CLUSTAL format seed alignment for MF_00435

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ILVC_LEUMM       --------------------MTTKMFYDKDIDTTPLENKKIAVIGYGAQGHAQANNLRDS
ILVC_LEUMC       --------------------MTTKMFYDKDIDTKPLENKKIAVIGYGAQGHAQANNLRVS
ILVC_STAES       ---------------------MTKVYYDETVTQDALQGKKIAVIGYGSQGHAHAQNLKDN
ILVC_STAEQ       ---------------------MTKVYYDETVTQDALQGKKIAVIGYGSQGHAHAQNLKDN
ILVC_STAA1       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAA9       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAB       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAN       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAM       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAW       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAR       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAA2       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAA8       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAE       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAC       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAT       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAA3       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAAS       ---------------------MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDN
ILVC_STAHJ       ---------------------MTKVYYDQSVEKDALQGKKIAIIGYGSQGHAHAQNLKDN
ILVC_STAS1       ---------------------MTTVYYDQSVTKDALQGKKVAIIGYGSQGHAHAQNLKDN
ILVC_LISMF       ---------------------MTKVYYEDAVKNNALEGKTVAVIGYGSQGHAHSQNLRDN
ILVC_LISIN       ---------------------MTKVYYEDAVKNNALEGKTVAVIGYGSQGHAHSQNLRDN
ILVC_LISW6       ---------------------MTKVYYEDAVKNNALEGKTVAVIGYGSQGHAHSQNLRDN
ILVC_LISMO       ---------------------MTKVYYEDAVKNNALEGKTVAVIGYGSQGHAHSQNLRDN
ILVC_STRR6       --------------------MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDS
ILVC_STRPN       --------------------MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDS
ILVC_STRP2       --------------------MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDS
ILVC_STRSV       --------------------MAVTMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDT
ILVC_STRGC       --------------------MAVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDT
ILVC_STRT2       --------------------MAVQMEYEKDVKVPALDGKKIAVIGYGSQGHAHSQNLRDT
ILVC_STRT1       --------------------MAVQMEYEKDVKVPALDGKKIAVIGYGSQGHAHSQNLRDT
ILVC_STRTD       --------------------MAVQMEYEKDVKVPALDGKKIAVIGYGSQGHAHSQNLRDT
ILVC_STRTR       --------------------MAVQMEYEKDVKVPALDGKKIAVIGYGSQGHAHSQNLRDT
ILVC_STRS2       --------------------MTVTMQYEKDVTVAALDGKRIAVIGYGSQGHAHAQNLRDT
ILVC_STRSY       --------------------MTVTMQYEKDVTVAALDGKRIAVIGYGSQGHAHAQNLRDT
ILVC_STRMU       --------------------MAVEMLYEADVKVAALDGKKIAVIGYGSQGHAHAQNLRDS
ILVC_LACLM       --------------------MAVTMYYEEDVEVAALAGKKIAVIGYGSQGHAHAQNLRDS
ILVC_LACLS       --------------------MAVTMYYEEDVEVAALAGKKIAVIGYGSQGHAHAQNLRDS
ILVC_LACLA       --------------------MAVTMYYEDDVEVSALAGKQIAVIGYGSQGHAHAQNLRDS
ILVC_RHIME       ----------------------MRVYYDRDADLNLIKSKKVAIIGYGSQGRAHALNLKDS
ILVC_SINMW       ----------------------MRVYYDRDADLNLIKSKKVAIIGYGSQGRAHALNLKDS
ILVC_RHIEC       ----------------------MRVYYDRDADLNLIKAKKVAVIGYGSQGRAHALNLKDS
ILVC_RHIL3       ----------------------MRVYYDRDADLNLIKAKKVAVIGYGSQGRAHALNLKDS
ILVC_AGRFC       ----------------------MRVYYDRDADLNLIKSKNVVIVGYGSQGRAHALNLKDS
ILVC_RHILO       ----------------------MRVYYDRDADLNLIKGKKVAIIGYGSQGRAHALNLKDS
ILVC_CHESB       ----------------------MRVYYDRDADLNLIKSKKVAIIGYGSQGRAHALNLKDS
ILVC_BRUO2       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_BRUSU       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_BRUC2       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_BRUAB       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_BRUA2       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_BRUME       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_BRUSI       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_OCHA4       ----------------------MRVYYDRDADVNLIKSKKVVIVGYGSQGRAHALNLKDS
ILVC_BART1       ----------------------MRVYYDRDADMNLIKGKKVAIVGYGSQGRAHALNLKDS
ILVC_BARHE       ----------------------MRVYYDRDANVNLIKEKKVAIVGYGSQGRAHALNLRDF
ILVC_BARQU       ----------------------MHVYYDHDANVNLIKGKKVAIVGYGSQGHAHALNLKDS
ILVC_BARBK       ----------------------MRVYYDCDVNVNLIKEKKVAIVGYGAQGHAHALNLKDS
ILVC_RHOPB       ----------------------MRVYYDRDADLNLIKGKKVVIIGYGSQGHAHALNLKDS
ILVC_RHOP5       ----------------------MRVYYDRDADINLIKGKKVVIIGYGSQGHAHALNLKDS
ILVC_RHOP2       ----------------------MRVYYDRDADLNLIKGKKVVIVGYGSQGHAHALNLKDS
ILVC_RHOPS       ----------------------MRVYYDRDADLNLIKGKKVVIVGYGSQGHAHALNLKDS
ILVC_RHOPA       ----------------------MRVYYDRDADLNLIKGKKVAVIGYGSQGHAHALNLKDS
ILVC_BRASO       ----------------------MRVYYDRDADLNLIKGKKVVIVGYGSQGHAHALNLKDS
ILVC_BRASB       ----------------------MRVYYDRDADLNLIKGKKVVIVGYGSQGHAHALNLKDS
ILVC_NITWN       ----------------------MRVYYDRDADLNLIKGKKVVIVGYGSQGHAHALNLKDS
ILVC_NITHX       ----------------------MRVYYDRDADLNLIKGKKVVIVGYGSQGHAHALNLKDS
ILVC_BRADU       ----------------------MRVYYDRDADLNLIKGKKVAIVGYGSQGHAHALNLKDS
ILVC_AZOC5       ----------------------MRVYYDRDADLNLIKGKKVVIVGYGSQGHAHALNLRDS
ILVC_PARL1       ----------------------MRVYYDRDADVNLIKGKKVAIIGYGSQGHAHALNLRDS
ILVC_MAGSA       ----------------------MRVYYDRDADVNLIKGKKVVVVGYGSQGHAHALNLRDS
ILVC_PHAMO       ----------------------MRVYYDRDADVNLIKSKKVAVIGYGSQGHAHVLNLRDS
ILVC_RHORT       ----------------------MRVYYDRDADVNLIKGKKVAVVGYGSQGHAHVLNLRDS
ILVC_GRABC       ----------------------MRVYYDRDADLNLIKGKKVAVIGYGSQGHAHVLNMRDS
ILVC_ACICJ       ----------------------MRVYYDSDADVNLIKAKKVAVVGYGSQGHAHALNLKES
ILVC_GLUDA       ----------------------MRVYYDRDADVNLIKSKKVAIIGYGSQGHAHANNLKDS
ILVC_GLUOX       ----------------------MRVYYDRDADLNLIKSKKVAIIGYGSQGHAHANNLKDS
ILVC_CAUSK       ----------------------MRVYYDRDADLARILDKKIAIVGYGSQGHAHALNLRDS
ILVC_CAUVC       ----------------------MRVYYDRDADLARILDRKIAIVGYGSQGHAHALNLRDS
ILVC_RHOS1       ----------------------MRVYYDRDCDINLIKDKKVAILGYGSQGHAHALNLRDS
ILVC_RHOS4       ----------------------MRVYYDRDCDINLIKDKKVAILGYGSQGHAHALNLRDS
ILVC_RHOS5       ----------------------MRVYYDRDCDINLIKDKKVAILGYGSQGHAHALNLRDS
ILVC_PARDP       ----------------------MRVYYDRDCDVNLIKDKKIAMLGYGSQGHAHALNLRDS
ILVC_DINSH       ----------------------MRVYYDRDCDVNLIKDKKVAILGYGSQGHAHALNLRDS
ILVC_ROSDO       ----------------------MRVYYDRDCDVNLIKDMKVAILGYGSQGHAHALNLRDS
ILVC_JANSC       ----------------------MRVYYDRDCDVNLIKDMKVAILGYGSQGHAHALNLRDS
ILVC_RUEPO       ----------------------MRVYYDRDCDINLIKDKKVAILGYGSQGHAHALNLRDS
ILVC_RUEST       ----------------------MRVYYDRDCDVNLIKEKKVAILGYGSQGHAHALNLRDS
ILVC_ERYLH       ----------------------MKVYYDADADLGLITDKKIAVLGYGSQGHAHAQNLRDS
ILVC_NOVAD       ----------------------MKVYYDADCDLNLITDKKIAILGYGSQGHAHAQNLRDS
ILVC_SPHAL       ----------------------MQVYYDRDADQDLIKGKKVAVVGYGSQGHAHAQNMRDS
ILVC_SPHWW       ----------------------MRVYYDRDADIGLIKTKKVAIVGYGSQGHAHAQNLQDS
ILVC_ZYMMO       ----------------------MKVYYDSDADLGLIKSKKIAILGYGSQGHAHAQNLRDS
ILVC_PELUB       ------------------------MFYEKDADVDLIKSKKIAIFGYGSQGHAHALNLKDS
ILVC_HYPNA       ----------------------MKIYYEKDADISLIQKLKVAVVGYGSQGHAHALNLKDS
ILVC_GEOUR       ----------------------MKIYYDKDCNLSLLKGKKVAIIGYGSQGHAHANNLKDS
ILVC_GEOMG       ----------------------MKIYYDKDCNMGVLKGKKVAIIGYGSQGHAHANNLKDS
ILVC_GEOSL       ----------------------MKIYYDKDCNQSVLKGKRVAVIGYGSQGHAHANNLKDS
ILVC_PELPD       ----------------------MKVYYDKDCNLAVLKNKTVAIIGYGSQGHAHALNLNDS
ILVC_MAGMM       ----------------------MKVYYDSDADLGLIQSKKVAIIGYGSQGHAHALNLKDS
ILVC_METCA       ----------------------MQIYYDKDADLSIIQGKKVAIIGYGSQGHAHANNLKDS
ILVC_NITOC       ----------------------MNIYYDKDCDLSLIQGMRVAIIGYGSQGHAHANNLKDS
ILVC_VESOH       ----------------------MNIYYDKNADLNIIKDMKVAIVGYGSQGHAHANNLRDS
ILVC_RUTMC       ----------------------MNRYYDKNADLNIIKGMKVSIIGYGSQGHAHANNLKDS
ILVC_ALKEH       ----------------------MQVYYDKDADLSIIQGKKVAVIGYGSQGHAHANNLKES
ILVC_HALHL       ----------------------MKVYYDQDADLSRITSRRVAIIGYGSQGHAHANNLKES
ILVC_NITEU       ----------------------MKVYYDKDADLSLIKKKKVAIIGYGSQGHAHANNLNDS
ILVC_NITEC       ----------------------MKVYYDKDADLSLIKKKKIAIIGYGSQGHAHANNLNDS
ILVC_NITMU       ----------------------MNVYYDKDADLSLIRDKKVTIVGYGSQGHAHANNLSDS
ILVC_CUPMC       ----------------------MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDS
ILVC_CUPNH       ----------------------MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDS
ILVC_CUPPJ       ----------------------MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDS
ILVC_RALSO       ----------------------MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLNDS
ILVC_BURM7       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURPS       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURP1       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURP0       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURM9       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURMS       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURMA       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURP6       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURTA       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURCH       ----------------------MNVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURVG       ----------------------MNVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURCA       ----------------------MNVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURCM       ----------------------MNVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_BURL3       ----------------------MNVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKDS
ILVC_PARXL       ----------------------MKVFYDKDADLSLIKGKQVTIIGYGSQGHAHALNLKES
ILVC_POLAQ       ----------------------MKVFYDKDADLSLIKGKKVTIIGYGSQGHAHALNLKDS
ILVC_JANMA       ----------------------MKVFYDKDCDLSLIKGKNVAIIGYGSQGHAHAQNLNDS
ILVC_HERAR       ----------------------MKVFYDKDCDLSLIKGKNVAIIGYGSQGHAHAQNLNDS
ILVC_POLNA       ----------------------MKVFYDKDCDLSLIKGKTVAIIGYGSQGHAHAQNLNDS
ILVC_POLSJ       ----------------------MKVFYDKDCDLSLIKGKTVAIIGYGSQGHAHAQNLNDS
ILVC_RHOFT       ----------------------MKVFYDKDCDLSLIKGKTVAIIGYGSQGHAHAQNLNDS
ILVC_METPP       ----------------------MKVYYDKDADLSLIKGKSVAIIGYGSQGHAHAQNLNDS
ILVC_BORBR       ----------------------MKVFYDKDCDLSLVKGKTVAIIGYGSQGHAHALNLHDS
ILVC_BORPA       ----------------------MKVFYDKDCDLSLVKGKTVAIIGYGSQGHAHALNLHDS
ILVC_BORPE       ----------------------MKVFYDKDCDLSLVKGKTVAIIGYGSQGHAHALNLHDS
ILVC_BORA1       ----------------------MKVFYDKDCDLSLVKGKTVAIIGYGSQGHAHALNLHES
ILVC_CHRVO       ----------------------MKVYYDKDADLSIIKGKKVAIIGYGSQGHAHAQNLKES
ILVC_METFK       ----------------------MKVYYDKDADLSLIKKLKVTIVGYGSQGHAHAQNLKDS
ILVC_AZOSB       ----------------------MKVYYDKDADLSLIKGKKVTIVGYGSQGHAHAQNLNDS
ILVC_DECAR       ----------------------MKVYYDKDADLSLIKGKKVTIVGYGSQGHAHAQNLKDS
ILVC_AROAE       ----------------------MKVYYDKDADLSLIKGKQITIVGYGSQGHAHAQNLKDS
ILVC_ACIAC       ----------------------MKVFYDKDCDLSLIKGKTVAIIGYGSQGHAHAQNLNDS
ILVC_ACISJ       ----------------------MKVFYDKDCDLSLIKGKTVAIIGYGSQGHAHAQNLNDS
ILVC_NEIMF       ----------------------MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDS
ILVC_NEIMB       ----------------------MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDS
ILVC_NEIM0       ----------------------MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDS
ILVC_NEIMA       ----------------------MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDS
ILVC_NEIG1       ----------------------MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDS
ILVC_PSEAB       ----------------------MRVFYDKDCDLSIIQGKKVAIIGYGSQGHAHACNLKDS
ILVC_PSEAE       ----------------------MRVFYDKDCDLSIIQGKKVAIIGYGSQGHAHACNLKDS
ILVC_PSEA7       ----------------------MRVFYDKDCDLSIIQGKKVAIIGYGSQGHAHACNLKDS
ILVC_PSEU5       ----------------------MKVSYDKDCDLSIIQGKKVAIIGYGSQGHAHACNLKDS
ILVC_PSEU2       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSE14       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSESM       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSEMY       ----------------------MKVYYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSEPF       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSEF5       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSEPK       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSEP1       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSEPG       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_PSEE4       ----------------------MKVFYDKDCDLSIIQGKKVAIIGYGSQGHAQACNLKDS
ILVC_ALCBS       ----------------------MQVYYDKDCDLSIIQGKKVAILGYGSQGHAHACNLKDS
ILVC_MARHV       ----------------------MQVYYDKDCDLSIIQGKKVAILGFGSQGHAHACNLKDS
ILVC_HAHCH       ----------------------MQVYYDKDCDLSIIQGKKVAIIGYGSQGHAHANNLKDS
ILVC_SACD2       ----------------------MQVYYDKDCDLSIIQGKKVAIIGYGSQGHAHACNLKDS
ILVC_HYDCU       ----------------------MQVYYDKDCDLSIIQGMKVAIIGFGSQGHAHAANLQDS
ILVC_PSYCK       ----------------------MNVYYDKDCDLSIVQGKKVAIIGYGSQGHAHALNLQDS
ILVC_PSYA2       ----------------------MNVYYDKDCDLSIVQGKKVAIIGYGSQGHAHALNLQDS
ILVC_PSYWF       ----------------------MNVYYDKDCDLSIIQAKKVAIIGYGSQGHAHALNLQDS
ILVC_ACIAD       ----------------------MQIFYDKDCDLSIIQGKKVAIIGYGSQGHAHALNLKDS
ILVC_THIDA       ----------------------MKVYYDKDADLSLIKQRKVAIVGYGSQGHAHANNLKDS
ILVC_CHRSD       ----------------------MRVYYDKDCDLSLIQAKNVTIVGYGSQGHAHAHNLKES
ILVC_PRB01       ----------------------MKIYYDEDANIEIIKGMNVSIIGYGSQGNAHANNLHES
ILVC_ARCB4       --------------------MAINVFYDKDCNIDLIKSKKVAMIGFGSQGHAHAENLRDS
ILVC_SULDN       ----------------------MTVYYDKDCNINLIKSKKVAMIGFGSQGHAHAENLRDS
ILVC_NITSB       --------------------MALPIYYDKDCDINLIKSKKVAIIGFGSQGHAHAENLRDS
ILVC_HELHP       --------------------MALKVYYDKDCDLGLIQKKKVAVIGFGSQGHAHAENLRDS
ILVC_WOLSU       --------------------MALSVYYDKDCNLDLIRSKKVAVVGFGSQGHAHAENLRDS
ILVC_CAMC5       --------------------MAVNIYYDKDCDLSLIQSKKVAIVGFGSQGHAHAENLRDS
ILVC_CAMC1       --------------------MAINVYYDKDCDLSLIQSRKVAIIGFGSQGHAHAENLRDN
ILVC_CAMFF       --------------------MAITVYYDKDCDLSLIRSKKVAIIGFGSQGHAHAENLRDS
ILVC_CAMHC       --------------------MAVTVYYDKDCDLSLIRSKKVAMIGFGSQGHAHALNLRDS
ILVC_CAMJ8       --------------------MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDN
ILVC_CAMJJ       --------------------MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDN
ILVC_CAMJR       --------------------MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDN
ILVC_CAMJE       --------------------MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDN
ILVC_CAMJD       --------------------MAITVYYDKDCDLNLIQSKKVAIIGFGSQGHAHAMNLRDN
ILVC_MYCSK       --------------------MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_MYCSJ       --------------------MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_MYCSS       --------------------MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_MYCVP       --------------------MAVEMFYDADADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_MYCGI       --------------------MAVEMFYDADADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_MYCS2       --------------------MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_NOCFA       --------------------MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_RHOJR       --------------------MAVEMFYDDDADLSIIQGRKVAVIGYGSQGHAHSLSLRDS
ILVC_MYCPA       ------------------------MFYDDDADLTIIQGRKVGVIGYGSQGHAHSLSLRDS
ILVC_MYCA1       ------------------------MFYDDDADLTIIQGRKVGVIGYGSQGHAHSLSLRDS
ILVC_MYCAV       ------------------------MFYDDDADLTIIQGRKVGVIGYGSQGHAHSLSLRDS
ILVC_MYCUA       ------------------------MFYDDDADLSIIEGRKVGVIGYGSQGHAHSLSLRDS
ILVC_MYCLE       ------------------------MFYDDNADLSIIQRRKVGVIGYGSQGYAHSLSLRDS
ILVC_MYCBP       --------------------MALEMFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDS
ILVC_MYCTA       --------------------MALEMFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDS
ILVC_MYCTU       --------------------MALEMFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDS
ILVC_MYCBO       ------------------------MFYDDDADLSIIQGRKVGVIGYGSQGHAHSLSLRDS
ILVC_CORGL       --------------------MAIELLYDADADLSLIQGRKVAIVGYGSQGHAHSQNLRDS
ILVC_CORGB       --------------------MAIELLYDADADLSLIQGRKVAIVGYGSQGHAHSQNLRDS
ILVC_COREF       --------------------MAIELFYDADADLSIIQGRKVAIIGYGSQGHAHAQNLRDS
ILVC_CORJK       --------------------MAIDVFYDDDADLSIIQGRKVAIIGYGSQGHAHAQNLRES
ILVC_CORDI       --------------------MAIELLYDADADLSIIQGRKVAVIGYGSQGHAHAQCLRDS
ILVC1_STRCO      ---------------------MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDS
ILVC2_STRCO      ---------------------MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDS
ILVC_STRAW       ---------------------MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDS
ILVC_SALAI       --------------------MSVEVFYDDDADLGLIQGRTVAVIGYGSQGHAHALSLRDS
ILVC_SALTO       --------------------MSVEVFYDDDADLGLIQGRTVAVIGYGSQGHAHALSLRDS
ILVC_SACEN       --------------------MATEIFYDADADLGIIQGRKVAVIGYGSQGHAHALSLRDS
ILVC_FRAAA       ---------------------MVEIYYDDDASLDVLAGRKVAVIGYGSQGHAHALNLRDS
ILVC_FRACC       ---------------------MVEIYYDDDASLDVLADRKVAVIGYGSQGHAHALNLRDS
ILVC_THEFY       --------------------MAAQMYYDDDADLNIIQGRTVAVIGYGSQGHAHALSLRDS
ILVC_CLAMS       ---------------------MTDIVYDKDADLSLIQGRKVAVIGYGSQGHAHALNLRDS
ILVC_CLAM3       ---------------------MTDIVYDKDADLSLIQGRKVAVIGYGSQGHAHALNLRDS
ILVC_LEIXX       ---------------------MAEIYYDNDADLSIIQGKKVAVIGYGSQGHAHAQNLRDS
ILVC_ARTS2       ---------------------MTEMFYDDDADLSIIQGRKVAIVGYGSQGHAHALNLRDS
ILVC_RENSM       ---------------------MTELFYDDDADLSIIQGRTVAVIGYGSQGHAHALSLRDS
ILVC_KINRD       ---------------------MAEMFYDDDADLSTITGKKVAVLGFGSQGHAHALSLRDS
ILVC_CUTAK       ---------------------MAKIYYDDDADLSIIQNRQVAVIGYGSQGHAHALNLRDS
ILVC_TROW8       -----------------MSEIGTRVYTECDADLSLIQNVLVAVIGYGSQGHAQALNLRDS
ILVC_TROWT       -----------------MSEIGTRVYTECDADLSLIQNVLVAVIGYGSQGHAQALNLRDS
ILVC1_BIFLO      --------------------MAAQIWYENDGDLSVLEGKKVAIIGYGSQGHAHALNLRDS
ILVC2_BIFLO      --------------------MAATIWYEKDADLSVFDGKKVAILGYGSQGHAHALNLRDS
ILVC_XYLFA       ----------------MVNVSITTDYSRMLFMRNTTSTLKIAIIGYGSQGRAHALNLRDS
ILVC_XYLFT       ----------------MVNVSITTDYSRMLFMRNTKSTLKIAIIGYGSQGRAHALNLRDS
ILVC_XANAC       --------------------------------MSNHTQPKIAIIGYGSQGRAHALNLRDS
ILVC_XANC5       --------------------------------MSNDTQPKIAIIGYGSQGRAHALNLRDS
ILVC_XANOM       --------------------------------MSNDTQPKIAIIGYGSQGRAHALNLRDS
ILVC_XANOR       --------------------------------MSNDTQPKIAIIGYGSQGRAHALNLRDS
ILVC_XANCP       --------------------------------MSNDTQPTIAIIGYGSQGRAHALNLRDS
ILVC_XANC8       --------------------------------MSNDTQPTIAIIGYGSQGRAHALNLRDS
ILVC_CHLPM       ----------------------MNVYYEQDADLGYLQGKNIAVLGYGSQGHAHALNLKES
ILVC_CHLPD       ----------------------MNVYYEQDADLGFLQGKNIAVLGYGSQGHAHALNLKDS
ILVC_CHLCH       ----------------------MNVYYEKDADLAYLQGKKIAVLGYGSQGHAHSLNLHES
ILVC_PELLD       ----------------------MNVYYEQDADLGRLQGKNIAVLGYGSQGHAHALNLKDS
ILVC_CHLTE       ----------------------MNIYYEQDADLAVLQNKNIAILGYGSQGHAHALNLKDS
ILVC_SALRD       ----------------------MDVHY--DADPALIHDKQVAVIGYGSQGHAHALNLHDS
ILVC_NATPD       -------------------MTDATIYYDDDAESTVLDDKTVAVLGYGSQGHAHAQNLDDS
ILVC_HALMA       ----------------MSDELTTTVYYDEDADVSTINDETVAVLGYGSQGHAHALNLHES
ILVC_DESVV       ----------------------MKVYYEKDANLEALKGKTVAIIGYGSQGHAHAQNLRDS
ILVC_DESVH       ----------------------MKVYYEKDANLEALKGKTVAIIGYGSQGHAHAQNLRDS
ILVC_DESAG       ----------------------MKVYYEQDANLEVLKGKTVAIIGYGSQGHAHAQNLRDS
ILVC_RHOBA       --------------------MAATIYYENDADLSHLKGKKVAILGYGSQGHAQAQNLRDS
ILVC1_BACC1      ---------------------MAKVYYEKDVTVNVLKEKKVAIIGYGSQGHAHAQNLRDN
ILVC1_BACCZ      ---------------------MAKVYYEKDVTVNVLKEKKVAIIGYGSQGHAHAQNLRDN
ILVC1_BACHK      ---------------------MAKVYYEKDVTVNVLKEKKVAIIGYGSQGHAHAQNLRDN
ILVC1_BACAN      ---------------------MAKVYYEKDVTVNVLKEKKVAIIGYGSQGHAHAQNLRDN
ILVC1_BACCR      ---------------------MAKVYYEKDVTVNVLKEKKVAIIGYGSQGHAHAQNLRDN
ILVC_BACCN       ---------------------MAKVYYEKDVMVNVLKGKKVAIVGYGSQGHAHAQNLRDN
ILVC_OCEIH       ---------------------MAKVLYEKDIQDGVLKNKKIAVIGYGSQGHAHAMNLRDS
ILVC_BACVZ       ---------------------MVKVYYNGDIKENVLAGKKVAIIGYGSQGHAHALNLKES
ILVC_BACSU       ---------------------MVKVYYNGDIKENVLAGKTVAVIGYGSQGHAHALNLKES
