CLUSTAL format seed alignment for MF_00434

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PHS_MYCLE       ------------------MTVLTDEQVDAALLDLN-DWKHTD----GALCRSIKFPTFLA
PHS_MYCTU       ------------------MAVLTDEQVDAALHDLN-GWQRA----GGVLRRSIKFPTFMA
PHS_STRAW       ----------------MPVEPLSQKEIEDRLAELP-GWSLD----GDRISRSYRLGSHFA
PHS_STRCO       ----------------MPAEPLSPQEVEERLATLP-GWSLD----AGRLTRSYRLGSHFA
PHS_HALSA       -----------------MSDRLDDDTISDRLPD---DWIHD----GDAITRTYTFEEYLD
PHS_AGRFC       ----------------MKYPRLEPDAIRQALSKLE-GWSLRE-D-GAAIVRSFKFSSFAE
PHS_RHIME       ----------------MRPEKLDAAAIAEHLHKME-GWVLAE-D-GGSIWKTFRFKTFAE
PHS_BRADU       -----------------MAERLTTEARKQALGGIP-DWTEVS-G-RDAIGKTFVFKDFNE
PHS_BRUME       ----------------MARNRLTESEMNEALRALD-GWQKVD-G-REAITRSFKFKDFST
PHS_RHILO       ----------------MTREKLSKDAITAALAELG-DWSLAT-D-GASIKRSFVFRNFSE
PHS_BORBR       ----------------MSTEFPMRIGAEVALPALQ-GWNAAA-G-RDAIEKRYRFDNFNA
PHS_CAUVC       ----------------MSRPRIGA---AAAITQLE-GWAIAP-NHKDAIVKTFRFDDFNQ
PHS_RALSO       -----------------MMPTLNDEQRKALFAELP-GWSLQN-D-RDAIHKRFTFTDFNA
PHS_SYNY3       ---------------MATPQRLTDPEIQTALGELG-GWSLQG----NKLHRQFKFANFNQ
PHS_PROMM       ----------------MTATLLTAEQLSSVAEKLP-GWTLAD----QRLQRQWRFRNFVE
PHS_SYNPX       --------------MIAMPTLLSADQRQTLPATLP-HWTVHE----QSISRELVFNDFNE
PHS_PROMA       ----------------MENKLLSSQEIQELRKSLP-TWEEAE----GKLVKRFKFTNFIE
PHS_SACS2       ------------------MSGISSKELEEL--KIN-GWIVLE-N-GKKIKKEFRFKDFKQ
PHS_SULTO       ------------------MKKLTEKEIREELNKMK-GWSLK----GNVIEKTFLFHDFKE
PHS_NOSS1       -----------------MAQLLSDVEIQSQASKLS-GWTLE----GSKLQTTRKFKDFIE
PHS_THEEB       -----------------MAERLSPADIEAQLANLP-GWKQV----GDRLEQTFTFKDFLG
PHS2_GLOVI      ------------------MNKMTPEEIETALKPIA-DWQLSEADGATAIERVFRFDDFVQ
PHS_AQUAE       -----------------MVRKLSEEEVKRELENLE-GWEFCK----DYIQKEFSTKNWKT
PHS_CHRVO       -----MNLLELSCTPQHGQSPLADNTVKQLLSTLP-DWEIV----GIELRKTYRFANYHE
PHS_NITEU       MTNVCDLTDRKCKPCEGGVPPLEMEEAEKLLKQLEQGWQLAD-N---KISRTFSFKNYYQ
PHS_XANAC       MTDLIPLEQAHCLPRKGSDHKLGEARLAELLPQVP-GWELAE--AGMALTRTFRFADYYR
PHS_XYLFA       MNDLITLAQAHCQPREKKEHKLGQARLAELLPQVP-GWELSN-N-GHALTRTFRFDNYYR
