVKYTAGFVHN
F2KWV8_PREDF          YGARSLSEAFFLEDFWELEKEYSNFHFHLSLDRQDPKA--------DEAGVKYYTGFAVN
F4KLK7_PORAD          YGARSRSEIFYEEDFRAIEREFPNFSFHIALSAPLPED--------NWTGL---TGFIHQ
I3YQE3_ALIFI          YGARALKEVPYLDEFHAIEKDFPNFSFNLALDRPDPEA--------DAAGVKYTPGFVHN
NQRF_CHLTR            YGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQEDLDQGWD----KNDPIKTNFLFK
NQRF_CHLTA            YGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQEDLDQGWD----KNDPIKTNFLFK
A0A0H3MJX9_CHLT2      YGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQEDLDQGWD----KNDPIKTNFLFK
NQRF_CHLMU            YGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQEDLDKGWD----SKDPIKTNFLFK
NQRF_CHLFF            YGARSLKENIYQEEYEKLEKDFPNFHYHLVLSEPLAEDIASGWD----KNDPEKTNFLFR
NQRF_CHLPN            YGARSLKENIYQEEYENLERQFPNFHYHLVLSEPLPEDIAAGWD----KDDPTKTNFLFR
F8KWJ9_PARAV          YGARSIKENIYQKEYEELAQKYPNFTYNLVLSEPLPEDLSAGWP----KDDPIKTNYLFK
D6YTY0_WADCW          YGARSLKENIYEDEYRQLDKDHENFTYHLVLSDPQPDDIKSGWP----KDDPIKTAFLFK
F8L6E4_SIMNZ          YGARSLKENIYQEEYEKLEKEFENFYYKLVLSEPAKDDLAQGWP----KDDPKKTNYLFK
                      **.*:  *  :   :  :  .  ** :   *.                        :   

NQRF_PSEAE            VLFENYLKDHPAPEDCEFYMCGPPMMNAAVIKMLTDLGVERENILLDDFGG
R9S508_SIMAS          VLYEQYLKDHPAPEDCEFYMCGPPMMNAAVIKMLKDLGVEDENILLDDFGG
NQRF_PSYA2            VLLEEYLKGHPNPEDCEYYMCGPPMMNAAVIDMLHSLGVEDENIMLDDFGG
NQRF_VIBAL            VLYENYLRDHEAPEDCEYYMCGPPMMNAAVIGMLKDLGVEDENILLDDFGG
NQRF_VIBCB            VLYENYLRDHEAPEDCEYYMCGPPMMNAAVIGMLKDLGVEDENILLDDFGG
NQRF_VIBVY            VLYENYLRDHDAPEDCEYYMCGPPMMNAAVIGMLKNLGVEDENILLDDFGG
NQRF_VIBC3            VLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENILLDDFGG
NQRF_VIBCH            VLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENILLDDFGG
K6WZS4_9ALTE          VLLENYLKDHPAPEDCEFYMCGPPMMNAAVISMLKDLGVEDENIMLDDFGG
NQRF_SHEDO            VLYENYLRDHDAPEDCEFYMCGPPMMNAAVISMLKDLGVEDENILLDDFGG
NQRF_HAES1            VLYENYLKNHEAPEDCEYYMCGPPVMNAAVIKMLKDLGVEDENILLDDFGG
NQRF_PASMU            VLYENYLKDHEAPEDCEYYMCGPPIMNASVIKMLKDLGVEDENILLDDFGG
NQRF_HAEIN            VLYENYLKNHEAPEDCEYYMCGPPVMNAAVIKMLKDLGVEDENILLDDFGG