ILVC_BACLD       ---------------------MVKVYYNGDIKENVLAGKKVAVIGYGSQGHAHALNLKES
ILVC_BACP2       ---------------------MVKVYYNGDIQENVLNGQKVAIIGYGSQGHAHALNLKES
ILVC_GEOKA       ---------------------MAKVYYNGDANEQYLQGKTVAIIGYGSQGHAHAQNLRDS
ILVC_GEOTN       ---------------------MAKVYYNGDANEQYLQGKTVAIIGYGSQGHAHAQNLRDS
ILVC_BACSK       ---------------------MAKVYYNGDVNEQVLEGKTVAIVGYGSQGHAHAQNLRES
ILVC_BACHD       ---------------------MAKVFYNGDINEGVLQGKTVAIIGYGSQGHAHAQNLRDS
ILVC2_BACAN      ----------------------MKTYYEQDANVGLLQGKTVAVIGYGSQGHAQAQNLRDS
ILVC2_BACHK      ----------------------MKTYYEQDANVGLLQGKTVAVIGYGSQGHAQAQNLRDS
ILVC2_BACCR      ----------------------MKTYYEKDANVELLQGKTVAVVGYGSQGHAQAQNLRDS
ILVC2_BACCZ      ----------------------MKTYYEKDANVDLLQGKTVAVVGYGSQGHAQAQNLRDS
ILVC2_BACC1      ----------------------MKTYYEKDANVELLKGKTVAVIGYGSQGHAQAQNLRDS
ILVC_CALS4       ---------------------MAKMYYDQDADAEVLKGKKIAVIGFGSQGHAHALNLRDS
ILVC_CALS8       ---------------------MAKIFYDQDCNLDLLKDKTVAVIGFGSQGHAHALNLRDS
ILVC_CLOB8       ---------------------MPKMYYEKDTDLNLLRGKKVAIIGYGSQGHAHALNLHES
ILVC_ALKMQ       ---------------------MAKLYYEKDCNLEVLKGKKVAIIGYGSQGHAHALNLKNS
ILVC_CLONN       ---------------------MAKVYYDEDANLELLRGKTVAIIGYGSQGHAHALNLKDS
ILVC_CLOAB       -------------------MEELKVYYDEDADLNYLKDKKIAIIGFGSQGHAHALNLKES
ILVC_LACP7       ---------------------MAKIYYQQDCNLSLLEGKTVAVIGYGSQGHAHALNMKES
ILVC_HUNT2       ---------------------MAKIYYDSDCNLGLLKGKTVAIIGYGSQGHAHAQNLRDS
ILVC_THEMA       ---------------------MAVIYYDKDADLNLIKDKKIAIIGYGSQGHAHALNLKDS
ILVC_THEP1       ---------------------MAVIYYDKDADLELIRDKKIAIIGYGSQGHAHALNLKDS
ILVC_AQUAE       ---------------------MAKIYYDEDASLDILKDKVIAILGYGSQGHAHALNLRDS
ILVC_PETMO       ---------------------MVETFYEKDADLGLLKEKTIAVLGYGSQGHAQAQNLKDS
ILVC_DESHY       ---------------------MAKMYYDSDASLELLQGKTIAVMGYGSQGHAQAQNLKDS
ILVC_DESRM       ---------------------MVKVYYDADANLEFLKGKKIAVLGYGSQGHAQAQSLRDS
ILVC_CARHZ       ---------------------MKKVYYDQDANLELLREKKIAIIGYGSQGHAQAQNLKDS
ILVC_SYNWW       ---------------------MARMFYDADANLENLKGKTIAVMGFGSQGHAQAQNLKES
ILVC_MOOTA       ---------------------MAVVYYDQDADLNVLKGKKIAVMGYGSQGHSQAQNLKDS
ILVC_DEHMC       ---------------------MAVIYYDKDCDLSLIEKKLIGIVGYGAQGHAHAQNLRDS
ILVC_DEHMB       ---------------------MAVIYYDKDCDLSLIEKKLIGIVGYGAQGHAHAQNLRDS
ILVC_DEHM1       ---------------------MAVIYYDKDCDLSLIEKKIIGIVGYGAQGHAHAQNLRDS
ILVC_METST       ----------------------MKVLYDDDVNTNVLENKTIAVIGYGSQGRGQSLNMHDS
ILVC_METS3       ----------------------MKMYYESDVNTDALEGKTVAVMGYGSQGRAQSRNMADS
ILVC_METTH       ----------------------MKIYYENDIDMEILADKKIAVIGYGSQGEAQARNMADS
ILVC_METM5       ----------------------MKVFYDSDFKLDALKEKTIAVIGYGSQGRAQSLNMKDS
ILVC_METM7       ----------------------MKVFYDSDFKLDALKEKTIAVIGYGSQGRAQSLNMKDS
ILVC_METMP       ----------------------MKVFYDSDFKLDALKEKTIAVIGYGSQGRAQSLNMKDS
ILVC_METVS       ----------------------MKVFYDADIKLDALKSKTIAVIGYGSQGRAQSLNMKDS
ILVC_METJA       ---------------------MVKIFYDKDVTFDAVKDKTIAVIGYGSQGRAQALNMKDS
ILVC_PYRIL       ---------------------MAKIYTDKDASLEPLKGKTIAVIGYGIQGRAQALNLRDS
ILVC_PYRAE       ---------------------MAKIYTDREASLEPLKGKTIAVIGYGIQGRAQALNLRDS
ILVC_PYRCJ       ---------------------MAKIYRDGDASLDWLKGKTIAVIGYGIQGRAQALNLRDS
ILVC_PYRAR       ---------------------MAKIYRDVDASLEPLKGKTIAVIGYGIQGRAQALNLRDS
ILVC_PYRAB       ------------------MVKVVKVYYDDEVSMDILKDKTVAVIGYGNQGEAQAKNMRDS
ILVC_PYRFU       ------------------MVRVVKVWYDNEVSMDILKDKTVAVIGYGSQGEAQAKNMRDS
ILVC_SULTO       ---------------------MAKVYIDKDASLDPIKDKTIAVLGYGSQGRAWALNLRDS
ILVC_SULAC       ---------------------MAKIYTDKDVSLDVIKEKRVAVLGYGSQGRAWALNLRDS
ILVC_SACS2       ------------------MKCTSKIYTDNDANLDLIKGKRIAVLGYGSQGRAWAQNLRDS
ILVC_METKA       ---------------------MAKIYGDEDASLEPLEDKTVAVIGYGSQGEAQAKNLRDS
ILVC_METAC       ---------------------MATIIYDNETTFDALKDKTIAIMGYGSQGHAHARNLHES
ILVC_METMA       ---------------------MATIIYDDETTFDALKDRTIAVMGYGSQGHAHARNLHES
ILVC_METBF       ---------------------MAKIIYDNETTFDALKDKTIAIMGYGSQGHAHARNLHES
ILVC_METBU       ---------------------MVEMFYDKDADLGALKGKIIAVMGYGSQGHAQAQNLHDS
ILVC_METAR       ---------------------MATIYYEKDADLKILKGKKIAIIGYGSQGMAQSQSLKDS
ILVC_METTP       ---------------------MATIYRDKDADLRVLKDKTIAIIGYGNQGHAQGANLKDS
ILVC_ARCFU       ---------------------MAKIYRDADADLKYLDGKTVCIIGYGSQGHAHALNLKDS
ILVC_METB6       ---------------------MMKKYYESDADLSVLSGKKIAVIGYGSQGRGQSLNLRDS
ILVC_METLZ       ---------------------MMEKYHETDADLKDLSGKTIAVIGYGSQGRGQSRNLKDS
ILVC_METHJ       ---------------------MLEKYYDKDADMSAISSKTIAVIGYGSQGRGQALNLKDS
ILVC_METMJ       ---------------------MVQKYYESDADPRTLEDKTIAVIGYGSQGRGQALNLRDS
ILVC_KORVE       ---------------------MAKVYHDSSADLSIIRGKKVGIVGYGSQGHAHALNLVDS
ILVC_SORC5       ---------------------MAKIFYDNDADLSLIQSKKVAIVGYGSQGHAHALNLRDS
ILVC_CHLAA       ---------------------MAELYYDNQADLNRLKNKPIAIIGFGSQGHAHARNLADS
ILVC_ROSCS       ---------------------MANIYYENHADLARLAGRTIAVIGFGSQGHAHALNLKES
ILVC_SOLUE       ---------------------MPNRYYEKDGNLDFLAGRTVAIIGYGSQGHAHALNLRDS
ILVC_SYNJA       ---------------------MARLYYDTDANLDLLDGKTVAIIGYGSQGHAHALNLRDS
ILVC_SYNJB       ---------------------MARLYYDTDANLEPLADKTVAIIGYGSQGHAHALNLRDS
ILVC_NOSS1       ---------------------MARMYYDEDANLDLLAGKTIAIIGYGSQGHAHALNLKDS
ILVC_TRIV2       ---------------------MARMYYDEDANLDLLAGKTIAIIGYGSQGHAHALNLKDS
ILVC_MICAN       ---------------------MARMYYDEDANLDLLAGKTIAIIGYGSQGHAHALNLKDS
ILVC_TRIEI       ---------------------MARMYYDSDANLDILNDKTIAIIGYGSQGHAHALNLKDS
ILVC_SYNY3       ---------------------MARMYYDQDANLDLLAGKTVAIIGYGSQGHAHALNLKDS
ILVC_ACAM1       ---------------------MARLYYDADANLDLLANKTVAIIGYGSQGHAHALNLKDS
ILVC_THEEB       ---------------------MARMYYDADAQLELLKDKTIAIIGYGSQGHAHALNLRDS
ILVC_SYNE7       ---------------------MARMYYDADANLDLLNGKTVAIIGYGSQGHAHALNLRDS
ILVC_SYNP6       ---------------------MARMYYDADANLDLLNGKTVAIIGYGSQGHAHALNLRDS
ILVC_GLOVI       -------------------MTRARMYYDEDADLSVLDNKTIAIVGYGSQGHAHALNLKDS
ILVC_SYNPW       ---------------------MAQLFYDTDADLSLLSGKTVAIVGYGSQGHAHALNLKDS
ILVC_SYNR3       ---------------------MATLYYDTDADLGLLSGKTVAIIGYGSQGHAHALNLKDS
ILVC_PROM3       ---------------------MAQLFYDSDADLSLLNGKTVAIVGYGSQGHAHALNLKDS
ILVC_PROMM       ---------------------MAQLFYDSDADLGLLNGKTVAIIGYGSQGHAHALNLKDS
ILVC_SYNSC       ---------------------MAQLFYDSDADLGLLNGKTVAIIGYGSQGHAHALNLKDS
ILVC_SYNPX       ---------------------MAQLFYDSDADLGLLNSKTVAIIGYGSQGHAHALNLKDS
ILVC_SYNS9       ---------------------MAQLFYDSDADLGLLNGKTVAIIGYGSQGHAHALNLKDS
ILVC_SYNS3       ---------------------MAQLFYDSDADLSLLSGKTVAIIGYGSQGHAHALNLKDS
ILVC_PROM1       ---------------------MAKLFYDSDADLGLLQDKTVAIIGYGSQGHAHALNLKDS
ILVC_PROMT       ---------------------MAKLFYDSDADLGLLQDKTVAIIGYGSQGHAHALNLKDS
ILVC_PROMA       ---------------------MAKLFYDSDADLQLLSQKTVAIIGYGSQGHAHALNLKDS
ILVC_PROMS       ---------------------MTQLFYDTDADLSLLNNKTIAIIGYGSQGHAHALNLKDS
ILVC_PROM2       ---------------------MTQLFYDTDADLSLLNNKTIAIIGYGSQGHAHALNLKDS
ILVC_PROM0       ---------------------MTQLFYDTDADLSLLNNKTIAIIGYGSQGHAHALNLKDS
ILVC_PROM9       ---------------------MTQLFYDTDADLSLLNKKTIAIIGYGSQGHAHALNLKDS
ILVC_PROM5       ---------------------MTQLFYDTDADLSLLNNKTIAIIGYGSQGHAHALNLKDS
ILVC_PROMP       ---------------------MTQLFYDTDADLSLLKNKTIAIIGYGSQGHAHALNLKDS
ILVC_ANADE       ---------------------MATIYYDKDANLDLLKKRKVAIIGYGSQGHAHALNLRDS
ILVC_THET2       ----------------------MKIYYEHDADLGFILGKKVAVLGFGSQGHAHALNLKDS
ILVC_THET8       ----------------------MKIYYEHDADLGFILGKKVAVLGFGSQGHAHALNLKDS
ILVC_RUBXD       ----------------------MARVYREGDIGNEIAQKRIAVLGFGSQGHAHALNLRDS
ILVC_DEIGD       --------------------MAATMYYDRDVSLSPIEDKLIAIIGYGSQAHAHAQNLRDS
ILVC_DEIRA       --------------------MSAKMYYDRDVDTQVLENKLIAIIGYGSQAHAHAQNLRDS
ILVC_LEPBL       ---------------------MANIYYDADCDLSSLKGKTIAVIGYGSQGHAQAQNMKDS
ILVC_LEPBJ       ---------------------MANIYYDADCDLSSLKGKTIAVIGYGSQGHAQAQNMKDS
ILVC_LEPIC       ---------------------MANIYYDSDCDLNSLKGKTIAVIGYGSQGHAQAQNMKDS
ILVC_LEPIN       ---------------------MANIYYDSDCDLNSLKGKTIAVIGYGSQGHAQAQNMKDS
ILVC_CLOD6       ---------------------MARMYYEKDVDLEVLKNKKVAVLGYGSQGHAHAQNLRDN
ILVC_TREPR       ----------------------MRVLYERDGDVSIIRERVVAVVGYGSQGRAHAMNLRDS
ILVC_HELPH       --------------------MALPVYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDS
ILVC_HELPJ       --------------------MALPVYYDKDIDLGVIQSLQVGIIGYGVQGEAQALNLRDS
ILVC_HELPY       --------------------MALPVYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDS
ILVC_HELAH       --------------------MALSVYYDKDIDLGVIQSLQVGIIGYGTQGEAQALNLRDS
ILVC_ECOK1       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECOUT       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECO24       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECOL5       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECOL6       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SHIDS       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SHIBS       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SHISS       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SHIFL       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECOLC       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECOLI       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECOHS       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ECO57       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SALCH       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SALPB       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SALTI       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SALPA       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SALTY       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SALAR       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_KLEP7       -MANYFNTLNLRQQLAQLGKCRFMARDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_CITK8       -MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ENT38       -MANYFNTLNLRQQLAQLGKCRFMARDEFADGASYLQGKKVVIVGCGAQGLNQGLNMRDS
ILVC_CROS8       -MANYFNTLNLRQQLAQLGKCRFMARDEFADGAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_YERP3       -MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_YERPS       -MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_YERPA       -MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_YERPP       -MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_YERPN       -MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_YERPE       -MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_YERE8       -MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SERP5       -MANYFNTLNLRQQLAQLGKCRFMAREEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_PECAS       -MANYFNTLNLRQQLDQLGKCRFMGRDEFADEASYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_PHOLL       -MANYFNTLNLRQQLAQLGKCRFMAREEFVDETGYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SODGM       -MANYFNTLNLRQQLAQLGKCRFMSRDEFVDEADYLKGKKVVIIGCGAQGLNQGLNMRDS
ILVC_AERHH       -MANYFNTLNLRQQLAQLGKCRFMQREEFADGCNVLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_AERS4       -MANYFNTLNLRQQLAQLGKCRFMQRAEFADGCDVLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_HAEIE       -MANYFNTLNLRQKLDQLGRCRFMDREEFADEANFLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_HAEIN       -MANYFNTLNLRQKLDQLGRCRFMDREEFADEANFLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_HAEI8       -MANYFNTLNLRQKLDQLGRCRFMDREEFADEANFLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_HAEIG       -MANYFNTLNLRQKLDQLGRCRFMDREEFADEANFLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_PASMU       -MANYFNTLNLRQQLDQLGRCRFMDRNEFANEADYLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_MANSM       -MSNYFNTLNLRQKLDQLGRCRFMERSEFADGCNFLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_ACTSZ       -MSNYFNTLNLREKLDQLGRCRFMDRSEFSDGCNFLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_ACTP2       -MANYFNTLNLRQKLDQLGRCRFMDRNEFADGCNFLKGKKIVIVGCGAQGLNQGLNMRDS
ILVC_HISS2       -MGNYFNTLNLRQQLDQLGRCRFMDREEFADEVNFLKGKKIVIIGCGAQGLNQGLNMRDS
ILVC_HAES1       -MGNYFNTLNLRQQLDQLGRCRFMEREEFADGVNFLKGKKIVIIGCGAQGLNQGLNMRDS
ILVC_VIBVY       -MANYFNTLNLREQLDQLGRCRFMDRSEFATEADYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_VIBVU       -MANYFNTLNLREQLDQLGRCRFMDRSEFATEADYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_VIBPA       -MANYFNTLNLREQLDQLGRCRFMDREEFVSEADYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_ALIF1       -MSNYFNTLNLREQLDQLGRCRFMDREEFATEADYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_VIBCH       -MANYFNTLNLREQLDQLGRCRFMAREEFATEADYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_VIBC3       -MANYFNTLNLREQLDQLGRCRFMAREEFATEADYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_PHOPR       -MANYFNTLNLRQQLDQLGRCRFMDRNEFATEADYLKGKKVVIVGCGAQGLNQGLNMRDS
ILVC_SHEON       -MANYFNSLNLRQQLAQLGQCRFMDRSEFSDGCNYIKDWNIVILGCGAQGLNQGLNMRDS
ILVC_BUCAI       --MNYFNTLNFTQKINQINKCRFMKKEEFNKKNDILKNKNIVIVGCGAQGLNQGLNMRDA
ILVC_BUCDN       --MNYFNTLNFRQKINQIKKCRFMEKKEFNKKNEILKNKKIVIVGCGSQGLNQGLNMRDS
ILVC_BUCAP       --MNYFNKLCFRKRINEIKKCRFMKENEFKNENKILKNKKIVIVGCGSQGLNQALNMRDS
ILVC_BUCMH       -MKNYFNSLNFRQKLINLQKCKLIDNQFLSEKNNVLKGKNIVIVGCGSQGLNQGLNMRDS
ILVC_BUCSC       --MNYFNSLNFRQKLINLRKCKLVEKNFFSKKCDILKRKNIVIVGCGSQGLNQGLNMRDS
ILVC_BUCBP       MGSNYFNSLNFRQKLIQLRQCTLIRKEEFSETFKILKGKNIVIVGCGSQGLNQGLNMRDS
ILVC_BLOFL       -MNNYFNKLTFIQKIKHLGQCRLMKKNEFSDGVRALLSKKIVIIGCGSQGLNQGLNMRDS
                    **** * :   :                         : ::* * *.      :   

ILVC_LEUMM       GF-DVIMGLRP------GKSFDSAKKDGFEVYSAAEATAQADVVMMETPDELQAAVWEKE
ILVC_LEUMC       GF-DVIMGLRP------GKSFDSVKKDGFEVYSAAEATAQADVVMMETPDELQAAVWEKE
ILVC_STAES       GY-DVVIGLRP------GRSFNKAKEDGFDVYTVSEATQQADVVMVLLPDEIQGEVYNKE
ILVC_STAEQ       GY-DVVIGLRP------GRSFNKAKEDGFDVYTVSEATQQADVVMVLLPDEIQGEVYNKE
ILVC_STAA1       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAA9       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAB       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAN       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAM       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAW       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAR       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAA2       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAA8       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAE       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAC       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAT       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAA3       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAAS       GY-DVVIGIRP------GRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNE
ILVC_STAHJ       GY-DVIVGIRP------GHSFDKAKEDGFDVYPVAEAVKQADVIMVLLPDEIQGNVYKNE
ILVC_STAS1       GY-DVIIGIRP------GCSFDKAKDDGFEVYPVDEAAKQADVIMVLLPDEIQGQVYKEE
ILVC_LISMF       GN-NVIIGIRE------GKSAESARNDGFDVYSVSEAAEKADVIMILLPDETQGETYENE
ILVC_LISIN       GN-NVIIGIRE------GKSAESARNDGFDVYSVSEAAEKADVIMILLPDETQGETYENE
ILVC_LISW6       GN-NVIIGIRE------GKSAESARNDGFDVYSVSEAAEKADVIMILLPDETQGETYENE
ILVC_LISMO       GN-NVIIGIRE------GKSAESARNDGFDVYSVSEAADKADVIMILLPDETQGETYENE
ILVC_STRR6       GR-DVIIGVRP------GKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAE
ILVC_STRPN       GR-DVIIGVRP------GKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAE
ILVC_STRP2       GR-DVIIGVRP------GKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAE
ILVC_STRSV       GH-DVIIGVRP------GKSFDKAKEDGFDTYTVAEAAKLADVIMILAPDEIQQDLYEAE
ILVC_STRGC       GH-DVIIGVRP------GKSFDKAKEDGFDTYTVAEAAKLADVIMILAPDEIQQELYEAE
ILVC_STRT2       GH-DVIIGVRP------GKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAE
ILVC_STRT1       GH-DVIIGVRP------GKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAE
ILVC_STRTD       GH-DVIIGVRP------GKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAE
ILVC_STRTR       GH-DVIIGVRP------GKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAE
ILVC_STRS2       GH-DVIIGVRA------GKSFDKAKEDGFETFEVAEAAKQADVIMILAPDEIQADLYNEE
ILVC_STRSY       GH-DVIIGVRA------GKSFDKAKEDGFETFEVAEAAKQADVIMILAPDEIQADLYNEE
ILVC_STRMU       GH-DVIIGVRH------GKSFDKAKEDGFDTYEVGEATKLADIIMVLAPDEIQKDIYKDE
ILVC_LACLM       GH-DVIIGVRQ------GKSFDKAKEDGFETFEVGEAVAKADVIMVLAPDELQQSIYEED
ILVC_LACLS       GH-DVIIGVRQ------GKSFDRAKEDGFETFEVGEAVAKADVIMVLAPDELQQSIYEED
ILVC_LACLA       GH-NVIIGVRH------GKSFDKAKEDGFETFEVGEAVAKADVIMVLAPDELQQSIYEED
ILVC_RHIME       GAQNVAIALKS-----GSATAKKAEADGFKVMTVAEAAAWADLMMMATPDELQADIYKAD
ILVC_SINMW       GAQNVAIALKS-----GSATAKKAEADGFKVMTVAEAAAWADLMMMATPDELQADIYKAE
ILVC_RHIEC       GAQNLVIALKA-----GSPTVKKAEADGFKVMTVAEAAGWADLMMMATPDELQADIYKAD
ILVC_RHIL3       GAQNVVIALKA-----GSPTVKKAEADGFKVMTVAEAAAWADLMMMATPDELQADIYKAD
ILVC_AGRFC       GAKNVVIALKA-----GSPTVKKAEADGFKVMTVAEAAKWGDLLMMATPDELQADIYKAD
ILVC_RHILO       GAKEIAIGLKA-----GSATAKKVEADGLKVMSVADAAKWADLMMMATPDELQADIYKNE
ILVC_CHESB       GAKDLAVALRP-----GSASAKKAEADGLKVMSVAEAAGWADLMMMATPDELQAGIYNNE
ILVC_BRUO2       GAANVRVALRE-----GSATVQKAQADGFEVMNVADAAKWADLMMMATPDELQADIYRDH
ILVC_BRUSU       GAANVRVALRE-----GSATVQKAQADGFEVMNVADAAKWADLMMMATPDELQADIYRDH
ILVC_BRUC2       GAANVRVALRE-----GSATVQKAQADGFEVMNVADAAKWADLMMMATPDELQADIYRDH
ILVC_BRUAB       GAANVRVALRE-----GSATVQKAQADGFEVMNVADAAKWADLMMMATPDELQADIYRDH
ILVC_BRUA2       GAANVRVALRE-----GSATVQKAQADGFEVMNVADAAKWADLMMMATPDELQADIYRDH
ILVC_BRUME       GAANVRVALRE-----GSATVQKAQADGFEVMNVADAAKWADLMMMATPDELQADIYRDH
ILVC_BRUSI       GAANVRVALRE-----GSATVQKAQADGFEVMNVADAAKWADLMMMATPDELQADIYRDY
ILVC_OCHA4       GAANVRVALRE-----GSATAKKAQADGFEVMNVADAAKWADLMMMATPDELQADIYKEH
ILVC_BART1       GVQNVQIALRS-----GSETVKKATADGFEVVSVAEAAKWADLIMMATPDELQADIYKEH
ILVC_BARHE       GVKNVKIALRS-----ESATVKKAVADGFEVVCVAEAAKWADLIMMATPDELQADIYKEH
ILVC_BARQU       GVQDVRIALHS-----RSATAKKAIADGFEVVRVAEAAKWADLIMMATPDELQADIYKEH
ILVC_BARBK       GVQNVRIALHS-----GSMTTKKAEADGFEVMSVAEAVQWADFIMIATPDELQADIYKEH
ILVC_RHOPB       GVKDVAIALRK-----GSTSAQKAEAAGFKVMEVAEAAKWADVMMMLTPDELQGDIYREH
ILVC_RHOP5       GVKDVAIALRK-----GSATAQKAEAAGFKVMEVAEAAKWADVMMMLTPDELQGDIYREH
ILVC_RHOP2       GVKDVAIALRK-----GSATAKKAEAAGFKVMEVAEAAKWADVMMMLTPDELQGEIYRDH
ILVC_RHOPS       GVKDVAIALRK-----GSATAKKAEAAGFKVMEVAEAAKWADVMMMLTPDELQGEIYREH
ILVC_RHOPA       GVKDVAIALRK-----GSASAKKAENAGFKVMEVAEAAKWADVMMMLTPDELQADIYREH
ILVC_BRASO       GVKDVAIALRK-----GSASAKKAEGAGFKVMEVAEAAKWADLVMMLTPDELQGDIYREH
ILVC_BRASB       GVKDVAIALRK-----GSASAKKAEGAGFKVMEVAEAAKWADLVMMLTPDELQGDIYREH
ILVC_NITWN       GVKEIAIALRK-----GSASAKKAEGAGFKVMEVAEAAKWGDLVMMLTPDELQGDIYREH
ILVC_NITHX       GVKEIAIALRK-----GSASAQKAEAAGFKVMDVAEAAKWGDVVMMLTPDELQGDIYREN
ILVC_BRADU       GVKEVAIALRK-----DSSSVKKAEAAGFKVMDVAEAAKWADLVMMLTPDELQGDIYREH
ILVC_AZOC5       GVKDIVVALRP-----GSASAKKAEGEGFKVMTPAEAAKWGDVVMMLTPDELQADIYRES
ILVC_PARL1       GVKEVAVALRA-----GSATAKKAEGEGLKVMTVADAAKWADVLMMLTPDELQADIYYAD
ILVC_MAGSA       GVKDVAVALRA-----GSATAKKAEGEGLKVMTPADAAKWGDVVMILTPDELQADLYYND
ILVC_PHAMO       GVKDVAVALRP-----GSASIKKAEAEGLKVLTPAEAAAWADVVMILTPDELQADLYKSE
ILVC_RHORT       GVTEVCVALRE-----GSPSAKKATGQGLVVKTPAEAAAWADVVMILTPDELQGDLYKDH
ILVC_GRABC       GVKDLVVGLRK-----GSSAVAKAEGEGLKVMEPAEAAAWADVVMILTPDESQADLYREH
ILVC_ACICJ       GVKELVVALRK-----GSAAVAKAEAAGLRVMTPEEAAAWADVVMILTPDEGQGDLYRDS
ILVC_GLUDA       GVTDMVIGLRP-----GSSAVAKAEAAGFKVMGPSEAAAWADVVMVLTPDEGQGALYKEH
ILVC_GLUOX       GVSDIVIGLRP-----TSSAVKKAEEAGFKVMEPGEAAAWADVVMVLTPDEGQGALYKES
ILVC_CAUSK       GATNVAVALRA-----GSPTAKKAQGEGLKVMTVAEAAAWADLLMILAPDEHQAAIYKND
ILVC_CAUVC       GIKNVAVALRA-----GSPTAKKAEGEGLKVMTVAEAAAWADLIMILAPDEHQAAIYKNE
ILVC_RHOS1       GAKNVVVALRE-----GSPSAKKAEAEGLKVMGIAEAAAWCDLIMFTMPDELQAETYKKY
ILVC_RHOS4       GAKNVVVALRE-----GSPSAKKAEAEGLKVMGIAEAAAWCDLIMFTMPDELQAETYRKY
ILVC_RHOS5       GAKNVVVALRE-----GSPSAKKAEAEGLKVMGIAEAAAWCDLIMFTMPDELQAETYKKY
ILVC_PARDP       GAKNLVVALRE-----GSASAKKAEAEGLKVMGIAEAAAWADLIMFTMPDELQAETYRKY
ILVC_DINSH       GAKNLVVALRE-----GSASAKKAEAEGLQVMGIAEAAAWCDLIMFTMPDELQAETYKKY
ILVC_ROSDO       GAKNLAVALRE-----GSASAAKAEGEGLQVMGIAEAAAWADLIMFTMPDELQAETYKKY
ILVC_JANSC       GAKNVVVALRE-----GSASAAKAEGEGLKVMGIAEAAAWCDVIMFTMPDELQAETYKKY
ILVC_RUEPO       GAKNLVVALRE-----GSASAKKAEGEGLTVMGIAEAAAWCDVIMFTMPDELQAETYKKY
ILVC_RUEST       GAKNLVIALRE-----GSPSAKKAEAEGLQVMGIAEAAAWCDVIMFTMPDELQAETYKKY
ILVC_ERYLH       GIKEVAIALRD-----GSSSAKKAQDAGFKVLSNSDAAEWADILMILAPDEHQAAIWADD
ILVC_NOVAD       GVKDVAIALRP-----GSASAKKAEAAGFKVLANADAAAWADILMILAPDEHQAAIYADD
ILVC_SPHAL       GVKEVAIALRP-----GSPTAKKAEAAGFKVMSNKEAAAWADVIMIAAPDEHQAKIYAED
ILVC_SPHWW       GVADVAIALRP-----GSATAKKAEGAGFKVLSNADAAKWADIVMILAPDEHQAAIYNDD
