CLUSTAL format seed alignment for MF_00432

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PETG_CUSRE      MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGGRLDV---
PETG_PELHO      MIEVFLFGIVLGLIPITLAGLFVTAYLQYKRGDRLGL---
PETG_CUSOB      MIEPFLLGIILGLIPITLIGLFVTAYLQYRRGDQLDF---
PETG_BIGNA      MIELLLFGIILGLISCVLAGLFVSAYYQYKR-NR------
PETG_PROM4      MIEPLLCGIVLGLVPITIVGLFVSAWNQYRRESAMPDWE-
PETG_PROMA      MIEPLLCGIVLGLVPITLLGLFVAAWNQYRRGSAIPDWE-
PETG_PROM5      MIEPLLCGIVLGLVPITLLGLFVSAWNQYRRGSGLLDMD-
PETG_SYNS3      MIEPLLCGIVLGLIPITLMGLFVAAWNQYRRGSALEG---
PETG_PROMM      MIEPLLCGIVLGLIPVTLLGLFVDAWNQYRRDTVLGDW--
PETG_SYNY3      MIEPLLLGIVLGLIPVTLAGLFVAAYLQYKRGNQFNLD--
PETG_GLOC7      MIEPLVLGLVMGLVPITLAGLFVAAYLQYKRGNQLNLD--
PETG_SYNJA      MIEPILLGIVLGMVLVTLAGLFVAAYRQYQRGNKMGL---
PETG_GLOVI      MIEPILLGMVLGFVPVTIAGLLVAAWLQYKQGNPSGLGEK
PETG_SYNP2      MIEPLLLGIVLGLIPVTLAGLFVAAYLQYKRGNDLGME--
PETG_PHATC      MVEPLLSGIVLGLITVSALGLFVAAFLQYRRGNQFEI---
PETG_CYAPA      MVEPLLSGIVLGLIPVTLIGLFVAAYLQYRRGNQFEF---
PETG_EMIHU      MVEVLLSGIVLGLVPVTITGLFVAAYLQYRRGNQFGL---
PETG_GRATL      MVEPLLSGIVLGLIPVTLFGLLVAAYLQYRRGNQFGL---
PETG_RHDSA      MIEPLLFGIVLGLIPVTLVGLFVAAYLQYRRGNQFGL---
PETG_SYNE7      MIEPLLCGIVLGLIPITLAGLFMAAYLQYRRGNQLGA---
PETG_ACAM1      MVEPLLAGIVLGLVPVTLAGLFVAAWQQYKRGEEVG----
PETG_CYAP4      MVEPLLCGIVLGLIPITLAGLFVAAYQQYKRGKELGV---
PETG_TRIV2      MVEPLLSGIVLGLIVVTLSGLFYAAYKQYKRPNELGG---
PETG_MASLA      MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG---
PETG_TRIEI      MVEPLLSGVVLGLILVTLSGLFFAAYQQYKRGNQLNG---
PETG_THEEB      MIEPLLCGIVLGLIPVTLAGLFFAAYQQYKRGSQLEL---
PETG_ANEMR      MVEALLSGIVPGLIPITLAGSFVIAYLQYRRGDQLDL---
PETG_HUPLU      MVEALLSGIVLGSIPITLAGSFVTAYPQYRRGDQLDLR--
PETG_CYCTA      MIEALPSGIVLGLIPITSAGSSVTAYLQYRRGDQLDI---
PETG_CRYJA      MIEVLLSGIVLGLIPITLAGLFVTAYLQYRRGDQLDI---
PETG_MESVI      MVESLLSGIVLGMIPITLAGLFVTAYLQYRRGDQLKI---
PETG_STAPU      MVEPLLSGIVLGMIPVTLAGLFVTAYLQYRRGDQLDL---
PETG_OSTTA      MVETLLSGIVLGLMPVTLAGLFTTAYLQYRRGDQLNL---
PETG_PLETE      MVEALLSGIVLGLVPVTILGLFVTAYLQYRRGDRVTSSF-
PETG_CHLVU      MVEALLSGIVLGLVPVTIAGLFVTAYLQYRRGDQLNI---
PETG_TUPAK      MVEPLLSGIVLGLVPITITGLLVTAYLQYRRGDSLNF---
PETG_CHLRE      MVEPLLCGIVLGLVPVTIAGLFVTAYLQYLRGDLATY---
PETG_CYAM1      MVEILLSGIVLGLIPITILGLLMAAYFQYQRSKAAS----
PETG_CYACA      MVEVLLTGIVLGSIFITLLGLLAAAKLQYNRKKTN-----
PETG_EUGGR      MVETLLSGIILGLIPITICGLFFTAYLQYMRSGNSFY---
                *:* :  *:: * :     *    *  ** :