NQRF_NEIMA            VVYENHLKNHEAPEDCEFYMCGPPIMNQSVIKMLKDLGVEDENILLDDFGG
NQRF_NEIMB            VVYENHLKNHEAPEDCEFYMCGPPIMNQSVIKMLKDLGVEDENILLDDFGG
NQRF_NEIG1            VVYENHLKNHEAPEDCEFYMCGPPIMNQSVIKMLKDLGVEDENILLDDFGG
NQRF_YERP3            VLLENYLKDHPAPEDCEFYMCGPPMMNAAVIKMLKDLGVEDENIMLDDFGG
NQRF_YERPS            VLLENYLKDHPAPEDCEFYMCGPPMMNAAVIKMLKDLGVEDENIMLDDFGG
NQRF_YERE8            VLLENYLKNHPAPEDCEFYMCGPPMMNAAVIKMLKDLGVEDENIMLDDFGG
NQRF_SERP5            VLLENYLRNHPAPEDCEFYMCGPPMMNAAVIKMLKDLGVEDENIMLDDFGG
NQRF_KLEP7            VLYENYLRDHPAPEDCEFYMCGPPVMNAAVIKMLKDLGVEDENILLDDFGG
C6BWF7_MARSD          VLYDNYIKDHPAPEDCEFYMCGPPMMASAVEKMLMDQGVEKENIMYDDFGG
D4H1M0_DENA2          VVLDNYLKNHEAPEEIEYYLCGPPMMIDAVKVMLDGLGVEPENIYFDDFGG
A8ZWL4_DESOH          CLYDHYLKDHADPAEIEYYLCGPPLMIDAVMTMLDELGVEPDMIAYDSFS-
K0NQ76_DESTT          HLCEAYLCKHEDPTQIEYYLCGPPPMINAIINMLYDLGVEDDMIFFDKF--
I3Z1U5_BELBD          VLYDNYLKDHPEPDEVEFYLCGPPLMNAAVLKLLDDMGVPQENIRFDDFGG
H6KZK2_SAPGL          VCYEQYLKDHPEPEEIEYYFCGPPMMNKSVVDTLDRLGVPEENISFDDFGG
G0L1Y1_ZOBGA          CVIEHYLNHHESPEDIELYFCGPPLMNKAVQKMGEDFGIPDEHIRFDDFGG
E6SVY5_BACT6          VIYETYLKDHEAPEDIEYYMCGPGPMSKAVEKMLDDLGVPAQNLMFDNFGG
Q64UR6_BACFR          VIYETYLKNHEAPEDIEYYMCGPGPMSKAVEKMLDDLGVPSKNLMFDNFGG
F2KWV8_PREDF          CIRDEYLSKHEAPEDCEYYLCGPPMLIKTVTDYLDSLGVDQDAIMYDNFG-
F4KLK7_PORAD          AIYDNYLKDHEAPEDIEYYMCGPGPMSAAAIKMLDNLGVPPEQINYDNFG-
I3YQE3_ALIFI          VLYENYLKNHQAPEDCIYLMCGPPMMIASVVKMLDSLGVPPENILYDNFGS
NQRF_CHLTR            AFELGQLSHLPNPEDYLYYVCGPALHNSSILTLLDNYGVERSSIVLDDFGS
NQRF_CHLTA            AFELRQLSHLPNPEDYLYYVCGPALHNSSILTLLDNYGIERSSIVLDDFGS
A0A0H3MJX9_CHLT2      AFELGQLSHLPNPEDYLYYVCGPALHNSSILTVLDNYGVERSSIVLDDFGS
NQRF_CHLMU            AFELGQLSKLPNPEDYLYYVCGPALHNSSILTLLDNYGVERSSIILDDFGS
NQRF_CHLFF            AFELGQLSKLSNPEDYLYYVCGPPLHNSSILKLLDNYGVERSSIILDDFGN
NQRF_CHLPN            AFNLGQLSRLDNPEDYLYYVCGPPLHNSSILKLLGDYGVERSSIILDDFGS
F8KWJ9_PARAV          AFELGQLSKMESPEECLFYVCGPPMHNISVLKLLDDYGVPRKSIILDDFGS
D6YTY0_WADCW          AFEEGQLKKMDYPEECLYYVCGPPLHNSSVMRLLDDYGVPRESIILDDFGS
F8L6E4_SIMNZ          AFEEGQLKEMEEPENCLYYVCGPPLHNQSVIHLLDEYGVPMENIILDDFGS
                            :     * :    .***     :        *:  . :  *.*