ILVC_ZYMMO       GVAEVAIALRP-----DSASVKKAQDAGFKVLTNAEAAKWADILMILAPDEHQAAIYAED
ILVC_PELUB       GAKEVVVALRD-----GSASKAKAESKGLRVMNMSDAAEWAEVAMILTPDELQASIYKNH
ILVC_HYPNA       GVKQIKVALQE-----GSASRKKAEAAGLEVVSVADAAKWADVLMILVPDEKQAVLYANE
ILVC_GEOUR       GI-DVVVGLKA-----DSASVKKATEAGLTVLTTSEAVKIADIIMILLPDEIQGDVYREE
ILVC_GEOMG       GI-DVVVGLRA-----DSASVKKATEAGLTVLPTSEAVKIADVVMILLPDETQGDIYREE
ILVC_GEOSL       GV-DVVVGLKA-----DSSSVAKATGAGLTVLPTADAVKGADVVMILLPDEIQGDVYREE
ILVC_PELPD       GI-DVIVGLRK-----ESPSVKKATDAGLKVLGVAEAAKAADIVMILLPDETQGDVYRAE
ILVC_MAGMM       GV-DVVVGLRA-----GSSSWMKAEGSGLQVAEVADAVGGADLVMMLVPDEHQAKIYREQ
ILVC_METCA       GV-QVVVGLRP-----GSASAKKAENAGLAVASVEDAVKQADVIMILAPDEHQARLYNEQ
ILVC_NITOC       GV-DVVVGLRS-----GSTSVAKAENAGLTVLPIEAAIKEADLAMILAPDEHQSKLYQED
ILVC_VESOH       NV-EVVVALRD-----GSASSKKASDAGLNVKSIKQATAWADLIMVLAPDEFQAQIYTDS
ILVC_RUTMC       GV-EVVVALRA-----DSASTEKAFVAGLTVKSIEEATDWADLVMVLAPDEFQAKIYTNS
ILVC_ALKEH       GV-DVVVGLRE-----GSSSAAKAQKAGLAVASIEDAAAQADVVMILAPDEHQAVIYHNQ
ILVC_HALHL       GV-NVVVGLRP-----GSSSAAKAQEAGLEVASVEEATQGADVVMMLVPDEAAPDIYNQQ
ILVC_NITEU       GV-KVTIGLRK-----GGASWDKAKKAGLTVKEVGAAVKDADVIMLLLPDEQMASVYQTE
ILVC_NITEC       GV-EVIIGLRK-----DGASWDKAKKAGLTVKEVSEAVKDADIVMLLLPDEQMASIYQTE
ILVC_NITMU       GV-AVTVGLRK-----EGASWGKAEKAGLTVKEVAESVKDADVVMVLLPDEQIADVYATE
ILVC_CUPMC       GV-NVTVGLRK-----SGASWNKAVNAGLQVKEVAEAVKGADVVMILLPDEQIADVYKNE
ILVC_CUPNH       GV-NVTVGLRK-----SGASWNKAANAGLQVKEVAEAVKGADVVMILLPDEQIADVYKNE
ILVC_CUPPJ       GV-NVTVGLRK-----SGASWNKAVNAGLQVKEVAEAVKGADVVMILLPDEQIADVYKNE
ILVC_RALSO       GV-KVTVGLRK-----NGASWNKAVNAGLQVKEVAEAVKDADVVMILLPDEQIADVYKNE
ILVC_BURM7       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURPS       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURP1       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURP0       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURM9       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURMS       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURMA       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURP6       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURTA       GV-NVTVGLRR-----GGASWSKAENAGLAVKEVAEAVKGADVVMMLLPDEQIAAVYAQE
ILVC_BURCH       GV-NVTVGLRK-----GGASWSKAENAGLSVKEVAEAVKGADVVMMLLPDEQIADVYAKE
ILVC_BURVG       GV-NVTVGLRK-----GGASWSKAENAGLSVKEVAEAVKGADVVMMLLPDEQIADVYAKE
ILVC_BURCA       GV-NVTVGLRK-----GGASWSKAENAGLSVKEVAEAVKGADVVMMLLPDEQIADVYAKE
ILVC_BURCM       GV-NVTVGLRK-----DGASWSKAENAGLSVKEVAEAVKGADVVMMLLPDEQIADVYAKE
ILVC_BURL3       GV-NVTVGLRK-----GGASWSKAENAGLSVKEVAEAVKSADVVMMLLPDEQIADVYAKE
ILVC_PARXL       GV-NITVGLRK-----GGASWSKAENAGLQVKEVAEAVKGADVVMMLLPDEQIAEVYAKE
ILVC_POLAQ       GC-NVTVGLRK-----GGASWSKAENAGLTVKEVGEAVKDADVVMMLLPDEQIADVYNKE
ILVC_JANMA       GV-KVTVGLRK-----GGASWDKVKNAGLNVAEVNDAVKAADVIMILLPDENIAQVYNEN
ILVC_HERAR       GC-KVTVGLRK-----GGASWDKVKNAGLNVAEVNDAVKAADVIMILLPDENIAQVYNEN
ILVC_POLNA       GV-KVVVGLRK-----GGASWPKVEKAGLQVAEVADAVKAADVVMILLPDEQIGAVYKND
ILVC_POLSJ       GV-KVVVGLRK-----GGASWPKVEKAGLKVAEVADAVKAADVVMILLPDEQIGAVYAND
ILVC_RHOFT       GV-KVVVGLRK-----GGASWTKVEKAGLKVAEVADAVKAADVVMILLPDEHIAAVYTED
ILVC_METPP       GV-KVTVGLRR-----GGASWNKVEKAGLKVAEVADAVKSADVVMILLPDEQIASVYSAE
ILVC_BORBR       GV-KVVVGLRK-----GGASWNKAANAGLEVAEVAEAVKRADIVMMLLPDENIAAVYRDE
ILVC_BORPA       GV-KVVVGLRK-----GGASWNKAANAGLEVAEVAEAVKRADIVMMLLPDENIAAVYRDE
ILVC_BORPE       GV-KVVVGLRK-----GGASWNKAANAGLEVAEVAEAVKRADIVMMLLPDENIAAVYRDE
ILVC_BORA1       GV-KVVVGLRK-----GGASWNKAANAGLEVAEVAEAVKRADVVMMLLPDENIAAVYRDE
ILVC_CHRVO       GV-DVIVGLRK-----DGASWKKAEAAGHKVKEVAEAVKKADVVMILLPDESQPEVYHKD
ILVC_METFK       GV-NVTIGARK-----EGSSFAKAVNAGHEVKEIKEAVTGADVVMVLLPDETMAEIYHAE
ILVC_AZOSB       GV-KVTVAVRK-----GGASWDKAKAAGLKVEEIAKAVKTADLVMILLPDENIPQVYKEE
ILVC_DECAR       GV-KVTVGLRK-----DGASWKKAEAAGLKVEEIAKAVKGADVVMILLPDENIPQVYNEE
ILVC_AROAE       GC-KVTVGLRK-----SGASWKKAEAAGLDVREVAEAVSNADIVMILLPDENIPGVYYND
ILVC_ACIAC       GV-KVVVGLRK-----GGASWDKVGKAGLTVLEVNEAVKSADVVMILLPDEQIAEVYKNN
ILVC_ACISJ       GV-KVVVGLRK-----GGASWDKVGKAGLTVKEVNDAVKEADVVMILLPDEQIAEVYKNN
ILVC_NEIMF       GV-NVVIGLRQ------GSSWKKAEAAGHVVKTVAEATKEADVVMLLLPDETMPAVYHAE
ILVC_NEIMB       GV-NVVIGLRQ------GSSWKKAEAAGHVVKTVAEATKEADVVMLLLPDETMPAVYHAE
ILVC_NEIM0       GV-NVVIGLRQ------GSSWKKAEAAGHVVKTVAEATKEADVVMLLLPDETMPAVYHAE
ILVC_NEIMA       GV-NVVIGLRQ------GSSWKKAEAAGHVVKTVAEATKEADVVMLLLPDETMPAVYHAE
ILVC_NEIG1       GV-NVVIGLRH------GSSWKKAEAAGHVVKTVAEATKEADVVMLLLPDETMPAVYHAE
ILVC_PSEAB       GV-DVTVGLRS-----GSATVAKAEAHGLKVADVKTAVAAADVVMILTPDEFQGRLYKEE
ILVC_PSEAE       GV-DVTVGLRS-----GSATVAKAEAHGLKVADVKTAVAAADVVMILTPDEFQGRLYKEE
ILVC_PSEA7       GV-DVTVGLRS-----GSATVAKAEAHGLKVADVKSAVAAADVVMILTPDEFQGRLYKEE
ILVC_PSEU5       GV-DVTVGLRP-----GSSSIAKAEAHGLKVSDVPAAVAAADLVMILTPDEFQGRLYKDE
ILVC_PSEU2       GV-DVTVGLRK-----GSATVAKAEAHGLKVTDVASAVAAADLVMILTPDEFQSQLYKNE
ILVC_PSE14       GV-DVTVGLRK-----GSATVAKAEAHGLKVTDVASAVAAADLVMILTPDEFQSQLYKNE
ILVC_PSESM       GV-DVTVGLRK-----GSATVAKAEAHGLKVTDVASAVAAADLVMILTPDEFQSQLYKNE
ILVC_PSEMY       GV-DVTIGLRK-----GSATVAKAEAHGLKVTDVASAVAAADLVMILTPDEFQGQLYKNE
ILVC_PSEPF       GV-DVTVGLRK-----GSATVAKAEAHGLKVTDVAAAVAGADLVMILTPDEFQSQLYKNE
ILVC_PSEF5       GV-DVTVGLRK-----GSATVAKAEAHGLKVTDVAAAVAGADLVMILTPDEFQSQLYKNE
ILVC_PSEPK       GV-DVTVGLRK-----GSATVAKAEAHGLKVADVATAVAAADLVMILTPDEFQGALYKNE
ILVC_PSEP1       GV-DVTVGLRK-----GSATVAKAEAHGLKVADVATAVAAADLVMILTPDEFQGALYKNE
ILVC_PSEPG       GV-DVTVGLRK-----GSATVAKAEAHGLKVADVATAVAAADLVMILTPDEFQGALYKNE
ILVC_PSEE4       GV-DVTIGLRK-----GSATVAKAEAHGLKVTDVATAVAAADLVMILTPDEFQGQLYKQE
ILVC_ALCBS       GV-DVVVGLRT-----GSTSIAKAEAHGLSVTDVPSAVAAADVVMVLTPDEFQAHLYKSD
ILVC_MARHV       GV-DVVVGLRA-----GSSSIAKAEAYGLKTSDVASAVASADVVMVLTPDEFQAQLYREE
ILVC_HAHCH       GV-DVCVGLRK-----GSGSWAKAENAGLAVKEVAEAVAGADVVMILTPDEFQAQLYKSE
ILVC_SACD2       GV-DVTVGLRT-----GSSSVAKAEAHGLKVADVATAVAAADVVMILTPDEFQSVLYKEE
ILVC_HYDCU       GV-DVTVGLRP-----GSSSIKKAEGYGLKTADVATAVAGADVVMILTPDEFQSVLYKEE
ILVC_PSYCK       NV-DVTVGLRA-----NSGSWKKAENAGLKVAEVEEAVKAADIIMILTPDEFQKELYNDV
ILVC_PSYA2       NV-DVTVGLRA-----DSGSWKKAENAGLKVAEVEEAVKAADIIMILTPDEFQKELYNDV
ILVC_PSYWF       GV-DVTVGLRK-----DSGSWKKAENAGLKVAEVAQAVQAADVVMILTPDEFQKSLYEDV
ILVC_ACIAD       GV-DVTVGLRA-----NSASWKKAENAGLKVAEVPEAVKQADLVMILTPDEFQSQLYRDV
ILVC_THIDA       GV-DVTVALRP-----GSASAKKAENAGLTVKSVPEAVAGADLVMILTPDEFQSRLYRDE
ILVC_CHRSD       GV-DVTVALRP-----GSSSVAKAEAAGFKVASVPDACKTADVLMLLAPDENQKAIYEQD
ILVC_PRB01       GV-SVTVGLRE-----GSSSWAKAEEAGLKVQTVADSVIQADLVMILAPDEFQKNIYETE
ILVC_ARCB4       GV-EVIVGLRK-----DGSSWKKAEAKGFKVLTVAEATKIADVVMILLPDENQADIYANE
ILVC_SULDN       GV-EVVVGLRK-----DGSSWAKAEAKGFKVMTVGDASAYADLIMILLPDENQAEIYKDE
ILVC_NITSB       GV-EVKIGLYP-----GGRSWKKAEAKGFDVLEVADASEWADVVMILIPDEIQSEVYYRD
ILVC_HELHP       GV-EVIIGLYR-----GGSSWVKAEAKGFKVLEVSEATKVADVIMILIPDELQADVFAKD
ILVC_WOLSU       GV-EVVIGLHK-----GGSSWSKAEAKNFKVMEVAEASRYADVIMILIPDELQAEVFERD
ILVC_CAMC5       GV-KVVIGLAK-----GGKSWAKAEAKGFDVKIVSEATKDADVVMILTPDELQSEIYKKE
ILVC_CAMC1       GV-SVVIGLVK-----GGKSWAKAEAKGFEVKTVSEATKGADVIMILTPDELQAEIYKNE
ILVC_CAMFF       GV-DVVVGLNP-----KGKSWAKAEAKGFKVMSVSEATKYADLIMILTPDEFQADIFKAE
ILVC_CAMHC       GV-DVVVGLKK-----GGKSWAKAEAMNFKVKSVVEATKEADVIMILTPDELQADIFASE
ILVC_CAMJ8       GV-NVTIGLRE-----GSVSAVKAKNAGFEVMSVSEASKTADVVMILAPDEIQADIFNIE
ILVC_CAMJJ       GV-NVIIGLRE-----GSVSAVKAKNAGFEVMSVSEASKTADVVMILAPDEIQADIFNVE
ILVC_CAMJR       GV-NVTIGLRE-----GSVSAVKAKNAGFEVMSVSEASKIADVIMILAPDEIQADIFNVE
ILVC_CAMJE       GV-NVTIGLRE-----GSVSAVKAKNAGFEVVSVSEASKIADVIMILAPDEIQADIFNVE
ILVC_CAMJD       GV-NVIIGLRE-----GSVSAVKAKNAGFEVMSASEASKMADVIMILAPDEIQADIFNVE
ILVC_MYCSK       GV-QVKVGLKE-----GSKSREKVTEQGLEVDTPAEVAKWADVIMLLAPDTAQAEIFTND
ILVC_MYCSJ       GV-QVKVGLKE-----GSKSREKVTEQGLEVDTPAEVAKWADVIMLLAPDTAQAEIFTND
ILVC_MYCSS       GV-QVKVGLKE-----GSKSREKVTEQGLEVDTPAEVAKWADVIMLLAPDTAQAEIFTND
ILVC_MYCVP       GV-QVKVGLKE-----GSKSREKVTEQGLEVDTPAEVAKWADVIMLLAPDTAQAEIFTND
ILVC_MYCGI       GV-EVKVGLKE-----GSKSRDKVTEQGLDVDTPAEVAKWADVIMLLAPDTAQAEIFTKD
ILVC_MYCS2       GV-QVKVGLKE-----GSKSREKAEEQGLEVDTPAEVAKWADVIMLLAPDTAQASIFTND
ILVC_NOCFA       GV-EVRVGLAE-----GSKSRPKAEEAGLTVGTPAEVSAWADVIMLLAPDTAQASIFTND
ILVC_RHOJR       GV-DVRIGLKE-----GSKSRAKAEEQGLTVGTPAEVSEWADVIMVLAPDTAQASIFTND
ILVC_MYCPA       GV-QVKVGLKE-----GSKSRAKVSEQGLDVDTPAAVAKWADVIMLLAPDTAQADIFKND
ILVC_MYCA1       GV-QVKVGLKE-----GSKSRAKVSEQGLDVDTPAAVAKWADVIMLLAPDTAQADIFKND
ILVC_MYCAV       GV-QVKVGLKE-----GSKSRAKVSEQGLDVDTPAAVAKWADVIMLLAPDTAQADIFKND
ILVC_MYCUA       GV-QVRVGLKE-----GSKSRAKVEEQGIEVDTPAKVAEWADVIMVLAPDTAQAEIFAND
ILVC_MYCLE       GV-QVRVGLPE-----GSKSRPKAFEQGLDVDTPAEVAKWADVIMLLVPDTAQADVFEND
ILVC_MYCBP       GV-QVRVGLKQ-----GSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGD
ILVC_MYCTA       GV-QVRVGLKQ-----GSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGD
ILVC_MYCTU       GV-QVRVGLKQ-----GSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGD
ILVC_MYCBO       GV-QVRVGLKQ-----GSRSRPKVEEQGLDVDTPAEVAKWADVVMVLAPDTAQAEIFAGD
ILVC_CORGL       GV-EVVIGLRE-----GSKSAEKAKEAGFEVKTTAEAAAWADVIMLLAPDTSQAEIFTND
ILVC_CORGB       GV-EVVIGLRE-----GSKSAEKAKEAGFEVKTTAEAAAWADVIMLLAPDTSQAEIFTND
ILVC_COREF       GV-EVVIGLRE-----GSKSAEKAKEAGFEVKTTAEAAAWANLIMILAPDTSQASIFTND
ILVC_CORJK       GV-EVVIGLRE-----GSKSRAKAEEAGFTVKTNAEAAEWADVIMLLAPDTSQAKIFAED
ILVC_CORDI       GV-EVVIGLRE-----GSKSSEKAQEAGFEVKSNADAAAWADVIMLLAPDTSQAEIFSHD
ILVC1_STRCO      GV-DVRVGLHE-----GSKSKAKAEEQGLRVVPVAEAAAEADVIMILVPDPIQAEVYEKD
ILVC2_STRCO      GV-DVRVGLHE-----GSKSKAKAEEQGLRVVPVAEAAAEADVIMILVPDPIQAEVYEKD
ILVC_STRAW       GV-DVRVGLHE-----GSKSKAKAEEQGLRVVTPSEAAAEADVIMILVPDPIQAQVYEES
ILVC_SALAI       GV-DVVIGLPA-----GSKSRPKAEEQGLRVRTPAEAAAEADIIMILAPDTAQRALYTES
ILVC_SALTO       GV-AVVIGLPA-----GSKSRPKAEEQGLRVLTPAEAAAEADIIMILAPDTAQRALYTDS
ILVC_SACEN       GA-DVRIGLPE-----GSKSRAKAEEEGLRVLTPAEASAEADLIMILAPDTKQRQIYADD
ILVC_FRAAA       GV-DVRVGLPA-----DSRSRAKAAEEGLRVLTPAEASAEADIIMLLTPDTTHRKIYADS
ILVC_FRACC       GV-DVRVGLPA-----DSRSRARAEEEGLRVLTPAEASAEADIIMLLTPDTTHRTIYAES
ILVC_THEFY       GV-DVRVGLPE-----SSKSRAKAEEDGLRVVTPAEAAQEADLIMILVPDHIHRDLYANE
ILVC_CLAMS       GV-EVVIGLKE-----GSTSRAKAEEQGFTVKTPSDASAWADVIVILAPDQHQRGLYADS
ILVC_CLAM3       GV-EVVIGLKE-----GSTSRAKAEEQGFTVKTPSDASAWADVIVILAPDQHQRGLYADS
ILVC_LEIXX       GV-EVVIGLKD-----GSKSTPKAEEAGFRVLSAAEAAQWADVVVILAPDQVQRTLYADD
ILVC_ARTS2       GV-EVTIALKE-----GSSSIAKAQDAGFTVKNVADAAEWADVIMILAPDQHQRSIYNDS
ILVC_RENSM       GV-DVRVGLAE-----GSQSRAKAEAEGLRVLNVAEAVAEADVIMVLTPDQVQRHVYAES
ILVC_KINRD       GV-DVVVGLKE-----GSKSRAKAEEQGLTVLTPFEASKAADVIMVLVPDHLQRGLYAEA
ILVC_CUTAK       GV-DVRVGLRD-----GSSSIAKAEAQGLRVLSIEDACEEADLIMVLVPDQNQRQLYAEH
ILVC_TROW8       GV-NVVIGLKE-----NSASRKSAQDSGFEVLLPQEAAKKAQLIALLVPDPAQRDVYESA
ILVC_TROWT       GV-NVVIGLKE-----NSASRKSAQDSGFEVLLPQEAAKKAQLISLLVPDPAQRDVYESA
ILVC1_BIFLO      GV-DVVVGLRP-----TSKSVDFAKEQGLEVKSVAEASAEADVIMILAPDQYQRTIWAND
ILVC2_BIFLO      GV-DVVVGLRP-----TSKSVEFAKEQGLEVKPVGEAVAEADVVMILLPDQYQAAVYKKD
ILVC_XYLFA       GF-DIIIGLRP-----GGPTEAKAQADGFTVQSPDQAAKHADLVAVLTPDMVQKKLYEEV
ILVC_XYLFT       GF-DIIVGLRP-----GGATEAKAQADGFTVQSPDQAAKHADLVAVLTPDMVQKKLYEEV
ILVC_XANAC       GF-DVTVGLRP-----GGPTEAKAQADGFTVVAPSEAVKSADLVAILTPDMVQKKLYEEV
ILVC_XANC5       GF-DVTVGLRA-----GGPTEAKAQADGFIVVAPSEAVKSADLVAILTPDMVQKKLYEEV
ILVC_XANOM       GF-DVTVGLRP-----GGPTESKAQADGFTVVAPSEAVKSADLVAILTPDMVQKKLYEDV
ILVC_XANOR       GF-DVTVGLRP-----GGPTESKAQADGFTVVAPSEAVKSADLVAILTPDMVQKKLYEDV
ILVC_XANCP       GF-DVTVGLRP-----GGPTEAKAQADGFTVVAPAEAVKTADLVAVLTPDMVQKKLYEEV
ILVC_XANC8       GF-DVTVGLRP-----GGPTEAKAQADGFTVVAPAEAVKTADLVAVLTPDMVQKKLYEEV
ILVC_CHLPM       GL-NVRVGLRT-----DSASCQKARAAGLQVDTIADAVKWADVVMVLLPDQYQKAIYDSE
ILVC_CHLPD       GM-NVCVGLRS-----DSTSCQKARDAGLEVKTIADAVTWADIVMVLLPDQNQKAIYEAE
ILVC_CHLCH       GL-NVRVGLRP-----ESASCAKAREAGLEVTSVAEATKWADIVMVLLPDQNQKAVYEAE
ILVC_PELLD       GM-NVCVGLRP-----DSSSCAKAREAGLRVEPVADAVKWADIVMVLLPDQTQKAVYEAE
ILVC_CHLTE       GM-NVCVGLKT-----DSASCAKAREAGLKVDTVAEAVKWADIVMILLPDQTQKSVYDNE
ILVC_SALRD       GV-DVAVGLRP-----GSSSRPKAEQQGLTVMDIGEAAAWGDVVMLLIPDQHQKDVYEAK
ILVC_NATPD       GV-DVVVGLRE-----DSSSRSAAEADGLDVATPRGAAEQADLVSVLVPDTVQPAVYEQ-
ILVC_HALMA       GV-DVIVGLRQ-----DSSSWADAEDAGLRVETPDVAAGEADRVVMLVPDTIQPAVYEA-
ILVC_DESVV       GI-SVIVGQRP-----GGANYALAKEHGFEPVSAAEAAAKADLIMILLPDQVQAAVYEAE
ILVC_DESVH       GI-SVIVGQRP-----GGANYALAKEHGFEPVSAAEAAAKADLIMILLPDQVQAAVYEAE
ILVC_DESAG       GV-NVIVGQRP-----GGPNFELAKEHGFQPLSAAEAAAQADLIMILLPDQYQASVYEND
ILVC_RHOBA       GC-EVIIGQRP-----GSANYDLAVSHGFEPMSIAEATKAADVINVLLPDEVQADIYRDS
ILVC1_BACC1      GF-DVVVGLRK-----GK-SWDKAKEDGFSVYTVAEAAKQADVVMILLPDELQPEVYEAE
ILVC1_BACCZ      GF-DVVVGLRK-----GK-SWDKAKEDGFSVYTVAEAAKQADVVMILLPDELQPEVYEAE
ILVC1_BACHK      GF-DVVVGLRK-----GK-SWDKAKEDGFSVYTVAEAAKKADVVMILLPDELQPEVYEAE
ILVC1_BACAN      GF-DVVVGLRK-----GK-SWDKAKEDGFSVYTVAEAAKQADVVMILLPDELQPEVYEEE
ILVC1_BACCR      GF-DVVVGLRK-----GK-SWDKANEDGFSVYTVAEAAEKADVVMILLPDELQPEVYEAE
ILVC_BACCN       NF-DVVVGLRK-----GK-SWEKAKEDGFSVYSVAEAAAMADVVMVLLPDELQPEVYQAE
ILVC_OCEIH       GY-DVVVGLRP-----GK-SQEKAEEDGFNVLSVAEASSQADVVMVLLPDEMQPKVYEES
ILVC_BACVZ       GI-DVIVGVRQ-----GK-SFTQAQEDGHQVFSVREAAAQADIIMVLLPDEQQQKVYEAE
ILVC_BACSU       GV-DVIVGVRQ-----GK-SFTQAQEDGHKVFSVKEAAAQAEIIMVLLPDEQQQKVYEAE
ILVC_BACLD       GV-DVIVGVRK-----GK-SFAKAEEDGHQVFTVREAAEQADIVMVLLPDEQQQKVYEAE
ILVC_BACP2       GV-DVIVGVRK-----GG-SYTKAQEDGHQVFTVKEAAAQADVLMVLLPDEQQKKVYDEE
ILVC_GEOKA       GV-RVIVGLRK-----GK-SWEQAEQDGFEVYSVREAAKQADIVMVLLPDEKQPAVYKEE
ILVC_GEOTN       GV-HVIIGLRK-----GR-SWEQAEQDGFDVYSVREASKKADIVMVLLPDEKQPAVYKEE
ILVC_BACSK       GV-DVIIGLRP-----GK-SWDKATEDGFSVYSVREASAKADIIMILSPDEHQPAIYKES
ILVC_BACHD       GQ-EVIVGLRP-----GK-SWDKAAEDGFQVYSVREAASRADVIMILLPDEHQPTVYKNE
ILVC2_BACAN      GV-EVVVGVRP-----GK-SFEVAKADGFEVMSVSEAVRTAQVVQMLLPDEQQAHVYKAE
ILVC2_BACHK      GV-EVVVGVRP-----GK-SFEVAKADGFKVMSVSEAVRTAQVVQMLLPDEQQAHVYKAE
ILVC2_BACCR      GV-EVVVGVRP-----GK-SYEVAKADGFEVMSVSEAVRTAQVVQMLLPDEQQAHVYKAE
ILVC2_BACCZ      GV-EVVVGVRP-----GK-SYEVAKADGFEVMSVSEAVRTAQVVQMLLPDEQQAHVYKAE
ILVC2_BACC1      GV-EVVVGVRP-----GK-SFEVAKTDGFEVMSVSEAVRTAQVVQMLLPDEQQAHVYKAG
ILVC_CALS4       GF-DVVVGLYE-----GSKSKERAEKEGLTVLTVEEAAKVADVIMMLIPDEKQAKVYKES
ILVC_CALS8       GI-NVVVGLYH-----GSKSWAKAESHGLKVMTADEATKAADIIMILVNDEKQPKLYKES
ILVC_CLOB8       GV-DVVVGLYN-----GSKSWAKAEAAGLQVATVADAAKAADLIMILLPDEKQAKIYNEE
ILVC_ALKMQ       GV-DVVVGLYE-----GSKSWERAEAEGLKVAVASDAAAEADVVVILVNDEKQVQVYEES
ILVC_CLONN       GV-NVIVGLYE-----GSKSRKIAESQGLQVLNTKDAVKNADVIMMLIPDEKQAKVYMED
ILVC_CLOAB       GL-NVIVGLYD-----GSKSWKVAEDYGFEVYEVADAVKQAQVVMILLPDEKQKQIYEAS
ILVC_LACP7       GV-HVIIGLYE-----GSKSWAKASAAGFEVYTAAEAAKKADVIMILINDEKQAKMYKES
ILVC_HUNT2       GI-DVVVGLPE-----GSKSRQKAVEDGLRVENTDVAAKMADVVMMLVPDQLQQDIYENS
ILVC_THEMA       GL-NVVVGLRE-----GSKSWKKAEEQGLTVKTIEEAAKEADIIMILIPDEHQPEIYKKY
ILVC_THEP1       GL-NVVVGLRE-----GSKSWKKAEEQGLTVKAIEEAAKEADIIMMLIPDENQPEIYKKY
ILVC_AQUAE       GL-NVIIGLHE-----GSRSREKAKADGFEVYTPREAAKRADIIMFLIPDTVQPEVYKNE
ILVC_PETMO       GL-KVIIGLKK-----DSKSKETAQRDGFEVYETSEAVKKGDIIQVLIPDEVQSEVYKKD
ILVC_DESHY       GL-NVVIGLRA-----DSRRWKQAEAAGLKVATVAEAAAQADLIQILLPDERQASVYEKE
ILVC_DESRM       GL-DVVVGLRK-----DSARWSKAEADGLQVATVPDACAQAEVIQVLLPDEIQGRVYAEE
ILVC_CARHZ       GL-NVVVGLHK-----KSKSREKAEADGFTVMKVDEAAQWADIIQILVPDQIQGELYRDK
ILVC_SYNWW       GL-NVIVGLRKPFDEASEKEWNAVIAAGITPMSVAEAAEAADVIQILLPDEVQARVYNAE
ILVC_MOOTA       GL-DVVVGLRP-----ESKSRAAAQAAGLEVKTVAEAAAEADIIQILLPDETQARVYREE
ILVC_DEHMC       GL-KVIVACVE-----GGRGWKKATADGFEVMCVAEMAKKADIIMMLAPDTSQAKIYKDS
ILVC_DEHMB       GL-KVIVACVE-----GGRGWKKATADGFEVMCVAEMAKKADIIMMLAPDTSQAKIYKDS
ILVC_DEHM1       GL-KVIVACVE-----GGRGWKKATADGFEVMCVAEMAKKADIIMMLAPDTSQAKIYKDS
ILVC_METST       GL-NVIVGLRE-----GGKSWKKAQEDGLTVKTIEDASKEADIIHILIPDEIQKTVYENQ
ILVC_METS3       GV-NVIVGLRE-----NGNSWNLAKEDGMTVKTFSDAAKEADIIHILLPDEIQEKVYNEQ
ILVC_METTH       GL-NVIVGLRR-----GGSSWKKAHDDGMNVMTIEDASREADIIHILIPDEIQETVFEQS
ILVC_METM5       GL-NVVVGLRK-----NGASWENAKADGHNVMTIEEAAEKADIIHILIPDELQAEVYESQ
ILVC_METM7       GL-NVVVGLRK-----NGASWENAKADGHNVMTIEEAAEKADIIHILIPDELQAEVYDAQ
ILVC_METMP       GL-NVVVGLRK-----NGASWNNAKADGHNVMTIEEAAEKADIIHILIPDELQAEVYESQ
ILVC_METVS       GL-NVVVGLRK-----NGASWENAKNDGHEVLTIEEASKKADIIHILIPDELQAEVYESQ
ILVC_METJA       GL-NVIVGLRP-----NGASWNKAIKDGHKVMTIEEAAEKADIIHILIPDEVQPAVYKKQ
ILVC_PYRIL       GL-KVIIGLRK-----GGNSWNLAVSEGFEVYEVSDAVAQADVIMVLIPDMEQPKVWQNQ
ILVC_PYRAE       GL-EVIIGLRR-----GGKSWELATSEGFRVYEIGEAVRKADVILVLIPDMEQPKVWQEQ
ILVC_PYRCJ       GL-DVIIGARR-----GGNSWEAARRDGFQVYEVGEAVAKADVVMMLIPDMEQPHVWREQ
ILVC_PYRAR       GL-NVILGLRR-----GGKSWDQAVAEGFRVFEIGQAVAKADVVMVLIPDMEQPKVWEEQ
ILVC_PYRAB       GV-HVILGLRP-----SGSSWKRAEKDGFEVYTIEEAVKRADIVHILIPDLVQPKVYREH
ILVC_PYRFU       GV-HVILGLRP-----EGNSWKRAQKDGFEVYTIEEATKRADIVHILIPDLVQPKVYKEK
ILVC_SULTO       GL-KVLVGLER-----EGNSWKVAESDGFNPMHTEDAVKKSDIVIFLVPDMVQRYVYRER
ILVC_SULAC       GI-KVSVGLER-----EGNSWKQAENDGFKPLRTEEAVRNSDIIIFLLPDMIQRTVYLER
ILVC_SACS2       GL-NVVVGLER-----EGKSWELAKSDGITPLHTKDAVKDADIIIFLVPDMVQRTLWLES
ILVC_METKA       GI-DVIIGVRE-----GGPSWERAKKDGFEVLPIPEAAEAGDVVHILIPDEVQPQVYREH
ILVC_METAC       GL-NVVVGLRK-----GSSSWAKAESDGLKVMTVEEAAKAADVIMILLPDEKQASVYYSQ
ILVC_METMA       GL-NVIVGLRQ-----GSSSWAKAESDGLKVMTVDDASRAADVIMILLPDEKQAAVYYSQ
ILVC_METBF       GL-NVIVGLRK-----SSSSWAKAENDGLKVMTVAEAAKAADVIMILLPDENQASVYYSE
ILVC_METBU       GL-DVVIGLRE-----GSRRWKQAEDDGLKVMTVADAAKAADVVQILLPDEIQSKVYYSE
ILVC_METAR       GL-DVVVGLRK-----GGASWEQAKKDGMKVATIEEAAQQADYIQMLIPDELQGKVYHEQ
ILVC_METTP       GL-DVIAADLK-----DSPAWKRAEKDGLRVMTVPEASKEADFIQILLPDELQPRIYREQ
ILVC_ARCFU       GV-NVVVGLPEW----DKATWERAEKDGMVVKKLSEAADGADVIAMLIPDMVQPAVYREH
ILVC_METB6       GL-DVIIGLRK------GKSWDAAAKDGMNVMTVAEAAKKADIIQILLPDELQAAVYKNE
ILVC_METLZ       GL-NVIIGIRA------GKSRDLAKSDGFETYDVAEAAKKGDVIMILVPDENQAAVYKAE
ILVC_METHJ       GL-KVIIGLRP------GKSWDLAKSEGFEVMDVANAAKKADIIQILIPDEQQGAVYKTQ
ILVC_METMJ       GC-RVVIGLRP------GGSWQKASEDGFEVYSVAEAVKRADVIQILLPDENQAAVYRAE
ILVC_KORVE       GV-QVRVGLRP-----SSSSKAKAEKSGLQVGSVSDVAQWADVIMILAPDTEQAAIYEKD
ILVC_SORC5       GV-TVIVALPE-----GSKSRPKAQAAGLQVATVSEAAKAADVIMILAPDTSQARIYNEQ
ILVC_CHLAA       GL-DVRVGLYP-----GSKSWAKVEAAGLKVMTVAEAAREAQIVMILTPDIGQADLYREH
ILVC_ROSCS       GC-DVIVGLYQ-----GSKSWSKAEGLGLKVLPVAEAAKEAQIVMLALPDTAQAAIYRDA
ILVC_SOLUE       GV-DVVVGLPA-----GSKSTAKAEAAGLKVLSPADAAKTANVVMILVPDHIQADLYNNE
ILVC_SYNJA       GV-NVLVGLYP-----GSPSWPKAERDGLTVKTVADAAAAADWVMILLPDEVQKTVFQSE
ILVC_SYNJB       GV-QVIVGLYP-----GSPSWPKAEQDGLMVKTVADAAAAADWVMILLPDEVQKAVFQGE
ILVC_NOSS1       GL-NVIVGLYP-----GSKSAEKAQAAGLTVKNVADAANIADFIMILLPDEVQKTVYKNE
ILVC_TRIV2       GL-NVIVGLYP-----GSKSAEKAQAAGLTVKNVADAANVADFIMILLPDEVQKTVYKNE
ILVC_MICAN       GV-NVIVGLYP-----GSKSAIKAKEAGIPVYDVAEAAKIADWIMILLPDEVQKTIYLNE
ILVC_TRIEI       GS-KVIVGLYS-----GSKSATKAKDAGLDVYPVDEAAEKADLIMILLPDEVQKTVYKNQ
ILVC_SYNY3       GV-NVVVGLYS-----GSKSVAKAEGAGLKVLSVAEAAKAADLIMILLPDEVQKTVYEAE
ILVC_ACAM1       GV-QVIVGLYE-----GSKSAAKAQEAGLTVKSAADAAKAADLIMILLPDEVQRTVYTQD
ILVC_THEEB       GL-NVVVGLYA-----GSRSAERARAEGLAVHPVAEAAKMADWIMILLPDEVQRVVYEQE
ILVC_SYNE7       GV-NVVVGLYP-----GSKSAAKAEAEGLKVLPVAEAAQAADWIMILLPDEFQKSVFENE
ILVC_SYNP6       GV-NVVVGLYP-----GSKSAAKAEAEGPKVLPVAEAAQAADWIMILLPDEFQKSVFENE
ILVC_GLOVI       GI-DVIVGLYE-----GSRSWARAENEGLAVYPTAEAAAKADLVMILLPDEVQREIYNRD
ILVC_SYNPW       GV-DVVVGLYE-----GSRSAEKAKADGLEVLSVAEAAERADWIMVLLPDEFQKDVYAKE
ILVC_SYNR3       GV-DVVVGLYE-----GSRSADKAKADGLEVLSVADAAAKADWIMVLLPDEFQKEVYDKE
ILVC_PROM3       GV-DVVVGLYE-----GSRSAEKARTDGLEVLSVAEASAKADWIMVLLPDEFQKDVYAKE
ILVC_PROMM       GV-DVVVGLYE-----GSRSAEKARADGLEVLSVAEAAAKADWIMVLLPDEFQKDVYAKE
ILVC_SYNSC       GV-NVVVGLYD-----GSRSAEKAKADGLEVLSVADASAKADWIMVLLPDEFQKDVYEKE
ILVC_SYNPX       GV-NVVVGLYD-----GSRSADKAKADGLEVLSVADASAKADWVMVLLPDEFQKDVYEKE
ILVC_SYNS9       GV-NVVVGLYE-----GSRSAEKAKADGLEVLTVAEASAKADWIMVLLPDEFQKDVYEKE
ILVC_SYNS3       GV-NVVVGLYA-----GSRSAEKAKADGLEVLSVADASAKADWIMVLLPDEFQKEVYEKE
ILVC_PROM1       GI-KVVVGLYE-----GSRSASKAKSDGLEVLSVAEASERADWIMILLPDEFQKDVYSKE
ILVC_PROMT       GI-KVVVGLYE-----GSRSASKATSDGLEVLSVAEASERADWIMILLPDEFQKDVYSKE
ILVC_PROMA       GI-DVVVGLYE-----GSRSASKASSDGLEVMSVADASAKADWIMILVPDEFQRDIYAKE
ILVC_PROMS       GM-DVIVGLYK-----GSKSESKAISDGLQVFSVSEACEKADWIMILLPDEFQKDVYLKE
ILVC_PROM2       GM-DVIVGLYK-----GSKSESKAVSDGLQVFSVSEACEKADWIMILLPDEFQKDVYLKE
ILVC_PROM0       GM-DVIVGLYK-----GSKSESKAISDGLKVFSVSEACEKADWIMILLPDEFQKDVYLKE
ILVC_PROM9       GM-DVIVGLYK-----GSKSEGKAVSDGLKVFSVSEACEKADWIMILLPDEFQKDVYLKE
ILVC_PROM5       GM-DVIVGLYK-----GSKSESKAINDGLEVFTVSEACEKADWIMILLPDEFQKDVYIKE
ILVC_PROMP       GM-DVIVGLYK-----GSNSESKAINDGLKVFTVSEACEKADWIMILLPDEFQKDVYIKE
ILVC_ANADE       GV-DVRVGLAA-----GSKSKAKAEGAGLRVLSVAEASKEADVIMVLIPDQTQKKVYDEE