PHS_PSEAE       ---MTALTQAHCEACRADAPHVSDEELPVLLRQIP-DWNIEVRDGIMQLEKVYLFKNFKH
PHS_PSESM       ---MSTLNQAHCEACSAGAPQVSEAELPELLRQIP-DWNIEVRDSVMQLEKVFLFKNFKF
PHS_SHEON       ---MTALTQMKCEACQADAPKVTDEELAELIRMIP-DWGVQVRDGIMQLERVYKFKNFKL
PHS_VIBCH       -----MLDELRCEACSAGAIGLTSEEQQQLLSELD-GWALIHRDGIAQLEKRYRFKNFKQ
PHS_VIBPA       -----MLNEQKCEACSFDAIALTKEEQQSLLLQLS-DWHLIERDDIPQLEKVYKFKNFKQ
PHS_CHLTE       ---MTQLENKHCVPCEGTAAPMASEELQRQLSSLP-EWTLVDDSGTSKLVRVFTFKDFQS
PHS1_GLOVI      ----MNLTEQRCTACRPDAPRVGAAEIAELHPQIP-AWRIVEIEGTPRLERQFRLRDFRE
                                                     *          :           

PHS_MYCLE       GIDAVCRVAEHAETKDHHPDIDIRYRTVTFILVTHYADG-ITKKDITMARDIDRLIGD--
PHS_MYCTU       GIDAVRRVAERAEEVNHHPDIDIRWRTVTFALVTHAVGG-ITENDIAMAHDIDAMFGA--
PHS_STRAW       AAAMVVHIAQVQEELDHHSDLTLSYHTVSLTVNTHSVGGAVTELDFALARRVEDLAPGHG
PHS_STRCO       AAAMVVHVAQVQEELDHHSDLTLGYHTVALAVHTHSAGGAVTEKDVELARRVEDLAAGHG
PHS_HALSA       GVAFASEVGDLADEAFHHPEITIRYDEVEVRFTDHEAGG-VTSQDIELARRTDDRR----
PHS_AGRFC       AFGFMAESALAAEKLNHHPEWSNVYSRVKVCLTTHDSQG-VTERDFLLAEAMQKAAAGRG
PHS_RHIME       AFTFMTQCAFAAEKLNHHPEWFNVYNKVDVTLSTHDADG-LTELDFKLAAKMDQAAEGRM
PHS_BRADU       AFGFMTRAALVAEKMDHHPEWRNVYKTVEVVLSTHDAGG-VTALDIELARAMNAIAKLTP
PHS_BRUME       AFGFMAQAALYAEKLDHHPEWFNAYNRVDVTLATHSENG-VTELDIKMARKMNAIAG---
PHS_RHILO       AFAFMTRVALAAEKMDHHPDWSNVYKTVDVTLNTHDAGG-VTALDIALAKKMNHYFGG--
PHS_BORBR       AFGFMARVAMFAEKMDHHPEWRNVYNRVDVTLTTHDAGG-VTELDVRMAQFMDEAAGRLG
PHS_CAUVC       AFGFMTRVALMADKLDHHPEWFNVYNRVEVLLTTHDADG-VTDLDLTLAKFMDSAA----
PHS_RALSO       AFGFMTRVALKAEQVNHHPEWFNVWNRVDITLSTHDANG-LTHRDADLARFIEQAAQLTG
PHS_SYNY3       AFGFMTRLALVAETLNHHPEWSNVYNRVTIDLTTHDAGG-ITELDVKFATKANSFAD---
PHS_PROMM       AFGFMTRVALLAEAMNHHPEWSNVYATVTIELTTHDVNG-LSDRDLKLAEAINLLEPG--
PHS_SYNPX       AFGFMSRVALLAEGRNHHPNWSNVYNRVSITLSTHDLGG-LSDLDVELAAAIDQLLPA--
PHS_PROMA       AFGFMTKIAIISESLSHHPEWTNIYSEVIIRLSTHDMGG-ITMLDYKLAKAIDAIKYE--
PHS_SACS2       SVDFLKDIQPSADALDHHPDVCVYYNRVVVELTTHDVGG-LTDLDYKLAIKLDELYKMKT
PHS_SULTO       AVNFLNKVQPIADSMNHHPDVCIYYNKVIVQLTTHDAGG-ITDLDVELAKKIDELLT---
PHS_NOSS1       AIAFVNKLVEPAESAGHHPDIEISYNKVKVTLTTHDAGG-LTQKDFDVAATISQIN----
