CLUSTAL format seed alignment for MF_00433

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PETL_CHLAT      --MFTAISYLGILVGALLFVTITFLTLRT-IQLL
PETL_MESVI      --MFTVVSYLGILAAFALVTIGIFLVLRT-IQLI
PETL_TUPAK      --MVTLISYISLLAGFVIIASVFYLALVK-IKLI
PETL_CHAVU      --MFTVISYLSLLFISFLFALTLFIVLNK-IELI
PETL_GNEPA      --MAILISYFCFLLIFFLFTLILFFGLNK-IRLI
PETL_WELMI      --MVILISYFCFLLVFFLFTLILFIGFNR-IRLI
PETL_CHAGL      --MISILTYFGILFGILTITVIIFVALNK-IQLI
PETL_CHLVU      --MVTIFSYIALLLSALVITLTCYIGLLK-IKLI
PETL_NEPOL      --MFTVISYFGFLLVALAFTLVTYLGLRA-IQLI
PETL_STIHE      --MLTIISYLVLLVGALTVTLVIYLGLLKGVKLI
PETL_OLTVI      --MLTVIAYLGLLASVLIGTIVIYLGLVK-VKLI
PETL_ADICA      --MFTLLSYFAFLMLALTFTLALFVGLNK-IQIL
PETL_TETOB      --MLTITSYVGLLFTALGFTLGLYFGLTKVVKLI
PETL_HUPLU      --MPIILSYSGFLLAAPIPASAPFTGLNK-IRLI
PETL_CUSGR      --MPTITSYFCLLLAALTLTLALFIGLSK-RQLI
PETL_PSINU      --MLTLLSYFGLLLAALISTLVLFIGLNK-VKLI
PETL_HELAN      --MPIITSYFGFLLTALTIASALFIGLSK-IRLI
PETL_ANGEV      --MLTLLSYFGFLFAILTLTSVLFIGLNK-IQLI
PETL_CALFG      --MPTITSYFGFLLAASTITPALLIGLNK-IRLI
PETL_OXYRB      --MFTLTSYFGFLLAALTITFVLFIGLNK-IRLI
PETL_POPTR      --MPTLTSYFGFLLVALTITLVLFISLSK-IRLI
PETL_PHAVU      --MLTITSYFGFLLAVLIITSSLFIGLSK-IQLI
PETL_LOTJA      --MPTITSYFGFLLAVLTITSGLFISLRK-LRLI
PETL_ZYGCR      --MFTIITYFGLLLAALALAVVLFVGLSK-IELI
PETL_STAPU      --MLTIISYFGLLLATLTFTIVLFVGLSK-IQLI
PETL_CYCTA      --MPTITSYFGFLLASLIFTLALFIGSSK-IRLL
PETL_ABIHO      --MSTIISYFGFLLASIIFTLILFISLSK-IQLI
PETL_PINMU      MPTITIISYFGLLLASIIFTLVLFISLSK-IQLI
PETL_TRIV2      --MLAIVAYIGFLALFTGIAAGLLFGLRS-AKIL
PETL_CYAPA      -----MVEYLVILSGMFGLALACFFGLRS-IKLI
PETL_MASLA      -MILGAVFYIVFIALFFGIAVGIIFAIKS-IKLI
PETL_THAPS      --MSILINYFLLVGFCFALASGLFLGLKS-IKLI
PETL_TRICV      --MTIAIDYFLLVGFCFAFTSGLYLGLKS-IKLI
PETL_PHATC      --MTVAIDYFLLVGFCFAVTSGLWIGLKS-IKLI
PETL_EMIHU      --MSALIGYILLMTLMFSLAAGLYFGLRS-IRLI
PETL_PYRYE      --MSVFLGYIIFLAAFFGLATGLFLGLKA-IKLI
PETL_GUITH      --MSLIIGYIILLACAFGLAAGLYFGLSA-IKLI
PETL_RHDSA      --MSILIGYIILLACAFGLAAGLFFGLSL-IKLI
                        *  ::      .            ::