ILVC_THET2       GV-DVRVGLRK-----GSRSWEKAEAAGLRVLPVAEAVREADVVMVLLPDEKQAQVYREE
ILVC_THET8       GV-DVRVGLRK-----GSRSWEKAEAAGLRVLPVAEAVREADVVMVLLPDEKQAQVYREE
ILVC_RUBXD       GC-EVTVGLYR-----GSASWPKAEEAGLRVAEIPETVRWAEVVMMLLPDERQPPVFREQ
ILVC_DEIGD       GL-NVVVGLRE-----GSPSRPKAEQAGLRVTSIEDATREADVIMLLIPDETQPKVYEES
ILVC_DEIRA       GF-NVVVGLRE-----GSSSKAKAEQAGLRVASIEDATKEADVVMLLIPDEQQPAVYEKS
ILVC_LEPBL       GL-KVIIGLKE-----GSKSIQDAKNAGFEVYSVAEASQKADVIQILAPDTIQADLYKKD
ILVC_LEPBJ       GL-KVIIGLKE-----GSKSIQDAKNAGFEVYSVAEASQKADVIQILAPDTIQADLYKKD
ILVC_LEPIC       GL-KVIIGLKE-----GSKSIQDAKNAGFEVYSVSEASQKADIIQILAPDTIQADLYKKD
ILVC_LEPIN       GL-KVIIGLKE-----GSKSIQDAKNAGFEVYSVSEASQKADIIQILAPDTIQADLYKKD
ILVC_CLOD6       GV-HVMIGLYD-----GSKSAQKAKEDGFEVKSVAEATKESDLTMMLMPDEKQKKVYEES
ILVC_TREPR       GV-EVVIGLRP------GPSFDAAMSDGFMPRSVQEAVSIADVAMLLTPDECMADVYAKA
ILVC_HELPH       KV-KVRIGLYQ-----GSLSVSKAKKEGFEVLGVKELVQQSDVIMALLPDELHKEVLEKE
ILVC_HELPJ       KV-KVRIGLYQ-----GSLSVSKAKKEGFEVLGVKELVQQSDVIMALLPDELHKEVLEKE
ILVC_HELPY       KV-KARIGLYQ-----GSLSVSKAKKEGFEVLEVKELVQNSDVIMALLPDELHKEVLEKE
ILVC_HELAH       KV-KVRVGLYQ-----GSLSIPKAKAEGFEVLEVKELVQKSDVIMALLPDELHKEVLEKE
ILVC_ECOK1       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_ECOUT       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_ECO24       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRT
ILVC_ECOL5       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRT
ILVC_ECOL6       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRT
ILVC_SHIDS       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRT
ILVC_SHIBS       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRT
ILVC_SHISS       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRT
ILVC_SHIFL       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRT
ILVC_ECOLC       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDK-QHSDVVRT
ILVC_ECOLI       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDK-QHSDVVRT
ILVC_ECOHS       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDK-QHSDVVRT
ILVC_ECO57       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVHT
ILVC_SALCH       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_SALPB       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_SALTI       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_SALPA       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_SALTY       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_SALAR       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVINLTPDK-QHSDVVRS
ILVC_KLEP7       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_CITK8       GL-DIAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSDVVRS
ILVC_ENT38       GL-DISYALRKEAIAEKRASWRKATENGFKVGTYEELVPQADLVVNLTPDK-QHSDVVRS
ILVC_CROS8       GL-DVSYALRKEAIAEKRASWRKATENGFQVGTYEELIPQADLVVNLTPDK-QHSDVVRA
ILVC_YERP3       GL-DVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSAVVKA
ILVC_YERPS       GL-DVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSAVVKA
ILVC_YERPA       GL-DVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSAVVKA
ILVC_YERPP       GL-DVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSAVVKA
ILVC_YERPN       GL-DVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSAVVKA
ILVC_YERPE       GL-DVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSAVVKA
ILVC_YERE8       GL-DVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDK-QHSAVVQA
ILVC_SERP5       GL-DVAYALRKEAIDEKRPSWRKATENGFKVGTYEDLIPQADLVVNLTPDK-QHTSVVRA
ILVC_PECAS       GL-DIAYALRAEAIAEKRASWRKATENGFTVGTYEDLIPQADLIVNLTPDK-QHSAVVQA
ILVC_PHOLL       GL-DIAYALRKEAIEEKRASWRKATENGFQVGTYEELIPQADLVINLTPDK-QHSSVVSA
ILVC_SODGM       GL-DIAYALRKEAIAEKRPSWRKATENGFRVGTYEELVPEAGLVVNLTPDK-QHSAVVQA
ILVC_AERHH       GL-DISYALRKAAITEKRASWQKATDNGFAVGTYEELIPTADLVLNLTPDK-QHSDVVKT
ILVC_AERS4       GL-DISYTLRKAAITEKRASWQKATDNGFAVGTYEELIPTADLVLNLTPDK-QHSDVVKT
ILVC_HAEIE       GL-DISYALRPEAIAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDK-QHSKVVAD
ILVC_HAEIN       GL-DISYALRPEAIAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDK-QHSKVVAD
ILVC_HAEI8       GL-DISYALRPEAIAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDK-QHSKVVAD
ILVC_HAEIG       GL-DISYALRPEAIAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDK-QHSKVVAD
ILVC_PASMU       GL-DISYALRAEAIAEKRASFQRATENGFKVGTYDELIPSADLVVNLTPDK-QHSKVVAD
ILVC_MANSM       GL-DISYALRPEAITEKRASFQRATENGFKVGTYQELIPTADLVVNLTPDK-QHSKVVAD
ILVC_ACTSZ       GL-DISYALRKAAIEEKRPSFQRATENGFKVGTYEELIPTADLVINLTPDK-QHSKVVSD
ILVC_ACTP2       GL-DISYALRAEAIAEKRASFTRATENGFKVGTYQELIPTADLVINLTPDK-QHSKVVAD
ILVC_HISS2       GL-DIAYALRPEAIEEKRASFQRASENGFVVGTYQQLIPTADLVINLTPDK-QHSKVVAD
ILVC_HAES1       GL-DIAYALRPEAIEEKRASFQRASENGFVVGAYQQLIPTADLVINLTPDK-QHSKVVAD
ILVC_VIBVY       GL-DVAYALRQAAIDEQRQSYKNAKENGFEVGSYETLIPQADLVVNLTPDK-QHTNVVET
ILVC_VIBVU       GL-DVAYALRQAAIDEQRQSYKNAKENGFEVGSYETLIPQADLVVNLTPDK-QHTNVVET
ILVC_VIBPA       GL-DVSYALRQAAIDEQRQSFKNAKDNGFEVGSYETLIPQADLVVNLTPDK-QHTNVVET
ILVC_ALIF1       GL-DVAYALRQAAIDEQRQSYKNAKENGFEVASYETLIPQADLVINLTPDK-QHTNVVET
ILVC_VIBCH       GL-DVSYALRQAAIDEQRQSFKNAKNNGFNVGSYEQLIPTADLVINLTPDK-QHTSVVNA
ILVC_VIBC3       GL-DVSYALRQAAIDEQRQSFKNAKNNGFNVGSYEQLIPTADLVINLTPDK-QHTSVVNA
ILVC_PHOPR       GL-DVSYALRQAAIDEQRQSYKNAKENGFDVGSYEQLIPIADLVVNLTPDK-QHSNVVET
ILVC_SHEON       GL-NIAYALRPEAIAQKRASWQKATDNGFKVGTFEELIPSADLVLNLTPDK-QHSNVVSA
ILVC_BUCAI       GL-NISYALKKNSIANKNQSWINAIENNFKVDDYDALIPDADLVINLTPDK-QHHSVIKK
ILVC_BUCDN       GL-NISYALRKNSILKKNQSWINATKNNFLVGDYESLIPNADLVINLTPDK-QHSNVVKE
ILVC_BUCAP       GL-NISFALKKNSILRKNSSWLNATKNNFEVNDYESLIPNADLVINLTPDK-QHENVVKE
ILVC_BUCMH       GL-NISYALRDDSIFNKNQSWINATSNGFFVGTYENIIPTADLVINLTPDK-QHEQVVNV
ILVC_BUCSC       GL-HVSYALRGSSILNKNKSWENATKNNFFVDTYENIIPTADLVINLTPDK-QRKEVVTL
ILVC_BUCBP       GL-NVKYALRKNSIISQRSSWKRAIDNKFLVGTCEELIPTADLVINLTPDK-QHEHVVDV
ILVC_BLOFL       GL-NITYALRRDSIINQSQSYIRAMKYGFSVGTYDELIPEADFVINLIPDK-YHESLIQK
                                        .                         *          

ILVC_LEUMM       VEPNLKAGSYLGFSHGFNIVYGLIKPNADINVMIIAPKGPGNIERRQFVEGGGIPSLYGV
ILVC_LEUMC       VEPNLKAGSDLGFSHGFNIVYGLIKPNADINVMIIAPKGPGNIERRQFVEGGGIPSLYGV
ILVC_STAES       IKPYLEKGNALAFAHGFNIHFSVIEPPSDVDVFLVAPKGPGHLVRRTFVEGSAVPALFGV
ILVC_STAEQ       IKPYLEKGNALAFAHGFNIHFSVIEPPSDVDVFLVAPKGPGHLVRRTFVEGSAVPALFGV
ILVC_STAA1       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAA9       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAB       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAN       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAM       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAW       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAR       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAA2       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAA8       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAE       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAC       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAT       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAA3       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAAS       IEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGI
ILVC_STAHJ       IEPNLEAGNALAFAHGFNIHFEVIKPPKDVDVFLVAPKGPGHLVRRTFVEGTAVPALFGV
ILVC_STAS1       IEPNLEANNALVFAHGFNIHFGVIQPPENVDVFLVAPKGPGHLVRRTFAEGSAVPALFAV
ILVC_LISMF       IKPNLKAGNALVFAHGFNIHFDVINPPSDVDVFLVAPKGPGHLVRRTFVEGGAVPSLFAI
ILVC_LISIN       IKPNLKAGNALVFAHGFNIHFDVINPPSDVDVFLVAPKGPGHLVRRTFVEGGAVPSLFAI
ILVC_LISW6       IKPNLKAGNSLVFAHGFNIHFDVINPPNDVDVFLVAPKGPGHLVRRTFVEGGAVPSLFAI
ILVC_LISMO       IKPNLKAGNSLVFAHGFNIHFDVINPPSDVDVFLVAPKGPGHLVRRTFVEGGAVPSLFAI
ILVC_STRR6       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAV
ILVC_STRPN       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAV
ILVC_STRP2       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAV
ILVC_STRSV       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRGC       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRT2       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRT1       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRTD       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRTR       IAPNLEAGNAVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRS2       IAPNLEAGNALGFAHGFNVHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRSY       IAPNLEAGNALGFAHGFNVHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAV
ILVC_STRMU       IAPNLSAGKALGFAHGFNIHFGYIKAPEDVDVFMVAPKGPGHLVRRTYTEGFGVPSLYAV
ILVC_LACLM       IKPNLKAGSALGFAHGFNIHFGYIEVPEDVDVFMVAPKAPGHLVRRTFTEGFGTPALFVS
ILVC_LACLS       IKPNLKSGSALGFAHGFNIHFGYIEVPEDVDVFMVAPKAPGHLVRRTFTEGFGTPALFVS
ILVC_LACLA       IKPNLKAGSALGFAHGFNIHFGYIKVPEDVDVFMVAPKAPGHLVRRTYTEGFGTPALFVS
ILVC_RHIME       IAGNIRDGAAIAFAHGLNVHFGLIEPKASVDVVMIAPKGPGHTVRGEYQKGGGVPCLVAV
ILVC_SINMW       IAGNIRDGAAIAFAHGLNVHFGLIEPKASVDVVMIAPKGPGHTVRGEYQKGGGVPCLVAV
ILVC_RHIEC       IAPNIRDGAAIAFAHGLNVHFGLIEPKASVDVVMIAPKGPGHTVRGEYQKGGGVPCLVAV
ILVC_RHIL3       IAGNIRDGAAIAFAHGLNVHFGLIEPKASVDVVMIAPKGPGHTVRGEYQKGGGVPCLVAV
ILVC_AGRFC       IAGNIRDGAAIAFAHGLNVHFGLIEPKASLDVVMIAPKGPGHTVRGEYQKGGGVPCLVAV
ILVC_RHILO       IAPNIRDGAAIAFAHGLNVHFGLIEPKSTVDVVMIAPKGPGHTVRGEYQKGGGVPCLVAV
ILVC_CHESB       IAPNIRDGAAIAFAHGLNVHFGLIEPKKTVDVLMIAPKGPGHTVRSEYQRGGGVPCLVAV
ILVC_BRUO2       IHNNLRDGAAIAFAHGLNVHFGLIEPKKTVDVVMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_BRUSU       IHNNLRDGAAIAFAHGLNVHFGLIEPKKTVDVVMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_BRUC2       IHNNLRDGAAIAFAHGLNVHFGLIEPKKTVDVVMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_BRUAB       IHNNLRDGAAIAFAHGLNVHCGLIEPKKTVDVVMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_BRUA2       IHNNLRDGAAIAFAHGLNVHCGLIEPKKTVDVVMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_BRUME       IHNNLRDGAAIAFAHGLNVHCGLIEPKKTVDVMMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_BRUSI       IHNNLRDGAAIAFAHGLNVHFGLIEPKKTVDVVMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_OCHA4       IHDNLRDGAAIAFAHGLNVHFGLIEPKKSVDVVMIAPKGPGHTVRGEYQKGGGVPCLIAI
ILVC_BART1       IHDHLRDGAAVAFAHGLSIHFGLIEPKKTVDVVMIAPKGPGHTVRHEYQRGCGVPCLIAV
ILVC_BARHE       IHDHLRDGAVIAFAHGLSIHFGLIEPKKTVDVVMIAPKGPGHTVRNEYQNGCGVPCLIAV
ILVC_BARQU       MHDDLRDGAVIAFAHGLSIHFGLIEPKKTVDVVMIAPKGPGHKVRNEYQRGCGVPCLIAV
ILVC_BARBK       IHDHLRDGAAISFAHGLSIHFGLIKVKKTVDVVMIAPKGAGRAVRSEYQHGRGIPCLIAV
ILVC_RHOPB       LHDNMKNGAALLFAHGLNVHFNLIEPRADLDVVMVAPKGPGHTVRSEYQRGGGVPCLIAV
ILVC_RHOP5       LHDNMKQGAALLFAHGLNVHFNLIDPRADLDVLMIAPKGPGHTVRGEYLKGGGVPCLIAI
ILVC_RHOP2       LHDNMKQGAALLFAHGLNVHFNLIEPRADLDVLMVAPKGPGHTVRSEYQRGGGVPSLIAI
ILVC_RHOPS       LHDNMKQGAALLFAHGLNVHFNLIEPRADLDVLMVAPKGPGHTVRSEYQRGGGVPSLIAI
ILVC_RHOPA       LHDNMKQGAALLFAHGLNVHFNLIEPRADLDVLMVAPKGPGHTVRSEYQRGGGVPCLIAI
ILVC_BRASO       LHDNMKQGAALVFAHGLNVHFNLLDPRADLDVLMIAPKGPGHTVRSEYQRGGGVPCLIAI
ILVC_BRASB       LHDNMKQGAALVFAHGLNVHFNLLDPRPDLDVLMIAPKGPGHTVRSEYQRGGGVPCLIAI
ILVC_NITWN       LHDNMKKGAALIFAHGLNVHFNLLDPRADLDVLMIAPKGPGHTVRAEYQRGGGVPCLIAV
ILVC_NITHX       LHDNMKKGAALIFAHGLNVHFNLLDPRADLDVLMIAPKGPGHTVRSEYQRGGGVPCLIAV
ILVC_BRADU       LHDNMKKGAALVFAHGLNVHFNLLDPRADLDVLMIAPKGPGHTVRSEYQRGGGVPCLIAI
ILVC_AZOC5       LHDNMKQGAALLFAHGLNVHFNLIEPRKDLDVLMIAPKGPGHTVRSEYQRGGGVPTLIAI
ILVC_PARL1       LHENMKPGSALLFAHGLNIHFNLIEPRKDIDVLMVAPKGPGHTVRSEYKRGGGVPSLIAV
ILVC_MAGSA       LAANMKQGASLVFAHGLNIHFKLIEARADLDVFMVAPKGPGHTVRGEYVKGGGVPCLVAV
ILVC_PHAMO       LAANLKPGAALVFAHGLAIHFKLIEARADLDVFMVAPKGPGHTVRGEYLKGGGVPCLVAV
ILVC_RHORT       LHANMKQGAALAFAHGLNIHFALIEPRPDLDVFMIAPKGPGHTVRSEYVRGGGVPCLVAV
ILVC_GRABC       LHANLRPGAALAFAHGLNIHFNLIEPRSDIDVFMIAPKGPGHTVRGEYQKGGGVPCLVAV
ILVC_ACICJ       LAANLKPGAAIAFAHGLNIHFNLIEPRADIDVFMIAPKGPGHTVRSEYQRGGGVPCLVAV
ILVC_GLUDA       LEANLKQGAALAFAHGLSIHFRIIEARPDLDVFLIAPKGPGHTVRSEYQRGGGVPSLVAV
ILVC_GLUOX       LEKNLKPGAALAFAHGLSIHFRIIEARPDLDVFLIAPKGPGHTVRSEYLRGGGVPSLVAV
ILVC_CAUSK       IAPNIRDGAALLFAHGLNVHFGLIEPKDTIDVLMVAPKGPGHTVRGEYQKGGGVPCLIAV
ILVC_CAUVC       IALNIRDGAALLFAHGLNVHFGLIEPKDTIDVLMVAPKGPGHTVRGEYQKGGGVPCLIAV
ILVC_RHOS1       VHDNLREGSAIAFAHGLNVHFGLIEPKPGVDVIMMAPKGPGHTVRGEYVKGGGVPCLVAV
ILVC_RHOS4       VHDNLREGSAIAFAHGLNVHFGLIEPKPGVDVIMMAPKGPGHTVRGEYVKGGGVPCLVAV
ILVC_RHOS5       VHDNLKEGSAIAFAHGLNVHFGLIEPKPGVDVIMMAPKGPGHTVRGEYVKGGGVPCLVAV
ILVC_PARDP       VHDNLREGAAIAFAHGLNVHFGLIEPKPGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAV
ILVC_DINSH       VHDNIREGAAIAFAHGLNVHFGLIEPKAGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAV
ILVC_ROSDO       VHDNIREGAAIAFAHGLNVHFGLIEPKEGIDVIMMAPKGPGHTVRGEYTKGGGVPCLVAV
ILVC_JANSC       VHDNLKDGAAIAFAHGLNVHFGLIEPKPGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAV
ILVC_RUEPO       VHDNIRPGAAIAFAHGLNVHFGLIEPKEGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAV
ILVC_RUEST       VHDNIKPGAAIAFAHGLNVHFGLIEPKEGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAV
ILVC_ERYLH       LAGNMKPGSALAFAHGLNIHFGLIEPPAEIDVIMIAPKGPGHTVRSEYQRGGGVPCLIAV
ILVC_NOVAD       LHANMKPGAALAFAHGLNIHFGLIEARADIDVIMIAPKGPGHTVRSEYQRGGGVPCLIAV
ILVC_SPHAL       IGPNMKPGAALAFAHGLNIHFGLIEARPDIDVFMVAPKGPGHTVRSEYQKGGGVPCLIAV
ILVC_SPHWW       LRDNLKPGAALAFAHGLNVHFGLIEPRADIDVFMIAPKGPGHTVRSEYQRGGGVPCLIAI
ILVC_ZYMMO       LKDNLRPGSAIAFAHGLNIHFGLIEPRKDIDVFMIAPKGPGHTVRSEYVRGGGVPCLVAV
ILVC_PELUB       IEQRIKQGTSLAFAHGLNIHYKLIDARKDLDVFMVAPKGPGHLVRSEFERGGGVPCLFAV
ILVC_HYPNA       IEPHLRAGQHLMFGHGFNIHYNLIRPRADVDVSLSAPKGPGHTLRNQYQMGFGLPGLIAI
ILVC_GEOUR       IAPYVKQGAYLAFGHGFNIHFGQIVPRHDINVIMVAPKGPGHLVRHEYTKGGGVPSLIAI
ILVC_GEOMG       IGPFLKQGAYLAFSHGFNIHFGQIVPRPDVNVIMIAPKGPGHLVRHEYTKGGGVPSLIAI
ILVC_GEOSL       VGPYLKQGAYLAFGHGFNIHFGQITPRPDINVIMAAPKGPGHLVRHEYTRGGGVPCLIAI
ILVC_PELPD       IGPNLKEGATIAFGHGFNIHFGQIEPRADINVFMVAPKGPGHMVRHEYTRGGGVPCLVAI
ILVC_MAGMM       IAPNLKDDAALVFAHGFNIHYGQIEAPAGVDVFLVAPKGPGHLVRAEYLRGGGVPSLVAI
ILVC_METCA       IAPNIKQGAALAFAHGFNIHFEQITPRADLDVIMIAPKGPGHLVRSTYTQGGGVPSLIAV
ILVC_NITOC       IEPHLKQNATLAFAHGFNIHFRQIEPRADLDVIMVAPKGPGHLVRSTYTQGGGVPSLIAV
ILVC_VESOH       IEPNLKQGATLAFAHGFNIHYNRIIPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAV
ILVC_RUTMC       IEPNLKQGATLAFAHGFNIHYNRIIPRTDLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAV
ILVC_ALKEH       IAPNVKPGAAIAFAHGFNIHFGQIQPAADLDVIMVAPKGPGHLVRSTYVEGGGVPSLIAI
ILVC_HALHL       VAPNLKDGAAIAFAHGFNIHYGQIQPAADHDVIMIAPKGPGHTVRSTYVAGAGVPSLIAI
ILVC_NITEU       VEPVLKKNATLAFAHGFNVHYGQIIPREDLDVIMVAPKGPGHLVRSTYTQGGGVPSLIAV
ILVC_NITEC       VEPALKKNATLAFAHGFNIHYGQIIPREDLDIIMIAPKGPGHLVRSTYIQGGGVPSLIAV
ILVC_NITMU       IEPNLKKGATLAFAHGFNIHYGQVAPREDLDVIMIAPKGPGHLVRSTYLQGGGVPSLIAV
ILVC_CUPMC       VHANIKEGAALAFAHGFNVHYGAVIPRADLDVIMIAPKAPGHTVRSTYAQGGGVPHLIAV
ILVC_CUPNH       VHDNIKEGAALAFAHGFNVHYGAVIPRADLDVIMIAPKAPGHTVRATYTQGGGVPHLIAV
ILVC_CUPPJ       VHDNIKAGAALAFAHGFNVHYGAVVPRADVDVIMIAPKAPGHTVRATYTQGGGVPHLIAV
ILVC_RALSO       VHGNIKQGAALAFAHGFNVHYGAVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURM7       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURPS       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURP1       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURP0       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURM9       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURMS       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURMA       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURP6       VHANIKEGAALAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURTA       VHANIKEGATLAFAHGFNVHYGQVIPRADLDVIMVAPKAPGHTVRGTYAQGGGVPHLIAV
ILVC_BURCH       VHANIKQGAALAFAHGFNVHYGQVIPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_BURVG       VHANIKQGAALAFAHGFNVHYGQVIPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_BURCA       VHANIKQGAALAFAHGFNVHYGQVIPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_BURCM       VHANIKQGAALAFAHGFNVHYGQVIPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_BURL3       VHANIKQGAALAFAHGFNVHYGAVIPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_PARXL       VHANIKQGAALAFAHGFNVHYGQVIPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_POLAQ       VHGNIKQGAALAFAHGFNVHYGQVQPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_JANMA       VAPYAKQGAVLAFAHGFNVHYGQVVPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_HERAR       VAPHAKQGAVLAFAHGFNVHYGQVVPRADLDVIMIAPKAPGHTVRGTYSQGGGVPHLIAV
ILVC_POLNA       VAPNIKQGASLVFAHGFNVHYGAVIPRDDLDVWMVAPKAPGHTVRNTYTQGGGVPHLVAV
ILVC_POLSJ       VAPNIKQGASLVFAHGFNVHYGAVIPRADLDVWMVAPKAPGHTVRNTYTQGGGVPHLVAV
ILVC_RHOFT       IEPNIKQGASLVFAHGFNVHYGLVTPRADLDVWMVAPKAPGHTVRGTYVQGGGVPQLIAI
ILVC_METPP       VAPNIKQGASLAFAHGFNVHYGQVVPREDLDVWMVAPKAPGHTVRNTYTQGGGVPHLIAV
ILVC_BORBR       VHANIKAGAALAFAHGFNVHYGQVVPREDIDVIMVAPKAPGHTVRSTYSQGGGVPHLIAV
ILVC_BORPA       VHANIKAGAALAFAHGFNVHYGQVVPREDIDVIMVAPKAPGHTVRSTYSQGGGVPHLIAV
ILVC_BORPE       VHANIKAGAALAFAHGFNVHYGQVVPREDIDVIMAAPKAPGHTVRSTYSQGGGVPHLIAV
ILVC_BORA1       VHANIKPGAALAFAHGFNVHYGQVVPREDIDVIMVAPKAPGHTVRSTYSQGGGVPHLVAV
ILVC_CHRVO       IAPNLKKGAALAFAHGFNIHYNQIVPPADVDVIMVAPKGPGHTVRSEYLKGGGVPTLIAV
ILVC_METFK       IEPNLKKGAALAFAHGFNIHYNQIVPSKDLDVIMIAPKGPGHTVRSEYLKGGGVPSLIAV
ILVC_AZOSB       VEPNIKKGATLAFAHGFNVHYNQVVPREDLDVIMVAPKGPGHTVRSEYLRGGGVPSLIAV
ILVC_DECAR       VAPNLKKGAALAFAHGFNVHYNQVVPRADVDVIMVAPKGPGHTVRSEYLKGGGVPSLIAV
ILVC_AROAE       VEPNIKQGATLAFAHGFNVHYNQVVPRDDLDVIMVAPKGPGHTVRSEYLKGGGVPSLIAV
ILVC_ACIAC       VEPNIKQGASLAFAHGFNVHYNQVVPRADLDVWMVAPKAPGHTVRSTYSQGGGVPHLVAV
ILVC_ACISJ       VEPHIKQGASLAFAHGFNVHYNQVVPRADLDVWMVAPKAPGHTVRNTYTQGGGVPHLVAV
ILVC_NEIMF       VTANLKEGATLAFAHGFNVHYNQIVPRADLDVIMVAPKGPGHTVRSEYKRGGGVPSLIAV
ILVC_NEIMB       VTANLKEGATLAFAHGFNVHYNQIVPRADLDVIMVAPKGPGHTVRSEYKRGGGVPSLIAV
ILVC_NEIM0       VTANLKEGATLAFAHGFNVHYNQIVPRADLDVIMVAPKGPGHTVRSEYKRGGGVPSLIAV
ILVC_NEIMA       VAANLKEGATLAFAHGFNVHYNQIVPRADLDVIMVAPKGPGHTVRSEYKRGGGVPSLIAV
ILVC_NEIG1       VAANLKEGATLAFAHGFNVHYNQIVPRADLDVIMVAPKGPGHTVRSEYKRGGGVPSLIAV
ILVC_PSEAB       IEPNLKKGATLAFAHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEAE       IEPNLKKGATLAFAHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEA7       IEPNLKKGATLAFAHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEU5       VEPNLKQGATLAFAHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEU2       VEPNLKKGATLAFSHGFAIHYNQVVPRADLDVIMIAPKAPGHTVRTEFVKGGGIPDLIAV
ILVC_PSE14       VEPNLKKGATLAFSHGFAIHYNQVVPRADLDVIMIAPKAPGHTVRTEFVKGGGIPDLIAV
ILVC_PSESM       VEPNLKKGATLAFSHGFAIHYNQVVPRADLDVIMIAPKAPGHTVRTEFVKGGGIPDLIAV
ILVC_PSEMY       IEPNIKKGATLAFSHGFAIHYNQVVPRADLDVIMIAPKAPGHTVRTEFVKGGGIPDLIAV
ILVC_PSEPF       IEPNIKKGATLAFSHGFAIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEF5       IEPNIKKGATLAFSHGFAIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEPK       IEPNIKKGATLAFSHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEP1       IEPNIKKGATLAFSHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEPG       IEPNIKKGATLAFSHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_PSEE4       IEPNIKKGATLAFSHGFAIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_ALCBS       IEPNLKEGATLAFAHGFAIHYNQIVPRADLDVIMIAPKAPGHTVRTEFTKGGGIPDLIAI
ILVC_MARHV       IEPNLKQGATLAFAHGFAIHYNQIVPRKDLDVIMVAPKAPGHTVRTEFTKGGGIPDLIAI
ILVC_HAHCH       IEPNLKSGATLAFAHGFSIHYNQIVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_SACD2       IEPNIKQGATLAFAHGFAIHYNQVVPRADLDVIMVAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_HYDCU       IEPNIKQGAVLAFAHGFAIIYNQIEPRKDLDVIMIAPKAPGHTVRSEFVRGGGIPDLIAI
ILVC_PSYCK       IEPNIKQGATLAFAHGFAIHYNQVIPRSDLDVIMVAPKAPGHTVRSEFAKGGGIPDLIAI
ILVC_PSYA2       IEPNIKQGATLAFAHGFAIHYNQVIPRSDLDVIMVAPKAPGHTVRSEFAKGGGIPDLIAI
ILVC_PSYWF       IEPNIKEGATLAFAHGFAIHYNQVVPRKDLDVIMVAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_ACIAD       IEPNIKEGATLAFAHGFSVLYNQVVPRQDLDVIMVAPKAPGHTVRSEFQRGSGVPDLIAI
ILVC_THIDA       IEPNIKQGATLAFAHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAI
ILVC_CHRSD       IAPNLKQGATLAFAHGFNIHYNQVTPRADLDVIMIAPKAPGHTVRSEFVRGAGVPDLIAV
ILVC_PRB01       IKPNLKTSAILAFAHGFNIHFEKIVPEATNSVIMIAPKGPGHTVRSTYTNGGGVPSLIAI
ILVC_ARCB4       IKPNLKDGAYLAFGHGFNIHYKRIIPCSKTNVMMIAPKAPGHTVRSEFVKGGGIPDLIAV
ILVC_SULDN       IEPNLKNGATIAFGHGFNIHYGRIHPRADINVTMIAPKAPGHTVRSEFVRGGGIPDLIAV
ILVC_NITSB       IEPNLKESDTIAFGHGFNIHYGRIKPRADINVMMVAPKAPGHTVRSEFVKGGGIPDLIAV
ILVC_HELHP       ILPSLSEDKIIAFGHGFNIHFGQIKAPKGVGVIMVAPKAPGHTVRSEFVKGGGIPDLIAV
ILVC_WOLSU       ILPNLSEGKAIAFGHGFNVHFGQIKAPKGVDVIMIAPKAPGHTVRSEFVKGGGIPDLIAV
ILVC_CAMC5       IEPNLKDGAAIAFGHGFNVHFGQIKAPKNIDVIMIAPKAPGHTVRSEFVRGGGIPDLIAV
ILVC_CAMC1       IEPNLKDHAAIAFGHGFNVHFGQIKAPANIDVIMIAPKAPGHTVRSEFLRGGGIPDLIAV
ILVC_CAMFF       IEPNLSEGNAIAFGHGFNIHYGQIIPPKGIDCIMIAPKAPGHTVRNEFVNGGGIPDLIAV
ILVC_CAMHC       IKDNLKEGDTIAFGHGFNIHYGQIVPPKGVDCIMVAPKAPGHTVRSEFVKGGGVPNLIAV