PHS_THEEB       SIAFVNRLVDPAEQAGHHPDLSISWNRVTVCLTTHDVGG-ITQKDIDLAKVISNLAVV--
PHS2_GLOVI      AIAFVNKVAERAETAGHHPDIHIHYNRVRLVLSTHDAGG-VTSKDLEMAAAL--------
PHS_AQUAE       TIFVVNAIASLAEAQWHHPDLEVSFKKVKVKLTTHEAGG-ITERDIKLAKSIDELVKEIL
PHS_CHRVO       TMAFVNALAWIANQEDHHPDMSVHYNRAVVNFSTHDAGG-LTLNDFICAAKTEALFRRP-
PHS_NITEU       TMAFVNAIAWVSHREDHHPDMMVGYDWCRVEYMTHAIGG-LSENDFICAAKVDMLFKS--
PHS_XANAC       TLAFVNALAWIAHREDHHPDLGVHYDRVVVRYSTHDVGG-LSENDFICAAKTAQLYDQGI
PHS_XYLFA       TLAFVNALAFIAHCEDHHPDMSVHYGRAVVCFSTHKIGG-ISENDFICAAKTSALYEQGI
PHS_PSEAE       ALAFTNAVGEISEAEGHHPGLLTEWGKVTVTWWSHSIKG-LHRNDFIMAARTDEVAKTAE
PHS_PSESM       ALAFTNAVGEIAEAEGHHPGLLTEWGKVTVTWWSHSIKG-LHRNDFIMAARTDEVAAKAE
PHS_SHEON       AMAFTNKLAELAEEEFHHPGILTEWGKVTVTWWSHSIKG-LHKNDFIMAAKTDLLLD---
PHS_VIBCH       AWAFSNQIAELAEQEFHNPAILLEWGNVTVTWWSHSIKG-LHKNDFICAAKCDALT----
PHS_VIBPA       AWAFSNKIAELAEEEFHHPSILLEWGKVTVTWWSHSIKG-LHKNDFICASKCDALVLSE-
PHS_CHLTE       ALDFTNRVGQLAEAEGHHPALLTEWGKVTVSWWTHAIGG-IHLNDVIMATKTEKLV----
PHS1_GLOVI      AIAFTVRVGEEAEAEGHHPALLTEWGSVKVSWWTHAIAG-LHRNDFVMAAKTDAIAAQVG
                            .   *:.     :    .    *   * :   *   *           

PHS_MYCLE       -------------
PHS_MYCTU       -------------
PHS_STRAW       AS-----------
PHS_STRCO       AH-----------
PHS_HALSA       -------------
PHS_AGRFC       N------------
PHS_RHIME       PDHM---------
PHS_BRADU       G------------
PHS_BRUME       -------------
PHS_RHILO       -------------
PHS_BORBR       ATGLPARADQPRT
PHS_CAUVC       -------------
PHS_RALSO       AK-----------
PHS_SYNY3       -------------
PHS_PROMM       -------------
PHS_SYNPX       -------------
PHS_PROMA       -------------
PHS_SACS2       S------------
PHS_SULTO       -------------
PHS_NOSS1       -------------
PHS_THEEB       -------------
PHS2_GLOVI      -------------
PHS_AQUAE       KH-----------
PHS_CHRVO       -------------
PHS_NITEU       -------------
PHS_XANAC       TA-----------
PHS_XYLFA       -------------
PHS_PSEAE       GRK----------
PHS_PSESM       GRK----------
PHS_SHEON       -------------
PHS_VIBCH       -------------
PHS_VIBPA       -------------
PHS_CHLTE       -------------
PHS1_GLOVI      AV-----------