ILVC_CAMJ8       IKPNLSEGKAIAFAHGFNIHYGQIVAPKGIDVIMIAPKAPGHTVRNEFTLGGGTPCLIAI
ILVC_CAMJJ       IKPNLSEGKAIAFAHGFNIHYGQIVAPKGIDVIMIAPKAPGHTVRNEFTLGGGTPCLIAI
ILVC_CAMJR       IKPNLSEGKAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAI
ILVC_CAMJE       IKPNLSEGKAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAI
ILVC_CAMJD       IKPNLSEGKAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLIAI
ILVC_MYCSK       IEPNLEDGNALFFGHGLNIHFGLIKPPANVTVGMVAPKGPGHLVRRQFVDGKGVPCLIAI
ILVC_MYCSJ       IEPNLEDGNALFFGHGLNIHFGLIKPPANVTVGMVAPKGPGHLVRRQFVDGKGVPCLIAI
ILVC_MYCSS       IEPNLEDGNALFFGHGLNIHFGLIKPPANVTVGMVAPKGPGHLVRRQFVDGKGVPCLIAI
ILVC_MYCVP       IEPNLEDGNALFFGHGLNIHFGLIKPPANVTIGMVAPKGPGHLVRRQFVDGKGVPCLIAI
ILVC_MYCGI       IEPNLEDGNALFFGHGLNIHFGLIKPPANVTIGMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_MYCS2       IEPNLEDGNALFFGHGLNIHFGLIKAPENVTVGMVAPKGPGHLVRRQFVDGKGVPCLIAI
ILVC_NOCFA       IEPNLKDGDALFFGHGLNIHFGLIKPPANVTIGMVAPKGPGHLVRRQFVDGKGVPALIAI
ILVC_RHOJR       IEPNLKDGDALFFGHGLNIHFDLIKAPEFVTVGMVAPKGPGHLVRRQFVDGKGVPALIAI
ILVC_MYCPA       IEPNLSDGDALFFGHGLNIHFGLIKPPAEVTVAMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_MYCA1       IEPNLSDGDALFFGHGLNIHFGLIKPPAEVTVAMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_MYCAV       IEPNLSDGDALFFGHGLNIHFGLIKPPAEVTVAMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_MYCUA       IEPNLKPGDALFFGHGLNVHFGLIKPPADVTVAMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_MYCLE       IEPNLQPGDALFFGHGLNIHFELVKPSGDVTVAMVAPKGPGYLVRRQFVDGKGVPCLIAV
ILVC_MYCBP       IEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAV
ILVC_MYCTA       IEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAV
ILVC_MYCTU       IEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAV
ILVC_MYCBO       IEPNLKPGDALFFGHGLNVHFGLIKPPADVAVAMVAPKGPGHLVRRQFVDGKGVPCLVAV
ILVC_CORGL       IEPNLNAGDALLFGHGLNIHFDLIKPADDIIVGMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_CORGB       IEPNLNAGDALLFGHGLNIHFDLIKPADDIIVGMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_COREF       VEPNLNEGDALFFGHGLNIHFDLIKPADNIIVGMVAPKGPGHLVRRQFVDGKGVPCLIAI
ILVC_CORJK       IEPNLNDGDALFFGHGLNIHFKLIEPADNIIIGMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_CORDI       IEPNLKDGDALLFGHGLNIHFELIKPAVNITVGMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC1_STRCO      IKDNLKDGDALFFGHGLNIRYGFIKPPAGVDVCMVAPKGPGHLVRRQYEEGRGVPCIAAV
ILVC2_STRCO      IKDNLKDGDALFFGHGLNIRYGFVKPPAGVDVCMVAPKGPGHLVRRQYEEGRGVPCLVAV
ILVC_STRAW       IKDNLKDGDALFFGHGLNIRFGFIKPPAGVDVCMVAPKGPGHLVRRQYEEGRGVPCIAAV
ILVC_SALAI       IAPHLAAGKALFFGHGFNIRYGLIQPPADVDVAMVAPKGPGHLVRRQYVDGKGVPCLVAV
ILVC_SALTO       IAPHLTAGKALLFGHGFNIRYGLITPPVDVDVAMIAPKGPGHLVRRQYVDGKGVPCLVAV
ILVC_SACEN       IAPNLKSGDALFFGHGFNIRYGLIKPPSDVDVAMVAPKGPGHLVRRQFVDGKGVPCLIAV
ILVC_FRAAA       IAPHLSEGKALAFGHGFNIRYGLIEPPAGVDVFMVAPKGPGHLVRRVFEEGKGVPVLVAV
ILVC_FRACC       IAPHLTAGKALAFGHGFNIRYGLIEPPAGVDVFMVAPKGPGHLVRRVFEEGKGVPVLVAV
ILVC_THEFY       IAPHLNEGDALFFGHGFSIRYGLITPPEGVDVAMVAPKGPGHLVRRQFEAGRGVPVLVAV
ILVC_CLAMS       VRDNLTEGKTLVFAHGFNIRFGYIEAPEGVDVVLVAPKGPGHTVRREFEAGRGVPVIVAV
ILVC_CLAM3       VRDNLTEGKTLVFAHGFNIRFGYIEAPEGVDVVLVAPKGPGHTVRREFEAGRGVPVIVAV
ILVC_LEIXX       IRANLEAGNALVFGHGFNIRFGYIEAPEGVDVIMVAPKGPGHTVRREYEAGRGVPVIVAV
ILVC_ARTS2       IKDKLTPGKALAFAHGFNIRFGYIKAPEGVDVILIAPKAPGHTVRREFEAGRGIPDIIAV
ILVC_RENSM       IAANLQAGDALFFGHGFNIRYGYIQPPADVDVALVAPKGPGHIVRREFEAGRGVPDLIAV
ILVC_KINRD       IEPNLTAGKALFFSHGFNIRFGYIKPPADVDVVMVAPKGPGHLVRREYVDGRGVPVIVAV
ILVC_CUTAK       IAPHLKDGDALFFAHGFNVHFGYIKAPQGVDVCMVAPKGPGHIVRREYSDGRGVPVLVCV
ILVC_TROW8       IKHNLSEGDALLFSHGFNIRYGYITPPDGVDVLMVAPKGPGHMVRREYLDNRGTPAVFAI
ILVC_TROWT       IKHNLSEGDALLFSHGFNIRYGYITPPDGVDVLMVAPKGPGHMVRREYLDNRGTPAVFAI
ILVC1_BIFLO      IEPNIKPGAAVAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAV
ILVC2_BIFLO      VEPNLKPGAALAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAV
ILVC_XYLFA       LAPNIKQGACLLFAHGLNVHYGMITPRSDLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_XYLFT       LAPNIKQGACLLFAHGLNVHYSLITPRSDLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_XANAC       IAPNMKQGACLLFAHGLNVHFDMITPRADLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_XANC5       IAPNMKQGACLLFAHGLNVHFDMIKPRADLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_XANOM       IAPNMKQGACLLFAHGLNVHFDMITPRADLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_XANOR       IAPNMKQGACLLFAHGLNVHFDMITPRADLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_XANCP       IAPNMKQGACLLFAHGLNVHFDMIKPRADLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_XANC8       IAPNMKQGACLLFAHGLNVHFDMIKPRADLDVVLVAPKGPGALVRREYEIGRGVPCIYAV
ILVC_CHLPM       IAPNMEPGNTLAFAHGFNIHYKQIVPPDTINVIMIAPKSPGHLVRRTFTEGNGVPCLIAI
ILVC_CHLPD       IAPNLVPGNTLAFAHGFNIHYKQIIPQETINVIMIAPKSPGHLVRRTFTQGNGVPCLIAV
ILVC_CHLCH       IAPNLEPGNTLAFGHGFNIHYKQIVPASSVNVIMIAPKSPGHLVRRTYTEGNGVPCLIAV
ILVC_PELLD       IAPNMVAGNTLAFGHGFNIHYNQIVPPADVDVIMIAPKSPGHLVRRTYTEGNGVPCLIAV
ILVC_CHLTE       IAPNLKSGATLAFGHGFNIHYKQIVPPADVNVIMIAPKSPGHLVRRTYTEGNGVPCLIAV
ILVC_SALRD       IAEHMTPGTALGFGHGFNIHYDRIEPPEAVDVFMVAPKSPGHLVRRTYTDGSGVPCLAAV
ILVC_NATPD       IEDVLQPGDTLQFAHGFNIHYGQIEPSEDVNVTMVAPKSPGHLVRRNYENDEGTPGLLAV
ILVC_HALMA       IEDELDAGDTLQFAHGFNIHYGQIEPPEDVDVTMVAPKSPGHLVRRTYERGEGTPGLIAV
ILVC_DESVV       IKPNLKAGDALLFAHGFNIHFGQIEPPKDVDVFMIAPKGPGHLVRRTYTEGGGVPCLVAV
ILVC_DESVH       IKPNLKAGDALLFAHGFNIHFGQIEPPKDVDVFMIAPKGPGHLVRRTYTEGGGVPCLVAV
ILVC_DESAG       IKPHLTAGKSLVFAHGFNIHFNQIVPPKDVDVFMIAPKGPGHLVRRTYTEGGGVPCLVAI
ILVC_RHOBA       IRDNLSEGNVLMCSHGFNIHFGQIDPPKGIDTLLVAPKGPGHLVRSEYEKGGGVPALIAL
ILVC1_BACC1      IAPNLQAGNSLVFAHGFNVHFDQVKPPANVDVFLVAPKGPGHLVRRTFSEGGAVPALFAV
ILVC1_BACCZ      IAPNLQAGNSLVFAHGFNVHFDQVKPPANVDVFLVAPKGPGHLVRRTFSEGGAVPALFAV
ILVC1_BACHK      IAPNLQAGNSLVFAHGFNVHFDQVKPPVNVDVFLVAPKGPGHLVRRTFVEGGAVPALFAV
ILVC1_BACAN      IAPNLQAGNSLVFAHGFNVHFDQVKPPVNVDVFLVAPKGPGHLVRRTFSEGGAVPALFAV
ILVC1_BACCR      IAPNLQAGNSLVFAHGFNVHFDQVKPPANVDVFLVAPKGPGHLVRRTFAEGGAVPALFAV
ILVC_BACCN       IESNLQSGNALVFAHGFNVHFNQVTPPEDVDVFLVAPKGPGHLVRRTFTEGGAVPALFAV
ILVC_OCEIH       IKDNLEQGNALVFAHGFNIHFTQVVPPANVDVFLVAPKGPGHLVRRTFEEGAGVPALYGV
ILVC_BACVZ       IKDELTAGKSLVFAHGFNVHFHQIVPPADVDVFLVAPKGPGHLVRRTYEQGAGVPALFAI
ILVC_BACSU       IKDELTAGKSLVFAHGFNVHFHQIVPPADVDVFLVAPKGPGHLVRRTYEQGAGVPALFAI
ILVC_BACLD       IKDGLQAGNSLVFAHGFNVHFHQIVPPADVDVFLVAPKGPGHLVRRTFEQGAGVPALFAI
ILVC_BACP2       IKDQLEAGNSLVFAHGFNVHFHQIVPPSDVDVYLVAPKGPGHLVRRTYEQGAGVPALFAI
ILVC_GEOKA       IEPELEPGNALVFAHGFNIHFSQIVPPNHVDVFLVAPKGPGHLVRRTYTEGAGVPALIAV
ILVC_GEOTN       IEPELKPGNALVFAHGFNIHFSQIVPPEHVDVFLVAPKGPGHLVRRTYVEGAGVPALIAV
ILVC_BACSK       IEPELTAGKALVFAHGFNIHFNQIVPPEHVDVFLAAPKGPGHLVRRTYTEGAGVPALIAV
ILVC_BACHD       IEPELSEGKTLAFAHGFNVHFNQIVPPATVDVFLAAPKGPGHLVRRTYVDGAGVPGLVAV
ILVC2_BACAN      VEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAV
ILVC2_BACHK      VEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAV
ILVC2_BACCR      VEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAV
ILVC2_BACCZ      IEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAV
ILVC2_BACC1      VEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAV
ILVC_CALS4       IEKNLTEGKALAFAHGFNIHFKQIVPPENVDVFMVAPKGPGHLVRRMYQEGKGVPCLVAV
ILVC_CALS8       IEPNLKEGKAIAFAHGFNIHFGQIVPPPYVDVIMIAPKGPGHTVRSQYEEGKGVPALVAV
ILVC_CLOB8       IAPNLEEGNALVFAHGFNIHFGQVVPPSYVDVFMVAPKGPGHLVRRTYTEGAGVPCLIAV
ILVC_ALKMQ       IKPNLTAGKYLMFAHGFNIHYGQIVPSEDVNVFMVAPKGPGHTVRSQYQEGKGVPCLVSV
ILVC_CLONN       VCMNLKEGDALVFAHGFNIHFNQIVPPEYVDVYMIAPKGPGHMVRREYVRGGGVPCLVAV
ILVC_CLOAB       IKDNLDEGDALFFAHGFNIHYNQIVPPKNVDVLMIAPKGPGHIVRRQYTEGGGVPCLYAV
ILVC_LACP7       IEPNLEAGNALMFAHGFAIHFGQIIPPKDVDVLMIAPKGPGHTVRSQYQEGQGVPCLIAV
ILVC_HUNT2       IKPNLEEGNVLAFAHGFAIHFKTIVPPPEVDVIMIAPKGPGHTVRSQYVEGKGVPSLIAV
ILVC_THEMA       IEKHLTEGKMLMFAHGFNIHYHQIIPPKNVDVTMIAPKSPGHIVRREYVEGRGVPALVAV
ILVC_THEP1       IEKHLTEGKMLMFAHGFNIHYHQIIPPKNVDVTMIAPKSPGHIVRREYVEGRGVPALVAV
ILVC_AQUAE       VEPELNSSKTLAFAHGFNIHFRQIVPPKDVDVFMVAPKGPGHLVRWMYTEGKGVPALVAI
ILVC_PETMO       IEPNLDEGNALGFSHGFNIHFGQIVPPKNVDVFMVAPKSPGHLVRRMYLEGKGVPGLLAV
ILVC_DESHY       IKPHLTAGKCLVFSHGFNIHFGQIVPPADVDVFMVAPKSPGHLVRRTYEEGAGVPGLIAV
ILVC_DESRM       IEPYLSEGKALMFSHGFNIHFGQIVPPKNVDVFLVAPKSPGHLVRRMYAEGKGVPGLVAV
ILVC_CARHZ       IEEHLKPGKALMFSHGFNIHYGQIVPPPDVDVFLVAPKSPGHLVRRMYLEGKGVPGLIAV
ILVC_SYNWW       IKPYLKAGNALGFSHGFNIHFGQIVPPAFVDVFMVAPKSPGHLVRRMYVKGAGVPGLVAV
ILVC_MOOTA       IAPYLTGGKVLMFSHGFNIHFNQIVPPADVDVIMVAPKGPGHLVRRTYVEGQGVPALIAI
ILVC_DEHMC       IEQGLKPGKMLMFAHGFNIHYGQIVPPSFVDVTMIAPKCPGYMLRQVFTEGAGAPSLIAV
ILVC_DEHMB       VEQGLKPGKMLMFAHGFNIHYGQIVPPSFVDVTMIAPKCPGYMLRQVFTEGAGAPSLIAV
ILVC_DEHM1       VEQGLTPGKMLMFAHGFNIHYGQIVPPSFVDVTMIAPKCPGYMLRQVFTEGAGAPSLIAV
ILVC_METST       IQQYVEPGNTISFSHGYNIHFNRIRVPEDVNVTMIAPKAPGSKVRQTYQEGFGTPGLIAI
ILVC_METS3       IAPYVEAGNTISFSHGYNIHFGLIKPDEDVNIVMFAPKGPGSRVRTTYLDGFGIPGLVAI
ILVC_METTH       IRPYLKEGNTISFSHGYNIHYGYIKAPEGVNVTMVAPKGPGAMVRRTYLEGFGIPGLVAV
ILVC_METM5       IKPYLKEGKTLSFSHGFNIHYGFIVPPKGVNVVLVAPKSPGKMVRRTYEEGFGVPGLICI
ILVC_METM7       IKPYLKEGKTLSFSHGFNIHYGFIVPPKGVNVVLVAPKSPGKMVRRTYEEGFGVPGLICI
ILVC_METMP       IKPYLKEGKTLSFSHGFNIHYGFIVPPKGVNVVLVAPKSPGKMVRRTYEEGFGVPGLICI
ILVC_METVS       IKPYLTEGKTLSFSHGFNIHYGFIIPPKGVNVVLVAPKSPGKMVRKTYEEGFGVPGLICI
ILVC_METJA       IEPYLTEGKTISFSHGYNIHYGFIRPPENVNITMVAPKSPGAMVRKTYEEGFGVPGLVAV
ILVC_PYRIL       IAPFLKEGAVVDFAHGFNIHYGLIKPPKNVDVIMVAPKAPGKAVREEFLAGRGVPALVAV
ILVC_PYRAE       IAPNLKEGVVVDFAHGFNVHFGLIKPPKNIDVIMVAPKAPGKAVREEYLAGRGVPALVAV
ILVC_PYRCJ       VAPNLRKGAVVDFAHGFNIHYKLITPPPYVDVVMVAPKGPGKAVREEFLAGRGVPALVAV
ILVC_PYRAR       IEPNLKPGTVVDFAHGFNIHFGLIKPPPNVDVVMVAPKGPGRAVREEYLSGRGVPALVAV
ILVC_PYRAB       IEPYLREGQALGFSHGFNIHYKQIVPPEYVDVIMVAPKSPGKRVREKYLEGFGVPALVAV
ILVC_PYRFU       IAPYLREGQALGFSHGFNIHYKQIVPPEYVDVIMVAPKSPGRRVREVFLEGFGVPALIAV
ILVC_SULTO       VAPYLRDGMDLVFAHGFNIHYKLIEPPKTVDVYMIAPKGPGPIVREYFAKGGGVPALVAV
ILVC_SULAC       VKPYLKEGMDLVFAHGFNIHYRLIEPPSNVDVYMIAPKAPGPIVREYFAKGGGVPALVAT
ILVC_SACS2       VQPYMKKGADLVFAHGFNIHYKLIDPPKDSDVYMIAPKGPGPTVREYYKAGGGVPALVAV
ILVC_METKA       IHDNLEKGNALGFSHAYNIHYGLIEPPEYVDVILVAPKGPGHMVRKLYTEGFGTPALVAV
ILVC_METAC       IEPSLEAGNALVFAHGFNIHYNQIVPPKDVDVFMVAPKGPGHIVRRTYTEGIGVPGLIAV
ILVC_METMA       IEPNLKAGDALVFAHGFNIHYNQIVPPKDVDVFMVAPKGPGHIVRRTYTEGIGVPGLIAV
ILVC_METBF       IAPNLEAGNALAFAHGFNIHYNQIVPPKDVDVFMAAPKGPGHIVRRTYTEGIGVPALIAV
ILVC_METBU       IEPGLEAGNSLVFSHGFNIHYNQIVPSKDLDVYMVAPKSPGHLVRRTYKEGAGVPGLIAV
ILVC_METAR       IEPYMKKGKILGFSHGFNIHYGMIKPGKDIDVVMIAPKSPGHLVRRMYQQGAGVPALVAI
ILVC_METTP       IAPYLEEGNILGFSHGFNIHFNQIIPPEYVDVVMVAPKGPGDLVRRQFLEGKGVPCLVAV
ILVC_ARCFU       IQDKLKEGAMLMFAHGFNIHYNQIVPPEYVDVAMVAPKGPGPLVRRMYVEGKGVPSLVAV
ILVC_METB6       ILPHLSENKVLMFSHGFNIHFGQIQPPGNVDVIMVAPKGPGFMVRRQYEEGKGVPALIAI
ILVC_METLZ       IMPYLTENKCLMFSHGFNIHFGQIVPPANVDVIMVAPKGPGHMVRRTYEEGKGVPALIAI
ILVC_METHJ       IAQGLTKGKTLMFSHGFNIHFGQIVPPADVDVIMVAPKGPGHMVRRTYTEGKGVPALIAI
ILVC_METMJ       ISPNIRENACLMFSHGFNIHYGQIVPPPTVDVVMVAPKGPGHMVRRTYEEGKGVPALIAV
ILVC_KORVE       IAPHLKPGKTLMFAHGFNIRYGTITPPEGIDVSMVAPKAPGHRVREVFTEGGGTPALFAI
ILVC_SORC5       IAPHLGPGKTLMFAHGFNIRFNTITPPPSVDVSMIAPKGPGHRVRETFEAGGGVPALLAV
ILVC_CHLAA       IAPAMEPGKTLMFAHGFNIRFGQIIPPQGIDVSMVAPKAPGHRVREVFVQGGGVPALIAV
ILVC_ROSCS       IGPHMTPGKTLMFAHGFNIRFGQIVPPEGVDVSMVAPKAPGHRVREVYTQGGGVPALVAV
ILVC_SOLUE       IAPHMTAGKTLMFAHGFNIHFGQIKPPVDIDVTMVAPKAPGHRVRELYTEGVGVPALVAV
ILVC_SYNJA       IRPHLKPGKVLLFAHGFNIHFGQIQPPPDIDVIMVAPKGPGHLVRRTYLEGQGVPCLFAV
ILVC_SYNJB       IRPHLQPGNVLLFAHGFNIHFGQIQPPANVDVIMVAPKGPGHLVRRTYQAGEGVPCLFAV
ILVC_NOSS1       IEPNLQEGNTLAFAHGFNIHFGQVVPPANVDVVMVAPKGPGHLVRRTYEQGQGVPALFAV
ILVC_TRIV2       IEPNLQEGNTLAFAHGFNIHFGQVVPPANVDVVMVAPKGPGHLVRRTYEQGQGVPALFAV
ILVC_MICAN       IAPNLSAGKVLSFAHGFNIHFGQVVPPANVDVVMVAPKGPGHLVRRTYEQGQGVPCLFAV
ILVC_TRIEI       IEPHLKEGKILAFAHGFNIHFGQIIPPENVDVVMVAPKGPGHLVRRTYEQGEGVPCLFAI
ILVC_SYNY3       IAPNLVAGNVLLFAHGFNINFAQIVPPADVDVVMAAPKGPGHLVRRTYEQGQGVPALFAV
ILVC_ACAM1       IQPHLSADKVLAFAHGFNIHFAQVVPPSDVDVVMVAPKGPGHLVRRTYTQGQGVPCLFAV
ILVC_THEEB       IAPHLQPGNVLSFAHGFNIHFGQIVPPAHVDVVMVAPKGPGHLVRRTYAQGEGVPCLFAV
ILVC_SYNE7       IRPALSAGKVLAFAHGFNIHFAQIVPPADVDVVMIAPKSPGHLVRRTYEQGQGVPCLFAI
ILVC_SYNP6       IRPALSAGKVLAFAHGFNIHFAQIVPPADVDVVMIAPKSPGHLVRRTYEQGQGVPCLFAI
ILVC_GLOVI       IAPHLGTGKTLAFAHGFNIHFSQIVPSQEVDVLMVAPKGPGHLVRRVFTEGKGVPCLFAV
ILVC_SYNPW       IAPHLKAGKVLSFAHGFNIRFGLIKPPADVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_SYNR3       IAPHLSAGKVLSFAHGFNIRFGLIKPPADVDVVMIAPKGPGHTVRWEYQNAQGVPALFAI
ILVC_PROM3       IAPHLSSGKVLSFAHGFNIRFGLIQPPADVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_PROMM       IASHLSSGKVLSFAHGFNIRFGLIQPPADVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_SYNSC       IAPHLNAGKVLSFAHGFNIRFELIKPPADVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_SYNPX       IAPHLTSGKVLSFAHGFNIRFELIKPPTDVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_SYNS9       IAPHLKSGKVLSFAHGFNIRFELIKPPADVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_SYNS3       IAPHLSAGKVLSFAHGFNIRFELIKPPADVDVLMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_PROM1       IAPHLKAGKILSFAHGFNIRFELIKPPEFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_PROMT       IAPHLKAGKILSFAHGFNIRFELIKPPEFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAI
ILVC_PROMA       VAPHLKPGKILSFAHGFNIRFGLIEPPSFVDVVMIAPKGPGHTVRWEFQNGQGVPALFAI
ILVC_PROMS       IEPNLKEGKILSFAHGFNIRFGLIKPPSFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAV
ILVC_PROM2       IEPNLKEGKILSFAHGFNIRFGLIKPPSFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAV
ILVC_PROM0       IEPNLKEGKILSFAHGFNIRFGLIKPPSFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAV
ILVC_PROM9       IEPNLKEGKILSFAHGFNIRFGLIKPPSFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAV
ILVC_PROM5       IEPNLKEGKILSFAHGFNIRFGLIKPPSFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAV
ILVC_PROMP       IEPNLKEGKILSFAHGFNIRFELIKPPNFVDVVMIAPKGPGHTVRWEYQNGQGVPALFAV
ILVC_ANADE       IAPHLSKGKALLFAHGFNIHFVQVRPPPDVDVLLVAPKGPGHMVRRQYQDGRGIPGLVAV
ILVC_THET2       VEPNLKEGGALAFAHGFNVHFGQIKPRKDLDVWMVAPKGPGHLVRSEYQKGSGVPALVAV
ILVC_THET8       VEPNLKEGGALAFAHGFNVHFGQIKPRKDLDVWMVAPKGPGHLVRSEYQKGSGVPALVAV
ILVC_RUBXD       VAPNLAEGNLMLFAHGFNVHFNQVSVPPEVDLGLVAPKGPGHVLRSLYEEGKGMPALFAV
ILVC_DEIGD       IAPNLTAGKALAFGHGFNIHFGRIKPPADVDVFLVAPKGPGHMLRRVYVDGAGMPSIFAV
ILVC_DEIRA       IAPHLTAGKALAFGHGFNVHFGRIKPPADVDVFLVAPKGPGHMLRRVYTDGAGMPGIFAV
ILVC_LEPBL       IEPNLKKGNALVFSHGFNIHYDFIKPPEEVDVYMVAPKGPGHLVRRVYTEGGGVPCLIAV
ILVC_LEPBJ       IEPNLKKGNALVFSHGFNIHYDFIKPPEEVDVYMVAPKGPGHLVRRVYTEGGGVPCLIAV
ILVC_LEPIC       IEPNLKKGDALVFSHGFNIHYDFIKPPKEVDVYMVAPKGPGHLVRRVYTEGGGVPCLIAI
ILVC_LEPIN       IEPNLKKGDALVFSHGFNIHYDFIKPPKEVDVYMVAPKGPGHLVRRVYTEGGGVPCLIAI
ILVC_CLOD6       VKDNLKEGQTLAFAHGFNIHYNQVQPPEFVDVVMVAPKGPGHLVRNVFTKGSGVPALFAV
ILVC_TREPR       VRDYLRPGASVAFAHGFNVCYNQIPIGNGVGAFMAAPKAPGHMVRETYIAGWGTPHLVAA
ILVC_HELPH       VIPFLKEGQIVGFAHGFSVHFNQVVLPKGVGAILVAPKGPGSALREEYLKNRGLYHLIAI
ILVC_HELPJ       VIPFLKEGQIIGFAHGFSVHFNQVVLPKGVGAILVAPKGPGSALREEYLKNRGLYHLIAI
ILVC_HELPY       VIPFLKEGQIVGFAHGFSVHFNQVVLPKGVGAILVAPKGPGSALREEYLKNRGLYHLIAI
ILVC_HELAH       VIPFLKEGQIVGFAHGFSVHFNQVSFKKGVGVILVAPKGPGSALREEYLKNKGLYHLIAI
ILVC_ECOK1       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECOUT       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECO24       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECOL5       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECOL6       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SHIDS       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SHIBS       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SHISS       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SHIFL       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECOLC       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECOLI       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECOHS       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ECO57       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SALCH       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SALPB       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SALTI       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SALPA       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SALTY       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SALAR       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_KLEP7       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_CITK8       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ENT38       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_CROS8       VQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_YERP3       VQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_YERPS       VQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_YERPA       VQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_YERPP       VQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_YERPN       VQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_YERPE       VQPLMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_YERE8       VQPLMKDGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SERP5       VQPLMKDGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_PECAS       VQPLMKQGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_PHOLL       VQPLMKEGAALGYSHGLNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SODGM       VQPLMKQGAALGYSHGFNIVEVGEQIRHDITVIMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_AERHH       VMPLMKQGAALGYSHGFNVVEEGQQIRADITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_AERS4       VMPLMKQGAALGYSHGFNVVEEGQQIRADITVVMVAPKCPGTEVREEYKRGFGVPTLLAV
ILVC_HAEIE       VMPLMKKDSAFGYSHGFNIVEVGEEIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_HAEIN       VMPLMKKDSAFGYSHGFNIVEVGEEIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_HAEI8       VMPLMKKDSAFGYSHGFNIVEVGEEIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_HAEIG       VMPLMKKDSAFGYSHGFNIVEVGEEIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_PASMU       VMPLMKQGAALGYSHGLNIVEVGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_MANSM       VMPLMKQGASFGYSHGFNIVEVGEQIREDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ACTSZ       VMPLMKQGAAFGYSHGFNIVEVGEQIREDITVVMSAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ACTP2       VVPLMKQGSAFGYSHGFNIVEEGEQIRKDITVVMTAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_HISS2       VMPLIKQGAALGYSHGLNIVELGEKIRQDITVVMVAPKCPGTEVREEFKRGFGVPTLIAV
ILVC_HAES1       VMPLIKQGAALGYSHGLNIVEVGEKIRQDITVVMVAPKCPGTEVREEFKRGFGVPTLIAV
ILVC_VIBVY       VMPLMKEGAALGYSHGFNVVEEGMQIRKDLTVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_VIBVU       VMPLMKEGAALGYSHGFNVVEEGMQIRKDLTVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_VIBPA       VMPLMKEGAALGYSHGFNVVEEGMQIRKDLTVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_ALIF1       VMPLMKEGAALGYSHGFNVVEEGMQIRKDLTVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_VIBCH       VMPLMKQGAALGYSHGFNIVEEGMQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_VIBC3       VMPLMKQGAALGYSHGFNIVEEGMQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_PHOPR       VMPLMKEGAALGYSHGFNIVEEGMQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_SHEON       VMPLMKQGATLSYSHGFNIVEEGMQIRPDITVIMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_BUCAI       LQKLMKKNAVLGYSHGFNIVEFGEKIRKDITVIMVAPKCPGTEVREEYKRGFGVPTLIAV
ILVC_BUCDN       LQKLMKKDACLGYSHGFNIVEKLRNIRKDITVIMVAPKCPGTEVREEYKRGFGVGTLIAV
ILVC_BUCAP       LQKLMKKNSCLGYSHGFNIVECGEIIRKDITVVMVAPKCPGTEVREEFKRGFGVPTLIAV
ILVC_BUCMH       LQKFMKPNSVLGFSHGFNIVEVGQLIRNDITVIMVAPKCPGTEVREEYKRGFGVPALIAV
ILVC_BUCSC       LQKFMKENSVLGFSHGFHIVEIGQKIRNDITVIMVAPKCPGTEVREEYKKGFGVPSLIAV
ILVC_BUCBP       LQNLMKKNSILGFSHGFNIIEFGQKIRQDITVIMVAPKCPGTEVREEYKRNFGVPTLISV
ILVC_BLOFL       IEPLMKYKAVLGYSHGFHIVEIGVKIRQDITVIMVAPKCPGTEVRQEYQRGFGVPALIAV
                 :         :  .*.: :              : *** .*   *  :    .   :   

ILVC_LEUMM       HQDPTGD-------TAEVAKAYAKGIGSGRAGILETTFEEETTEDLFGEQAVLCGGLT--
ILVC_LEUMC       HQDPTGD-------TAEVAKAYAKGIGSGCAGILETTFEEETTEDLFGEQAVLCGGLT--
ILVC_STAES       QQDATGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAEQ       QQDATGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAA1       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAA9       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAB       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAN       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAM       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAW       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAR       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAA2       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAA8       QQGASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAE       QQGASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAC       QQGASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAT       QQGASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAA3       QQGASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAAS       QQDASGQ-------ARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVS--
ILVC_STAHJ       QQDATGQ-------ARDISLSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGIH--
ILVC_STAS1       EQDPSGE-------ARDLALSYAKGIGATRAGVLETSFKEETETDLFGEQAVLCGGTT--
ILVC_LISMF       YQDATGN-------ARDTALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGAT--
ILVC_LISIN       YQDATGN-------ARDTALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGAT--
ILVC_LISW6       YQDATGN-------ARETALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGAT--
ILVC_LISMO       YQDATGN-------ARDTALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGAT--
ILVC_STRR6       YQDATGN-------AKNIAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRPN       YQDATGN-------AKNIAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRP2       YQDATGN-------AKNIAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRSV       YQDATGN-------AKDIAMDWCKGVGSARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRGC       YQDATGN-------AKNIAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRT2       YQDATGN-------AKDIAMDWCKGIGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRT1       YQDATGN-------AKDIAMDWCKGIGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRTD       YQDATGN-------AKDIAMDWCKGIGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRTR       YQDATGN-------AKDIAMDWCKGIGAARVGLLETTYKEETEEDLFGEQAVLCGGLT--
ILVC_STRS2       YQDATGN-------AKHIAMDWAKGVGSARVGLLETTFKEETEEDLFGEQAVLCGGLT--
ILVC_STRSY       YQDATGN-------AKHIAMDWAKGVGSARVGLLETTFKEETEEDLFGEQAVLCGGLT--
ILVC_STRMU       YQNPTGN-------AENIALDWAKGIGSARVGLLVTTFKEETEEDLFGEQAVLMGGLT--
ILVC_LACLM       HQNATGH-------AREIAMDWAKGIGCARVGIIETTFKEETEEDLFGEQAVLCGGLT--
ILVC_LACLS       HQNATGH-------AREIAMDWAKGIGCARVGIIETTFKEETEEDLFGEQAVLCGGLT--
ILVC_LACLA       HQNASGH-------AREIAMDWAKGIGCARVGIIETTFKEETEEDLFGEQAVLCGGLT--
ILVC_RHIME       HQDASGN-------ALDLALSYACGVGGGRSGIIETNFKEECETDLFGEQVVLCGGLV--
ILVC_SINMW       HQDASGN-------ALDLALSYACGVGGGRSGIIETNFKEECETDLFGEQVVLCGGLV--
ILVC_RHIEC       HQNASGN-------ALELALSYACGVGGGRSGIIETNFREECETDLFGEQVVLCGGLV--
ILVC_RHIL3       HQNASGN-------ALELALSYACGVGGGRSGIIETNFREECETDLFGEQVVLCGGLV--
ILVC_AGRFC       HHNASGN-------ALELALSYACGVGGGRSGIIETNFKEECETDLFGEQVVLCGGLV--
ILVC_RHILO       NQDASGN-------ALDLALSYACGVGGGRSGIIETNFREECETDLFGEQVVLCGGLV--
ILVC_CHESB       HHDASGN-------ALDLALSYACGVGGGRSGIIETTFREECETDLFGEQVVLCGGLV--
ILVC_BRUO2       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_BRUSU       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_BRUC2       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_BRUAB       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_BRUA2       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_BRUME       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_BRUSI       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_OCHA4       HQDASGN-------AHDLALSYASGVGGGRSGVIETTFKEECETDLFGEQAVLCGGVV--
ILVC_BART1       AQDASGH-------AHSVALSYACGLGGGRAGVIETTFKEECETDLFGEQAVLCGGLV--
ILVC_BARHE       AQDASGH-------AHNVALSYACGLGGGRAGVIETTFKEECETDLFGEQAVLCGGLV--
ILVC_BARQU       AQDVSGH-------AHDIALSYACGIGGGRAGVMETTFKEECETDLFGEQAVLCGGLV--
ILVC_BARBK       EQDVSGN-------AHDLALSYACGIGGGRSGIMKTTFREECETDLFGEQAVLCGGLV--
ILVC_RHOPB       HKDSSGN-------AHDLGLSYASAIGGGRAGIIETTFREECETDLFGEQVVLCGGLV--
ILVC_RHOP5       HKDSSGN-------AHDLGLSYASAVGGGRAGIIETTFREECETDLFGEQVVLCGGLV--
ILVC_RHOP2       HQDPSGN-------AHDLGLSYASAIGGGRAGIIETSFKEECETDLFGEQVVLCGGLV--
ILVC_RHOPS       HKDSSGN-------AHDLGLSYASAIGGGRAGIIETSFKEECETDLFGEQVVLCGGLV--
ILVC_RHOPA       HKDASGN-------AHDLGLSYASAIGGGRAGIIETTFREECETDLFGEQVVLCGGLV--
ILVC_BRASO       AKDSSGN-------AHDLGLSYASAIGGGRAGIIETTFKEECETDLFGEQAVLCGGLV--
ILVC_BRASB       AKDSSGN-------AHDLGLSYASAIGGGRAGIIETTFKEECETDLFGEQAVLCGGLV--
ILVC_NITWN       AKDSSGN-------AHDLGLSYASAIGGGRAGIIETTFREECETDLFGEQAVLCGGLV--
ILVC_NITHX       ARDSSGN-------AHDLGLSYASAVGGGRAGIIETTFREECETDLFGEQVVLCGGLV--
ILVC_BRADU       AKDVSGN-------AHDLGLSYASAVGGGRAGIIETTFKEECETDLFGEQVVLCGGLV--
ILVC_AZOC5       AQDASGN-------AHDLGLSYASANGGGRAGIIETTFKEECETDLFGEQVVLCGGLV--
ILVC_PARL1       HQDATGN-------AHDVGLSYASANGGGRAGIIETTFREECETDLFGEQVVLCGGLV--
ILVC_MAGSA       AQNASGN-------ALEIALSYASAIGGGRSGIIETSFREECETDLFGEQVVLCGGLT--
ILVC_PHAMO       AQNPTGN-------ALELALSYASAIGGGRSGIIETTFREECETDLFGEQVVLCGGLS--
ILVC_RHORT       AQDASGN-------AMEIALSYASAIGGGRSGIIETTFREECETDLFGEQAVLCGGLT--
ILVC_GRABC       AQNASGN-------ALEIALSYASAVGGGRAGIIETTFKEECETDLFGEQAVLCGGLV--
ILVC_ACICJ       AQNPSGN-------ALDIALSYASAIGGGRAGIIETTFKEECETDLFGEQTVLCGGLV--
ILVC_GLUDA       AQNASGN-------ALEIALSYASANGGGRAGIIETSFKEEVETDLFGEQAVLCGGLV--
ILVC_GLUOX       AQNASGN-------ALEIALSYASANGGGRAGIIETTFKEEVETDLFGEQAVLCGGLV--
ILVC_CAUSK       HHNATGN-------ALDLGLAYASAIGGGRSGIIETNFREECETDLFGEQAVLCGGTV--
ILVC_CAUVC       HHNATGN-------ALDLGLAYASAIGGGRSGIIETNFREECETDLFGEQAVLCGGTV--
ILVC_RHOS1       HNDATGK-------AMEIGLSYCSAIGGGRSGIIETNFRQECETDLFGEQAVLCGGLV--
ILVC_RHOS4       HNDATGK-------AMEIGLSYCSAIGGGRSGIIETNFRQECETDLFGEQAVLCGGLV--
ILVC_RHOS5       HNDATGK-------AMEIGLSYCSAIGGGRSGIIETNFRQECETDLFGEQAVLCGGLV--
ILVC_PARDP       HQDATGK-------AMDIGLSYCSAIGGGRSGIIETNFRQECETDLFGEQAVLCGGLV--
ILVC_DINSH       DTDATGR-------ALEIGLSYCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGLV--
ILVC_ROSDO       DKDASGR-------ALEIGLSYCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGLV--
ILVC_JANSC       HQNASDR-------ALEIGLSYCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGLV--
ILVC_RUEPO       HTDATGK-------ALEIGLSYCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGLV--
ILVC_RUEST       HNDASGS-------ALETALSYCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGLV--
ILVC_ERYLH       HQDSSGN-------AKDIALAYASGVGGGRSGIIETNFREECETDLFGEQAVLCGGIT--
ILVC_NOVAD       HQNVTGN-------AHDVALAYASGVGGGRSGIIETNFREECETDLFGEQVVLCGGTT--
ILVC_SPHAL       AQEAQGSAAAGNGYAKALALSYASAVGGGRSGIIETTFKEECETDLFGEQAVLCGGIT--
ILVC_SPHWW       AQDASGN-------AHDVALSYASAIGGGRSGVIETTFKEECETDLFGEQAVLCGGLS--
ILVC_ZYMMO       DQDASGN-------AHDIALAYASGIGGGRSGVIETTFREEVETDLFGEQAVLCGGLT--
ILVC_PELUB       HQDGTGK-------ARDLALSYASAIGGGKSGIIETTFKDECETDLFGEQSVLCGGLV--
ILVC_HYPNA       HQDATGS-------AQAVALSYSKAIGNTRAGVIETSFREETETDLFGEQAVLCGGIV--
ILVC_GEOUR       HHDPSG-------NSRDVALAYASANGGGKAGIIETSFKEETETDLFGEQAVLCGGIS--
ILVC_GEOMG       HHDPAG-------NSRDVALAYASANGGGRAGIIETSFKEETETDLFGEQAVLCGGIS--
ILVC_GEOSL       HHDPSG-------NSRDVALAYASAIGGGRAGIIETSFKEETETDLFGEQAVLCGGIS--
ILVC_PELPD       HQDPSG-------KTKEIALAYASAVGGGRSGIIETNFREETETDLFGEQAVLCGGIS--
ILVC_MAGMM       HQNATG-------KALDLALSYASANGGGRAGIIETSFKEETETDLFGEQAVLCGGIT--
ILVC_METCA       YQNASG-------RAKELALSYASANGGGRAGIIETTFREETETDLFGEQAVLCGGAT--
ILVC_NITOC       HQDVST-------KAREIALSYAAANGGGRAGIIETAFREETETDLFGEQVVLCGGVT--
ILVC_VESOH       FQDVSG-------NAKDTALSYASAIGGGRTGILETSFKDETETDLFGEQVVLCGGTT--
ILVC_RUTMC       FQDASG-------NAKATSLSYACAIGGGRTGILETSFKDETETDLFGEQVVLCGGTT--
ILVC_ALKEH       HQDATG-------KAKDIALSYASANGGGRAGVIETSFREETETDLFGEQAVLCGGIT--
ILVC_HALHL       EQDASG-------QAKEIALAYAVANGGGRSGIIETSFREETETDLFGEQTVLCGGIA--
ILVC_NITEU       HQDKSG-------KARDLALSYAAANGGTRGGVIETTFKEETETDLFGEQVVLCGGLT--
ILVC_NITEC       HQDKSG-------KARDLALSYAAANGGTRGGVIETTFKEETETDLFGEQVVLCGGLT--
ILVC_NITMU       HQDKSG-------RARDLALSYAAANGGTRGGVIETNFREETETDLFGEQVVLCGGLT--
ILVC_CUPMC       HQNKSG-------AARDIALSYATANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_CUPNH       HQNKSG-------AARDIALSYATANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_CUPPJ       YQDKSG-------SARDVALSYATANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_RALSO       HQDKSG-------SARDIALSYATANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURM7       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURPS       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURP1       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURP0       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURM9       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURMS       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURMA       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURP6       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURTA       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURCH       AQNKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURVG       AQNKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURCA       AQNKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURCM       AQNKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BURL3       AQNKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_PARXL       AQDKSG-------AARDIALSYAAANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_POLAQ       YQDKSG-------SARDVALSYATANGGGRAGIIETNFREETETDLFGEQAVLCGGAV--
ILVC_JANMA       YQDKSG-------VARDIALSYAMANGGGRAGIIETNFREETETDLFGEQAVLCGGAV--
ILVC_HERAR       YQDKSG-------VARDIALSYAMANGGGRAGIIETNFREETETDLFGEQAVLCGGAV--
ILVC_POLNA       HQDKSG-------KARDLALSYAMANGGGKAGIIETNFREETETDLFGEQAVLCGGAV--
ILVC_POLSJ       HQDKSG-------KARDLALSYAMANGGGKAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_RHOFT       HQDKSG-------RTRDLALSYAMANGGGKAGIIETTFREETETDLFGEQAVLCGGTV--
ILVC_METPP       HADKTG-------KARDLALSYAAANGGGKAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BORBR       YQDKSG-------SARDVALSYASANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BORPA       YQDKSG-------SARDVALSYASANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BORPE       YQDKSG-------SARDVALSYASANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_BORA1       YQDKSG-------AARDVALSYASANGGGRAGIIETNFREETETDLFGEQAVLCGGTV--
ILVC_CHRVO       YQDKTG-------KARDVALSYAAANGGTKGGVIETNFREETETDLFGEQAVLCGGAV--
ILVC_METFK       YQDASG-------KAKDIALSYAAANGGTKGGVIETNFREETETDLFGEQAVLCGGAV--
ILVC_AZOSB       YQDKSG-------KAKDIALSYAAANGGTKGGVIETNFKEETETDLFGEQAVLCGGAV--
ILVC_DECAR       YQDVTK-------KAKDIALSYAAANGGTKGGVIETNFREETETDLFGEQAVLCGGAV--
ILVC_AROAE       HQDRSG-------KAKDIALSYAAANGGTKGGVIETNFREETETDLFGEQAVLCGGAV--
ILVC_ACIAC       HQDKSG-------KARDLALSYAMANGGGKAGIIETNFKEETETDLFGEQAVLCGGAV--
ILVC_ACISJ       HQDKSG-------KARDLALSYAMANGGGKAGIIETNFKEETETDLFGEQAVLCGGAV--
ILVC_NEIMF       YQDNSG-------KAKDIALSYAAANGGTKGGVIETTFREETETDLFGEQAVLCGGVV--
ILVC_NEIMB       YQDNSG-------KAKDIALSYAAANGGTKGGVIETTFREETETDLFGEQAVLCGGVV--
ILVC_NEIM0       YQDNSG-------KAKDIALSYAAANGGTKGGVIETTFREETETDLFGEQAVLCGGVV--
ILVC_NEIMA       YQDNSG-------KAKDIALSYAAANGGTKGGVIETTFREETETDLFGEQAVLCGGVV--
ILVC_NEIG1       YQDNSG-------KAKDIALSYAAANGGTKGGVIETTFREETETDLFGEQAVLCGGVA--
ILVC_PSEAB       YQDASG-------NAKNVALSYACGVGGGRTGIIETTFKDETETDLFGEQAVLCGGCV--
ILVC_PSEAE       YQDASG-------NAKNVALSYACGVGGGRTGIIETTFKDETETDLFGEQAVLCGGCV--
ILVC_PSEA7       YQDASG-------NAKNVALSYACGVGGGRTGIIETTFKDETETDLFGEQAVLCGGCV--
ILVC_PSEU5       YQDASG-------NARNVALSYACGVGGGRTGIIETTFKDETETDLFGEQAVLCGGCV--
ILVC_PSEU2       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSE14       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSESM       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSEMY       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSEPF       YQDASG-------NAKNVALSYAAGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSEF5       YQDASG-------NAKNVALSYAAGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSEPK       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSEP1       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSEPG       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_PSEE4       YQDASG-------NAKNVALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGTV--
ILVC_ALCBS       FQDASG-------SAKELALSYACGVGGGRTGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_MARHV       FQDASG-------NAKNVALSYASGIGGGRTGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_HAHCH       FQDASG-------SAKDLALSYASGVGGGRTGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_SACD2       FQDASG-------TAKEVALSYASGVGGGRSGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_HYDCU       QQDASG-------KAKEIALSYASGVGGGRTGIIETTFRDECETDLFGEQAVLCGGAV--
ILVC_PSYCK       YQDASG-------QAKQLALSYAAGVGGGRSGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_PSYA2       YQDASG-------QAKQLALSYAAGVGGGRSGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_PSYWF       YQDASG-------QAKQVALSYASGVGGGRSGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_ACIAD       HQDASG-------NARNVALSYASGVGGGRTGIIETSFREETETDLFGEQAVLCGGAV--
ILVC_THIDA       YQDASG-------KAKETALSYASAIGGGRTGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_CHRSD       QQDATG-------QAKELALSYAAGVGGGRSGIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_PRB01       YEDALSDED---YSAKDVALSYAKANGGTRAGVLETSFKEETETDLFGEQAVLCGGLT--
ILVC_ARCB4       HQDAS-------GDTKQVALAYASAIGGGRTGIIETTFKDETETDLFGEQAVLCGGAT--
ILVC_SULDN       GQNPS-------GNTRELALSYASAIGGGRTAIIETTFKDETETDLFGEQAVLCGGAV--
ILVC_NITSB       AQDPS-------GNTLELAKSYASAIGGGRTGIIHTTFKDETETDLFGEQAVLCGGVS--
ILVC_HELHP       EQDTSR------GDAKAIALSYASAIGGGRSGIIETTFKDETETDLFGEQAVLCGGVT--
ILVC_WOLSU       EQNAS-------GIAKEICLSYASAIGGGRTGIIETTFKDETETDLFGEQAVLCGGVT--
ILVC_CAMC5       EQDAS-------GQAKQIALSYASAIGGGRTGIIETTFKDETETDLFGEQAVLCGGLC--
ILVC_CAMC1       EQNAS-------GKAKEIALSYACGIGGGRTGIIETTFKDETETDLFGEQAVLCGGLC--
ILVC_CAMFF       SQDAT-------GKAKDLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLC--
ILVC_CAMHC       SQNAS-------GQAKELALSYASAIGAGRTGIIETTFKDETETDLFGEQAVLCGGLC--
ILVC_CAMJ8       HQDES-------KNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLS--
ILVC_CAMJJ       HQDES-------KNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLS--
ILVC_CAMJR       HQDES-------KNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLS--
ILVC_CAMJE       HQDES-------KNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLS--
ILVC_CAMJD       HQDES-------KNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLS--
ILVC_MYCSK       DQDPKGE-------GQALALSYAAAIGGARAGVIKTTFKEETETDLFGEQAVLCGGTE--
ILVC_MYCSJ       DQDPKGE-------GQALALSYAAAIGGARAGVIKTTFKEETETDLFGEQAVLCGGTE--
ILVC_MYCSS       DQDPKGE-------GQALALSYAAAIGGARAGVIKTTFKEETETDLFGEQAVLCGGTE--
ILVC_MYCVP       DQDPKGE-------GQALALSYAAAIGGARAGVIKTTFKEETETDLFGEQAVLCGGTE--
ILVC_MYCGI       DQDPKGE-------GQALALSYAAAIGGARAGVIKTTFKDETETDLFGEQAVLCGGTE--
ILVC_MYCS2       DQDPKGE-------GQALALSYAAAIGGARAGVIKTTFKEETETDLFGEQAVLCGGTE--
ILVC_NOCFA       DQDPKGE-------GQALALSYAKGIGGTRAGVIKTTFKEETETDLFGEQAVLCGGTE--
ILVC_RHOJR       DQDPKGE-------GQALALSYAKGIGGTRAGVIKTTFKEETETDLFGEQAVLCGGTE--
ILVC_MYCPA       DQDPTGK-------GEALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQAVLCGGTE--
ILVC_MYCA1       DQDPTGK-------GEALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQAVLCGGTE--
ILVC_MYCAV       DQDPTGK-------GEALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQAVLCGGTE--
ILVC_MYCUA       DQDPTGK-------GEALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQAVLCGGTE--
ILVC_MYCLE       NQDPTGT-------GEALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQAVLCGGTE--
ILVC_MYCBP       EQDPRGD-------GLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTE--
ILVC_MYCTA       EQDPRGD-------GLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTE--
ILVC_MYCTU       EQDPRGD-------GLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTE--
ILVC_MYCBO       EQDPRGD-------GLALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQTVLCGGTE--
ILVC_CORGL       DQDPTGT-------AQALTLSYAAAIGGARAGVIPTTFEAETVTDLFGEQAVLCGGTE--
ILVC_CORGB       DQDPTGT-------AQALTLSYAAAIGGARAGVIPTTFEAETVTDLFGEQAVLCGGTE--
ILVC_COREF       DQDPTGD-------AQALALSYASAIGGGRAGIIPTTFEAETVTDLFGEQAVLCGGTE--
ILVC_CORJK       EQDPKNN-------GRDLALSYAAAIGGARAGVIPTTFEAETVTDLFGEQAVLCGGTE--
ILVC_CORDI       AQDPKGE-------GKDLALSYAAAIGGARAGVIPTTFREETETDLFGEQVVLCGGLE--
ILVC1_STRCO      EQDATGN-------AFALALSYAKGIGGTRAGVIKTTFTEETETDLFGEQAVLCGGTA--
ILVC2_STRCO      EQDATGN-------AFALALSYAKGIGGTRAGVIRTTFTEETETDLFGEQAVLAGGVT--
ILVC_STRAW       EQDATGN-------GFALALSYAKGIGGTRAGVIKTTFTEETETDLFGEQAVLCGGTA--
ILVC_SALAI       EQDASGN-------AFGLALAYAKAIGGTRAGAIRTTFTEETETDLFGEQAVLCGGAA--
ILVC_SALTO       EQDASGS-------ALGLALAYAKAIGGTRAGVIKTTFTEETETDLFGEQAVLCGGAA--
ILVC_SACEN       EQDASGN-------AQALALSYAAGIGGARAGVIKTTFTEETETDLFGEQAVLCGGAS--
ILVC_FRAAA       ENDASGN-------ALAVALAYAKGIGGTRAGALRTTFTEETETDLFGEQAVLCGGAS--
ILVC_FRACC       EADASGN-------ALAVALAYAKGIGGTRAGALRTTFTEETETDLFGEQAVLCGGAS--
ILVC_THEFY       EKDASGS-------AWDLALSYAKAIGGTRAGALKTTFKEETETDLFGEQAVLCGGVS--
ILVC_CLAMS       EVDASGK-------AWDLAWSYAKGIGGLRAGGIRTTFTEETETDLFGEQAVLCGGTS--
ILVC_CLAM3       EVDASGK-------AWDLAWSYAKGIGGLRAGGIRTTFTEETETDLFGEQAVLCGGTS--
ILVC_LEIXX       EKDATGA-------AWPLVLSYAKGIGGLRAGGIKTTFTEETETDLFGEQAVLCGGVS--
ILVC_ARTS2       EQDATGA-------AWDLAKSYAKAIGGTRAGVIKTTFTEETETDLFGEQAVLCGGVS--
ILVC_RENSM       EQDPSGN-------AWALALSYAKAIGGTRAGVIKTTFTEETETDLFGEQAVLCGGAS--
ILVC_KINRD       EQDATGQ-------AWALALAYAKAIGGLRAGGIKTTFTEETETDLFGEQAVLCGGAS--
ILVC_CUTAK       EQDASGI-------AWDLTRSYAKALGGLRAGGIETSFREETETDLFGEQAVLCGGLS--
ILVC_TROW8       EKDASGR-------CFDLALSYAKGIGALRAGAIQTTFTEETETDLFGEQAVLCGGLE--
ILVC_TROWT       EKDASGR-------CFDLALSYAKGIGALRAGAIQTTFTEETETDLFGEQAVLCGGLE--
ILVC1_BIFLO      EQDPRGD-------GWALTLAYAKALGALRAGAIKTTFKEETETDLFGEQNVLMGGVN--
ILVC2_BIFLO      EQDPDGK-------TWPLCLAYAKALGALRAGAIKTTFTEETETDLFGEQDVLMGGIN--
ILVC_XYLFA       HQDLSSH-------AEQLALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGVS--
ILVC_XYLFT       HQDLSSH-------AEQLALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGVS--
ILVC_XANAC       YQDTSGK-------AEQFALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGAS--
ILVC_XANC5       YQDTSGK-------AEQFALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGAS--
ILVC_XANOM       YQDTSGK-------AEQFALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGAS--
ILVC_XANOR       YQDTSGK-------AEQFALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGAS--
ILVC_XANCP       YQDTSGK-------AEQFALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGAS--
ILVC_XANC8       YQDTSGK-------AEQFALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGAS--
ILVC_CHLPM       HHDATGE-------AKQQALAWAKGLGGAKAGVIETTIKNETETDLFGEQAVLCGGSA--
ILVC_CHLPD       HQDYTGE-------AKQQALAWAKGLGGTKAGVIETTIKNETETDLFGEQAVLCGGSA--
ILVC_CHLCH       HQDPTGE-------AKQQALAWAKALGGTKAGVIETNFKNETETDLFGEQAVLCGGSA--
ILVC_PELLD       HQDATGE-------AKKTALAWAKGIGGTKAGVIETNFKDETETDLFGEQAVLCGGSA--
ILVC_CHLTE       HQDATGD-------AKAIALAWAKGIGGTKAGVIETSFKDETETDLFGEQAVLCGGSA--
ILVC_SALRD       DQDPSGG-------AMALAISYADAIGGTHAGVIETTFKDETETDLFGEQAVLCGGSQ--
ILVC_NATPD       YQDPSGE-------AHDLGLAYAKAIGCTRAGVVETTFREETETDLFGEQAVLCGGVT--
ILVC_HALMA       YQDATGN-------AKQESLAYAKGIGCTRAGVIETSFQEEVETDLFGEQAVLCGGVT--
ILVC_DESVV       HQDATGK-------AMEKALAYAKGVGGSRSGVIETTFREETETDLFGEQAVLCGGLS--
ILVC_DESVH       HQDATGK-------AMEKALAYAKGVGGSRSGVIETTFREETETDLFGEQAVLCGGLS--
ILVC_DESAG       HQDASGQ-------AMEKALAYAMGVGGTRSGVIETTFREETETDLFGEQAVLCGGIS--
ILVC_RHOBA       GEGASET-------TKQIGLAYAKGIGGTRGGVIETTFAEETETDLFGEQVVLCGGVS--
ILVC1_BACC1      YQDATGV-------ATEKALSYADGIGATRAGVLETTFKEETETDLFGEQAVLCGGVT--
ILVC1_BACCZ      YQDATGV-------ATEKALSYADGIGATRAGVLETTFKEETETDLFGEQAVLCGGVT--
ILVC1_BACHK      YQDATGV-------ATEKALSYADGIGATRAGVLETTFKEETETDLFGEQAVLCGGVT--
ILVC1_BACAN      YQDATGV-------ATEKALSYADGIGATRAGVLETTFKEETETDLFGEQAVLCGGVT--
ILVC1_BACCR      YQDATGV-------ATEKALSYADGIGATRAGVLETTFKEETETDLFGEQAVLCGGVT--
ILVC_BACCN       YQDATGT-------ATEKALSYADGIGATRAGVLETTFKEETETDLFGEQAVLCGGVT--
ILVC_OCEIH       HQDYTGE-------AKDVALAYSKGIGAARAGVLETSFQEETETDLFGEQAVLCGGVT--
ILVC_BACVZ       YQDVSGE-------AKDTALAYAKGIGGARAGVLETTFKEETETDLFGEQAVLCGGLT--
ILVC_BACSU       YQDVTGE-------ARDKALAYAKGIGGARAGVLETTFKEETETDLFGEQAVLCGGLS--
ILVC_BACLD       YQDVTGE-------AKDKALAYAKAIGGARAGVLETTFKEETETDLFGEQAVLCGGLT--
ILVC_BACP2       YQDVSGQ-------AKDKALAYAKAIGGARAGVLETTFKEETETDLFGEQAVLCGGLT--
ILVC_GEOKA       YQDVTGH-------ARETALAYAKAIGAARAGVLETTFKEETETDLFGEQAVLCGGLT--
ILVC_GEOTN       YQDVTGH-------AKETALAYAKAIGAARAGVLETTFKEETETDLFGEQAVLCGGLT--
ILVC_BACSK       YQDATGQ-------AKDIALAYAKQIGAARAGVLETTFKEETETDLFGEQAVLCGGTS--
ILVC_BACHD       YQDATGQ-------AKDIALAYSKMNGSARAGVIETTFQEETETDLFGEQAVLCGGTS--
ILVC2_BACAN      HQDATGT-------ALHVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVT--
ILVC2_BACHK      HQDATGT-------ALHVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVT--
ILVC2_BACCR      HQDATGT-------ALHVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVT--
ILVC2_BACCZ      HQDATGT-------ALHVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVT--
ILVC2_BACC1      HQDATGT-------ALHVALAYAKGVGCTRAGVIETTFQEETETDLFGEQTVLCGGVT--
ILVC_CALS4       HQNYTGK-------ALDIALAYAKGIGGTKAGAIETTFKEETETDLFGEQAVLCGGLT--
ILVC_CALS8       HQDYTGK-------ALDIALAYAKGIGASRAGIILTTFKEETETDLFGEQAVLCGGLT--
ILVC_CLOB8       HQDATGK-------AKQYALAYANGIGGARAGVLETTFKDETETDLFGEQAVLCGGVS--
ILVC_ALKMQ       YQDATGN-------TMDVALAYAAGIGGARAGVLKTTFKEETETDLFGEQAVLCGGVT--
ILVC_CLONN       AQDYTGK-------AKEYALAYTKGIGGTKGGVLETTFKDETETDLFGEQAVLCGGLT--
ILVC_CLOAB       HQDYTGK-------GKEIALAYGKGIGGTKGGVMNTTFKIETETDLFGEQAVLCGGIC--
ILVC_LACP7       HQDATGK-------AHDLGLAYALAIGGARAGVLETTFREETETDLFGEQAVLCGGVT--
ILVC_HUNT2       YQDASGK-------AKDYALAYAAGIGAGRAGILETTFKEETETDLFGEQAVLCGGVT--
ILVC_THEMA       YQDYTGK-------AKDIALAYAKGIGVTRAGVIETTFKEETETDLFGEQAVLCGGVT--
ILVC_THEP1       YQDYTGK-------AKDIALAYAKGIGVTRAGVIETTFKEETETDLFGEQAVLCGGVT--
ILVC_AQUAE       HQDASGT-------CKDKALAYAKGIGATRAGVIETTFKEETETDLFGEQMVLCGGVT--
ILVC_PETMO       HQDFSGK-------AKELGLSYAKGIGCTRAGVIKTTFKEETETDLFGEQAVLCGGTT--
ILVC_DESHY       HQDASGR-------AYDLALAYAKGIGCTRAGVLETTFKEETETDLFGEQAVLCGGVS--
ILVC_DESRM       HQDYTGK-------AKDIALAYAKGIGCTKAGVFETSFREETETDLFGEQAVLCGGVS--
ILVC_CARHZ       YQDATGK-------AKDLALAYAKGIGCTRAGVFETTFKEETETDLFGEQAVLCGGVT--
ILVC_SYNWW       QQDYSGK-------AKDLALAYACGIGCTRAGVIETSFQEETETDLFGEQCVLCGGVT--
ILVC_MOOTA       YQDASGK-------AKEIGLAYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGTT--
ILVC_DEHMC       EQDASGK-------AKELALAYAKGIGSNRAGILETTFAEETETDLFGEQAVLCGGTT--
ILVC_DEHMB       EQDASGK-------AKELALAYAKGIGSNRAGILETTFAEETETDLFGEQAVLCGGTT--
ILVC_DEHM1       EQDASGK-------AKEIALAYAKGIGSNRAGVLETTFAEETETDLFGEQAVLCGGTT--
ILVC_METST       EQDATGD-------AYDIAIEMAKAVGLTRAGVIETTYREETETDLFGEQAVLCGGLT--
ILVC_METS3       EQDATGD-------ALQLALGMAKACGFTKAGVIETTFKEETETDLFGEQAVLCGGLT--
ILVC_METTH       EVDATGD-------AMEQALAMAKACGLARAGVLETTFREETETDLFGEQAVLCGGVT--
ILVC_METM5       EIDATNN-------AFDIVSAMAKGIGLSRAGVIQTTFKEETETDLFGEQAVLCGGVT--
ILVC_METM7       EIDATNN-------AFDIVSAMAKGIGLSRAGVIQTTFKEETETDLFGEQAVLCGGVT--
ILVC_METMP       EIDATNN-------AFDIVSAMAKGIGLSRAGVIQTTFKEETETDLFGEQAVLCGGVT--
ILVC_METVS       EVDATNT-------AFETVSAMAKGIGLSRAGVIQTTFREETETDLFGEQAVLCGGVT--
ILVC_METJA       ERDYTGD-------ALQIALGMAKGIGLTKVGVIQTTFREETETDLFGEQVVLCGGVT--
ILVC_PYRIL       HQDYSGA-------ALKYALAIAKGIGATRAGVIETTFAEETETDLIGEQIVLVGGLM--
ILVC_PYRAE       YQDYSGS-------ALKYALALAKGIGATRAGVIETTFAEETETDLIGEQIVLVGGLM--
ILVC_PYRCJ       YQDYSGA-------ALKYALAIAKGIGATRAGVIETTFAEETETDLIGEQVVLVGGLM--
ILVC_PYRAR       YQNYSGR-------AMEYALAIAKGIGATRAGVIETTFAEETETDLIGEQTVLVGGLM--
ILVC_PYRAB       YQDYTGN-------AKDLALAMAKAIGCTRAGVIETTFKDETESDLIGEQLVLVGGLI--
ILVC_PYRFU       YQDYTGH-------AKELALAMAKAIGATRAGVIETTFKDETESDLIGEQLVLVGGLI--
ILVC_SULTO       HQNYSGK-------AFEKALAIAKALGATRAGVIETTFKEETETDLFGEQVDLVGGIT--
ILVC_SULAC       YQDHSGK-------ALQKALAVAKAIGATRAGVIETTFKEETETDLFGEQVDLVGGVM--
ILVC_SACS2       HQDVSGT-------ALHKALAIAKGIGATRAGVIPTTFKEETETDLFGEQVILVGGIM--
ILVC_METKA       HQDYTGE-------AMDLALAMAKAMGFTRAGVIKTTFREEVETDLFGEQVDLVGGVL--
ILVC_METAC       YQDATGK-------ARDLALAYAKGIGATRAGVYETTFREETETDLFGEQVDLCGGLS--
ILVC_METMA       YQDATGK-------ARDLALSYAKGIGATRAGVYETTFREETETDLFGEQVDLCGGLS--
ILVC_METBF       YQDATGN-------AREIALSYVKGIGATRAGVYETTFREETETDLFGEQVDLCGGLS--
ILVC_METBU       YQDASGN-------ALEMALAHAKGVGCTRAGVIETTFREETETDLFGEQVDLCGGVA--
ILVC_METAR       QQDASKK-------ALQYALAYAAGIGCTRAGVLATTFKEETETDLFGEQVDLCGGCT--
ILVC_METTP       KQDYSKS-------AKRIALAYAKGIGGTRAGVLETTFAEETETDLFGEQVDLCGGVT--
ILVC_ARCFU       EQNYTGK-------ALEVALAYAKGIGATRAGVIETTFKEETETDLFGEQVDLCGGVA--
ILVC_METB6       HQDHTCK-------AHKTALAYAKGIGATRAVVLETTFREETETDLFGEQAVLCGGTA--
ILVC_METLZ       EQDHTGN-------AKKLALAYAKGIGATRAVVLETTFREETETDLFGEQAVLCGGVT--
ILVC_METHJ       HQDVSGN-------GKKTALAYAKGIGATRAVVFETSFREETETDLFGEQAVLCGGMT--
ILVC_METMJ       HQDATGQ-------ARAIALAYARGIGATRAVVFETTFAEETETDLFGEQAVLCGGIT--
ILVC_KORVE       HQDASGK-------AREIALSYAAAIGTTRAGVLETTFKEETETDLFGEQAVLCGGAA--
ILVC_SORC5       HQDASGK-------AEAQALAYAKGIGATRAGVLLTTFAEETETDLFGEQAVLCGGAS--
ILVC_CHLAA       EQDATGG-------AFEDALAYAKGLGCTRAGVLRTTFAEETETDLFGEQVVLCGGVS--
ILVC_ROSCS       HQDASGN-------ALADALAYARGLGCTRAGVIETTFAEETETDLFGEQVVLCGGVS--
ILVC_SOLUE       HQNATGQ-------ALERALAYALALGCLKAGVIDTNFREETESDLFGEQAVLCGGAA--
ILVC_SYNJA       YQDASGM-------ARERAMAYAKAIGGTRAGILETSFREETETDLFGEQVVLCGGLT--
ILVC_SYNJB       YQDASGM-------ARERAMAYAKAIGGTRAGILETTFREETETDLFGEQVVLCGGLT--
ILVC_NOSS1       YQDASGK-------ARDRALSYAKGIGGTRGGVLETTFREETETDLFGEQAVLCGGLS--
ILVC_TRIV2       YQDASGK-------ARDRALSYAKGIGGTRGGVLETTFREETETDLFGEQAVLCGGLS--
ILVC_MICAN       YQDATGQ-------ARDRAMAYAKGIGGTRAGVLETTFREETETDLFGEQAVLCGGLS--
ILVC_TRIEI       FQDASGQ-------GRDRAMAYAKGIGGTRAGILETTFREETETDLFGEQVVLCGGLS--
ILVC_SYNY3       YQDASGQ-------ARDYAMAYAKGIGGTRAGILETTFREETETDLFGEQVVLCGGLT--
ILVC_ACAM1       YQDASGQ-------ARDRAMAYAKGIGGTRAGILETTFREETETDLFGEQAVLCGGLT--
ILVC_THEEB       YQDASGQ-------ARDLAMAYAKGIGGTRAGILETTFREETETDLFGEQVVLCGGLS--
ILVC_SYNE7       YQDASGQ-------ARDRAMAYAKGIGGTRAGILETSFREETETDLFGEQAVLCGGLS--
ILVC_SYNP6       YQDASGQ-------ARDRAMAYAKGIGGTRAGILETSFREETETDLFGEQAVLCGGLS--
ILVC_GLOVI       EQDASGR-------ARATAMAYARAIGGTRAGILETTFREEAETDLFGEQTVLCGGLT--
ILVC_SYNPW       EQDASGN-------ARGLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_SYNR3       EQDASGN-------ARGLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROM3       EQDASGQ-------ARALAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROMM       EQDASGQ-------ARALAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_SYNSC       EQDASGN-------ARGMAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_SYNPX       EQDASGQ-------ARGLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_SYNS9       EQDASGN-------ARGLTMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_SYNS3       EQDASGN-------ARGLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROM1       EQDASGN-------ARALAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROMT       EQDSSGN-------ARALAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROMA       EQDASGQ-------ARSLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROMS       EQDSSGN-------ARSLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROM2       EQDSSGS-------ARSLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROM0       EQDSSGS-------ARSLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROM9       EQDSSGN-------ARSLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROM5       EQDYSSN-------ARSLAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_PROMP       EQDYSGN-------ARSLAMSYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLS--
ILVC_ANADE       HQDATGQ-------AKAVGLAYARGIGCTRAGVLETTFKEETETDLFGEQAVLCGGAA--
ILVC_THET2       HQDASGS-------AFPTALAYAKAIGAARAGVIATTFKDETETDLFGEQAVLCGGLT--
ILVC_THET8       HQDASGS-------AFPTALAYAKAIGAARAGVIATTFKDETETDLFGEQAVLCGGLT--
ILVC_RUBXD       GRDATGQ-------ARDLVLSYAKGIGCARAGVLETTFAEETETDLFGEQAVLCGGLS--
ILVC_DEIGD       GQDASGN-------ARDLALAYARGIGGTRAGVLETTFKEETETDLFGEQSVLCGGVT--
ILVC_DEIRA       QQDASGK-------ARDIALAYARGIGCTKAGVLETTFKEETETDLFGEQSVLCGGVT--
ILVC_LEPBL       HQDSTGE-------AKKRALAHAAGVGGGRAGILETSFREETETDLFGEQVVLCGGLS--
ILVC_LEPBJ       HQDSTGE-------AKKRALAHAAGVGGGRAGILETSFREETETDLFGEQVVLCGGLS--
ILVC_LEPIC       YQDSSGE-------AKKRALAHAAGVGGGRAGILETSFREETETDLFGEQVVLCGGLS--
ILVC_LEPIN       YQDSSGE-------AKKRALAHAAGVGGGRAGILETSFREETETDLFGEQVVLCGGLS--
ILVC_CLOD6       YQDHTKK-------ATETVLAYAKGIGATRAGVLETTFKEETETDLFGEQSVLCGGIS--
ILVC_TREPR       KPQCEHL--------RALAVSYAIANGGGAAGIIETTFVDETETDLFGEQAVLCGGLV--
ILVC_HELPH       EQESSKN------NAKAVALSYAKAMGGGRMGVLKTSFKEECESDLFGEQAVLCGGLE--
ILVC_HELPJ       EQESSIH------NAKAVALSYAKAMGGGRMGVLETSFKEECESDLFGEQAVLCGGLE--
ILVC_HELPY       EQESSIH------NAKAVALSYAKAMGGGRMGVLETSFKEECESDLFGEQAVLCGGLE--
ILVC_HELAH       EQENSKN------NAKAVALSYAKAMGGGRMGVLETSFKEECESDLFGEQAVLCGGLE--
ILVC_ECOK1       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECOUT       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECO24       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECOL5       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECOL6       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SHIDS       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SHIBS       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SHISS       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SHIFL       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECOLC       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECOLI       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECOHS       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ECO57       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SALCH       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SALPB       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SALTI       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SALPA       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SALTY       HPENDPQ-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SALAR       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_KLEP7       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_CITK8       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ENT38       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_CROS8       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_YERP3       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_YERPS       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_YERPA       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQTILCGMLQAG
ILVC_YERPP       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQTILCGMLQAG
ILVC_YERPN       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQTILCGMLQAG
ILVC_YERPE       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQTILCGMLQAG
ILVC_YERE8       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SERP5       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_PECAS       HPENDPK-----GEGMAIAKAWAAATGGHRAGVLQSSFVAEVKSDLMGEQTILCGMLQAG
ILVC_PHOLL       HPENDPK-----GEGMAIAKAWAAATGAHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SODGM       HPENDPK-----GEGMTLAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_AERHH       HPENDPK-----GEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_AERS4       HPENDPK-----GVGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_HAEIE       HPENDPK-----GEGMAIAKAWAAATGGHKAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_HAEIN       HPENDPK-----GEGMAIAKAWAAATGGHKAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_HAEI8       HPENDPK-----GEGLAIAKAWAAATGGHKAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_HAEIG       HPENDPK-----GEGLAIAKAWAAATGGHKAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_PASMU       HPENDPN-----GDGLEIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_MANSM       HPANDPK-----GEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ACTSZ       HPANDPK-----GEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ACTP2       HPENDPK-----GEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_HISS2       HPENDPK-----GEGLAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_HAES1       HPENDPK-----GEGLAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_VIBVY       HPENDPK-----GEGWDIAKAWAAATGGHRAGCLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_VIBVU       HPENDPK-----GEGWDIAKAWAAATGGHRAGCLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_VIBPA       HPENDPK-----GEGWDIAKAWAAATGGHRAGCLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_ALIF1       HPENDPK-----GEGWDIAKAWAAGTGGHRAGCLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_VIBCH       HPENDPQ-----GEGWEIAKAWAAATGGHRAGCLASSFVAEVKSDLMGEQTILCGMLQAG
ILVC_VIBC3       HPENDPQ-----GEGWEIAKAWAAATGGHRAGCLASSFVAEVKSDLMGEQTILCGMLQAG
ILVC_PHOPR       HPENDPK-----GDGQEIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQAG
ILVC_SHEON       HPENDPN-----GDGLDIAKAYASATGGDRAGVLQSSFIAEVKSDLMGEQTILCGMLQTG
ILVC_BUCAI       HHENDIN-----KIGLEVAKAWAFSTGGHRAGVLESSFIAEVKSDLMGEQTILCGMLQTA
ILVC_BUCDN       HNENDYS-----NMGLEVAKAWAFSTGGHRAGVLESSFVAEVKSDLMGEQTILCGMLQTA
ILVC_BUCAP       HTENDPK-----KIGLEIAKAWAFSTGGHRAGVLESSFIAEVKSDLMGEQTILCGLLQTA
ILVC_BUCMH       HSENDPH-----DIGFEIAKSWAISIGSHHAGILHSSFIAEVKSDLMGEQTILCGMLQAS
ILVC_BUCSC       HMENDPK-----KIGFEIAKAWAYSLGSHRAGVLHSSFIAEVKSDLMGEQTILCGMLQTS
ILVC_BUCBP       HLDNDCH-----NIGLEVAKEWATAIGGHRAGVLHSSFSAEVKSDLMGEQTILCGLLQTG
ILVC_BLOFL       HEENNAY-----GTGMELAKSWACSIGSNKAGVLESSFVAEVKSDLMGEQTVLCGMLQVG
                                           *      :   :  *   **:***  * *     

ILVC_LEUMM       ------------------------------------------------------------
ILVC_LEUMC       ------------------------------------------------------------
ILVC_STAES       ------------------------------------------------------------
ILVC_STAEQ       ------------------------------------------------------------
ILVC_STAA1       ------------------------------------------------------------
ILVC_STAA9       ------------------------------------------------------------
ILVC_STAAB       ------------------------------------------------------------
ILVC_STAAN       ------------------------------------------------------------
ILVC_STAAM       ------------------------------------------------------------
ILVC_STAAW       ------------------------------------------------------------
ILVC_STAAR       ------------------------------------------------------------
ILVC_STAA2       ------------------------------------------------------------
ILVC_STAA8       ------------------------------------------------------------
ILVC_STAAE       ------------------------------------------------------------
ILVC_STAAC       ------------------------------------------------------------
ILVC_STAAT       ------------------------------------------------------------
ILVC_STAA3       ------------------------------------------------------------
ILVC_STAAS       ------------------------------------------------------------
ILVC_STAHJ       ------------------------------------------------------------
ILVC_STAS1       ------------------------------------------------------------
ILVC_LISMF       ------------------------------------------------------------
ILVC_LISIN       ------------------------------------------------------------
ILVC_LISW6       ------------------------------------------------------------
ILVC_LISMO       ------------------------------------------------------------
ILVC_STRR6       ------------------------------------------------------------
ILVC_STRPN       ------------------------------------------------------------
ILVC_STRP2       ------------------------------------------------------------
ILVC_STRSV       ------------------------------------------------------------
ILVC_STRGC       ------------------------------------------------------------
ILVC_STRT2       ------------------------------------------------------------
ILVC_STRT1       ------------------------------------------------------------
ILVC_STRTD       ------------------------------------------------------------
ILVC_STRTR       ------------------------------------------------------------
ILVC_STRS2       ------------------------------------------------------------
ILVC_STRSY       ------------------------------------------------------------
ILVC_STRMU       ------------------------------------------------------------
ILVC_LACLM       ------------------------------------------------------------
ILVC_LACLS       ------------------------------------------------------------
ILVC_LACLA       ------------------------------------------------------------
ILVC_RHIME       ------------------------------------------------------------
ILVC_SINMW       ------------------------------------------------------------
ILVC_RHIEC       ------------------------------------------------------------
ILVC_RHIL3       ------------------------------------------------------------
ILVC_AGRFC       ------------------------------------------------------------
ILVC_RHILO       ------------------------------------------------------------
ILVC_CHESB       ------------------------------------------------------------
ILVC_BRUO2       ------------------------------------------------------------
ILVC_BRUSU       ------------------------------------------------------------
ILVC_BRUC2       ------------------------------------------------------------
ILVC_BRUAB       ------------------------------------------------------------
ILVC_BRUA2       ------------------------------------------------------------
ILVC_BRUME       ------------------------------------------------------------
ILVC_BRUSI       ------------------------------------------------------------
ILVC_OCHA4       ------------------------------------------------------------
ILVC_BART1       ------------------------------------------------------------
ILVC_BARHE       ------------------------------------------------------------
ILVC_BARQU       ------------------------------------------------------------
ILVC_BARBK       ------------------------------------------------------------
ILVC_RHOPB       ------------------------------------------------------------
ILVC_RHOP5       ------------------------------------------------------------
ILVC_RHOP2       ------------------------------------------------------------
ILVC_RHOPS       ------------------------------------------------------------
ILVC_RHOPA       ------------------------------------------------------------
ILVC_BRASO       ------------------------------------------------------------
ILVC_BRASB       ------------------------------------------------------------
ILVC_NITWN       ------------------------------------------------------------
ILVC_NITHX       ------------------------------------------------------------
ILVC_BRADU       ------------------------------------------------------------
ILVC_AZOC5       ------------------------------------------------------------
ILVC_PARL1       ------------------------------------------------------------
ILVC_MAGSA       ------------------------------------------------------------
ILVC_PHAMO       ------------------------------------------------------------
ILVC_RHORT       ------------------------------------------------------------
ILVC_GRABC       ------------------------------------------------------------
ILVC_ACICJ       ------------------------------------------------------------
ILVC_GLUDA       ------------------------------------------------------------
ILVC_GLUOX       ------------------------------------------------------------
ILVC_CAUSK       ------------------------------------------------------------
ILVC_CAUVC       ------------------------------------------------------------
ILVC_RHOS1       ------------------------------------------------------------
ILVC_RHOS4       ------------------------------------------------------------
ILVC_RHOS5       ------------------------------------------------------------
ILVC_PARDP       ------------------------------------------------------------
ILVC_DINSH       ------------------------------------------------------------
ILVC_ROSDO       ------------------------------------------------------------
ILVC_JANSC       ------------------------------------------------------------
ILVC_RUEPO       ------------------------------------------------------------
ILVC_RUEST       ------------------------------------------------------------
ILVC_ERYLH       ------------------------------------------------------------
ILVC_NOVAD       ------------------------------------------------------------
ILVC_SPHAL       ------------------------------------------------------------
ILVC_SPHWW       ------------------------------------------------------------
ILVC_ZYMMO       ------------------------------------------------------------
ILVC_PELUB       ------------------------------------------------------------
ILVC_HYPNA       ------------------------------------------------------------
ILVC_GEOUR       ------------------------------------------------------------
ILVC_GEOMG       ------------------------------------------------------------
ILVC_GEOSL       ------------------------------------------------------------
ILVC_PELPD       ------------------------------------------------------------
ILVC_MAGMM       ------------------------------------------------------------
ILVC_METCA       ------------------------------------------------------------
ILVC_NITOC       ------------------------------------------------------------
ILVC_VESOH       ------------------------------------------------------------
ILVC_RUTMC       ------------------------------------------------------------
ILVC_ALKEH       ------------------------------------------------------------
ILVC_HALHL       ------------------------------------------------------------
ILVC_NITEU       ------------------------------------------------------------
ILVC_NITEC       ------------------------------------------------------------
ILVC_NITMU       ------------------------------------------------------------
ILVC_CUPMC       ------------------------------------------------------------
ILVC_CUPNH       ------------------------------------------------------------
ILVC_CUPPJ       ------------------------------------------------------------
ILVC_RALSO       ------------------------------------------------------------
ILVC_BURM7       ------------------------------------------------------------
ILVC_BURPS       ------------------------------------------------------------
ILVC_BURP1       ------------------------------------------------------------
ILVC_BURP0       ------------------------------------------------------------
ILVC_BURM9       ------------------------------------------------------------
ILVC_BURMS       ------------------------------------------------------------
ILVC_BURMA       ------------------------------------------------------------
ILVC_BURP6       ------------------------------------------------------------
ILVC_BURTA       ------------------------------------------------------------
ILVC_BURCH       ------------------------------------------------------------
ILVC_BURVG       ------------------------------------------------------------
ILVC_BURCA       ------------------------------------------------------------
ILVC_BURCM       ------------------------------------------------------------
ILVC_BURL3       ------------------------------------------------------------
ILVC_PARXL       ------------------------------------------------------------
ILVC_POLAQ       ------------------------------------------------------------
ILVC_JANMA       ------------------------------------------------------------
ILVC_HERAR       ------------------------------------------------------------
ILVC_POLNA       ------------------------------------------------------------
ILVC_POLSJ       ------------------------------------------------------------
ILVC_RHOFT       ------------------------------------------------------------
ILVC_METPP       ------------------------------------------------------------
ILVC_BORBR       ------------------------------------------------------------
ILVC_BORPA       ------------------------------------------------------------
ILVC_BORPE       ------------------------------------------------------------
ILVC_BORA1       ------------------------------------------------------------
ILVC_CHRVO       ------------------------------------------------------------
ILVC_METFK       ------------------------------------------------------------
ILVC_AZOSB       ------------------------------------------------------------
ILVC_DECAR       ------------------------------------------------------------
ILVC_AROAE       ------------------------------------------------------------
ILVC_ACIAC       ------------------------------------------------------------
ILVC_ACISJ       ------------------------------------------------------------
ILVC_NEIMF       ------------------------------------------------------------
ILVC_NEIMB       ------------------------------------------------------------
ILVC_NEIM0       ------------------------------------------------------------
ILVC_NEIMA       ------------------------------------------------------------
ILVC_NEIG1       ------------------------------------------------------------
ILVC_PSEAB       ------------------------------------------------------------
ILVC_PSEAE       ------------------------------------------------------------
ILVC_PSEA7       ------------------------------------------------------------
ILVC_PSEU5       ------------------------------------------------------------
ILVC_PSEU2       ------------------------------------------------------------
ILVC_PSE14       ------------------------------------------------------------
ILVC_PSESM       ------------------------------------------------------------
ILVC_PSEMY       ------------------------------------------------------------
ILVC_PSEPF       ------------------------------------------------------------
ILVC_PSEF5       ------------------------------------------------------------
ILVC_PSEPK       ------------------------------------------------------------
ILVC_PSEP1       ------------------------------------------------------------
ILVC_PSEPG       ------------------------------------------------------------
ILVC_PSEE4       ------------------------------------------------------------
ILVC_ALCBS       ------------------------------------------------------------
ILVC_MARHV       ------------------------------------------------------------
ILVC_HAHCH       ------------------------------------------------------------
ILVC_SACD2       ------------------------------------------------------------
ILVC_HYDCU       ------------------------------------------------------------
ILVC_PSYCK       ------------------------------------------------------------
ILVC_PSYA2       ------------------------------------------------------------
ILVC_PSYWF       ------------------------------------------------------------
ILVC_ACIAD       ------------------------------------------------------------
ILVC_THIDA       ------------------------------------------------------------
ILVC_CHRSD       ------------------------------------------------------------
ILVC_PRB01       ------------------------------------------------------------
ILVC_ARCB4       ------------------------------------------------------------
ILVC_SULDN       ------------------------------------------------------------
ILVC_NITSB       ------------------------------------------------------------
ILVC_HELHP       ------------------------------------------------------------
ILVC_WOLSU       ------------------------------------------------------------
ILVC_CAMC5       ------------------------------------------------------------
ILVC_CAMC1       ------------------------------------------------------------
ILVC_CAMFF       ------------------------------------------------------------
ILVC_CAMHC       ------------------------------------------------------------
ILVC_CAMJ8       ------------------------------------------------------------
ILVC_CAMJJ       ------------------------------------------------------------
ILVC_CAMJR       ------------------------------------------------------------
ILVC_CAMJE       ------------------------------------------------------------
ILVC_CAMJD       ------------------------------------------------------------
ILVC_MYCSK       ------------------------------------------------------------
ILVC_MYCSJ       ------------------------------------------------------------
ILVC_MYCSS       ------------------------------------------------------------
ILVC_MYCVP       ------------------------------------------------------------
ILVC_MYCGI       ------------------------------------------------------------
ILVC_MYCS2       ------------------------------------------------------------
ILVC_NOCFA       ------------------------------------------------------------
ILVC_RHOJR       ------------------------------------------------------------
ILVC_MYCPA       ------------------------------------------------------------
ILVC_MYCA1       ------------------------------------------------------------
ILVC_MYCAV       ------------------------------------------------------------
ILVC_MYCUA       ------------------------------------------------------------
ILVC_MYCLE       ------------------------------------------------------------
ILVC_MYCBP       ------------------------------------------------------------
ILVC_MYCTA       ------------------------------------------------------------
ILVC_MYCTU       ------------------------------------------------------------
ILVC_MYCBO       ------------------------------------------------------------
ILVC_CORGL       ------------------------------------------------------------
ILVC_CORGB       ------------------------------------------------------------
ILVC_COREF       ------------------------------------------------------------
ILVC_CORJK       ------------------------------------------------------------
ILVC_CORDI       ------------------------------------------------------------
ILVC1_STRCO      ------------------------------------------------------------
ILVC2_STRCO      ------------------------------------------------------------
ILVC_STRAW       ------------------------------------------------------------
ILVC_SALAI       ------------------------------------------------------------
ILVC_SALTO       ------------------------------------------------------------
ILVC_SACEN       ------------------------------------------------------------
ILVC_FRAAA       ------------------------------------------------------------
ILVC_FRACC       ------------------------------------------------------------
ILVC_THEFY       ------------------------------------------------------------
ILVC_CLAMS       ------------------------------------------------------------
ILVC_CLAM3       ------------------------------------------------------------
ILVC_LEIXX       ------------------------------------------------------------
ILVC_ARTS2       ------------------------------------------------------------
ILVC_RENSM       ------------------------------------------------------------
ILVC_KINRD       ------------------------------------------------------------
ILVC_CUTAK       ------------------------------------------------------------
ILVC_TROW8       ------------------------------------------------------------
ILVC_TROWT       ------------------------------------------------------------
ILVC1_BIFLO      ------------------------------------------------------------
ILVC2_BIFLO      ------------------------------------------------------------
ILVC_XYLFA       ------------------------------------------------------------
ILVC_XYLFT       ------------------------------------------------------------
ILVC_XANAC       ------------------------------------------------------------
ILVC_XANC5       ------------------------------------------------------------
ILVC_XANOM       ------------------------------------------------------------
ILVC_XANOR       ------------------------------------------------------------
ILVC_XANCP       ------------------------------------------------------------
ILVC_XANC8       ------------------------------------------------------------
ILVC_CHLPM       ------------------------------------------------------------
ILVC_CHLPD       ------------------------------------------------------------
ILVC_CHLCH       ------------------------------------------------------------
ILVC_PELLD       ------------------------------------------------------------
ILVC_CHLTE       ------------------------------------------------------------
ILVC_SALRD       ------------------------------------------------------------
ILVC_NATPD       ------------------------------------------------------------
ILVC_HALMA       ------------------------------------------------------------
ILVC_DESVV       ------------------------------------------------------------
ILVC_DESVH       ------------------------------------------------------------
ILVC_DESAG       ------------------------------------------------------------
ILVC_RHOBA       ------------------------------------------------------------
ILVC1_BACC1      ------------------------------------------------------------
ILVC1_BACCZ      ------------------------------------------------------------
ILVC1_BACHK      ------------------------------------------------------------
ILVC1_BACAN      ------------------------------------------------------------
ILVC1_BACCR      ------------------------------------------------------------
ILVC_BACCN       ------------------------------------------------------------
ILVC_OCEIH       ------------------------------------------------------------
ILVC_BACVZ       ------------------------------------------------------------
ILVC_BACSU       ------------------------------------------------------------
ILVC_BACLD       ------------------------------------------------------------
ILVC_BACP2       ------------------------------------------------------------
ILVC_GEOKA       ------------------------------------------------------------
ILVC_GEOTN       ------------------------------------------------------------
ILVC_BACSK       ------------------------------------------------------------
ILVC_BACHD       ------------------------------------------------------------
ILVC2_BACAN      ------------------------------------------------------------
ILVC2_BACHK      ------------------------------------------------------------
ILVC2_BACCR      ------------------------------------------------------------
ILVC2_BACCZ      ------------------------------------------------------------
ILVC2_BACC1      ------------------------------------------------------------
ILVC_CALS4       ------------------------------------------------------------
ILVC_CALS8       ------------------------------------------------------------
ILVC_CLOB8       ------------------------------------------------------------
ILVC_ALKMQ       ------------------------------------------------------------
ILVC_CLONN       ------------------------------------------------------------
ILVC_CLOAB       ------------------------------------------------------------
ILVC_LACP7       ------------------------------------------------------------
ILVC_HUNT2       ------------------------------------------------------------
ILVC_THEMA       ------------------------------------------------------------
ILVC_THEP1       ------------------------------------------------------------
ILVC_AQUAE       ------------------------------------------------------------
ILVC_PETMO       ------------------------------------------------------------
ILVC_DESHY       ------------------------------------------------------------
ILVC_DESRM       ------------------------------------------------------------
ILVC_CARHZ       ------------------------------------------------------------
ILVC_SYNWW       ------------------------------------------------------------
ILVC_MOOTA       ------------------------------------------------------------
ILVC_DEHMC       ------------------------------------------------------------
ILVC_DEHMB       ------------------------------------------------------------
ILVC_DEHM1       ------------------------------------------------------------
ILVC_METST       ------------------------------------------------------------
ILVC_METS3       ------------------------------------------------------------
ILVC_METTH       ------------------------------------------------------------
ILVC_METM5       ------------------------------------------------------------
ILVC_METM7       ------------------------------------------------------------
ILVC_METMP       ------------------------------------------------------------
ILVC_METVS       ------------------------------------------------------------
ILVC_METJA       ------------------------------------------------------------
ILVC_PYRIL       ------------------------------------------------------------
ILVC_PYRAE       ------------------------------------------------------------
ILVC_PYRCJ       ------------------------------------------------------------
ILVC_PYRAR       ------------------------------------------------------------
ILVC_PYRAB       ------------------------------------------------------------
ILVC_PYRFU       ------------------------------------------------------------
ILVC_SULTO       ------------------------------------------------------------
ILVC_SULAC       ------------------------------------------------------------
ILVC_SACS2       ------------------------------------------------------------
ILVC_METKA       ------------------------------------------------------------
ILVC_METAC       ------------------------------------------------------------
ILVC_METMA       ------------------------------------------------------------
ILVC_METBF       ------------------------------------------------------------
ILVC_METBU       ------------------------------------------------------------
ILVC_METAR       ------------------------------------------------------------
ILVC_METTP       ------------------------------------------------------------
ILVC_ARCFU       ------------------------------------------------------------
ILVC_METB6       ------------------------------------------------------------
ILVC_METLZ       ------------------------------------------------------------
ILVC_METHJ       ------------------------------------------------------------
ILVC_METMJ       ------------------------------------------------------------
ILVC_KORVE       ------------------------------------------------------------
ILVC_SORC5       ------------------------------------------------------------
ILVC_CHLAA       ------------------------------------------------------------
ILVC_ROSCS       ------------------------------------------------------------
ILVC_SOLUE       ------------------------------------------------------------
ILVC_SYNJA       ------------------------------------------------------------
ILVC_SYNJB       ------------------------------------------------------------
ILVC_NOSS1       ------------------------------------------------------------
ILVC_TRIV2       ------------------------------------------------------------
ILVC_MICAN       ------------------------------------------------------------
ILVC_TRIEI       ------------------------------------------------------------
ILVC_SYNY3       ------------------------------------------------------------
ILVC_ACAM1       ------------------------------------------------------------
ILVC_THEEB       ------------------------------------------------------------
ILVC_SYNE7       ------------------------------------------------------------
ILVC_SYNP6       ------------------------------------------------------------
ILVC_GLOVI       ------------------------------------------------------------
ILVC_SYNPW       ------------------------------------------------------------
ILVC_SYNR3       ------------------------------------------------------------
ILVC_PROM3       ------------------------------------------------------------
ILVC_PROMM       ------------------------------------------------------------
ILVC_SYNSC       ------------------------------------------------------------
ILVC_SYNPX       ------------------------------------------------------------
ILVC_SYNS9       ------------------------------------------------------------
ILVC_SYNS3       ------------------------------------------------------------
ILVC_PROM1       ------------------------------------------------------------
ILVC_PROMT       ------------------------------------------------------------
ILVC_PROMA       ------------------------------------------------------------
ILVC_PROMS       ------------------------------------------------------------
ILVC_PROM2       ------------------------------------------------------------
ILVC_PROM0       ------------------------------------------------------------
ILVC_PROM9       ------------------------------------------------------------
ILVC_PROM5       ------------------------------------------------------------
ILVC_PROMP       ------------------------------------------------------------
ILVC_ANADE       ------------------------------------------------------------
ILVC_THET2       ------------------------------------------------------------
ILVC_THET8       ------------------------------------------------------------
ILVC_RUBXD       ------------------------------------------------------------
ILVC_DEIGD       ------------------------------------------------------------
ILVC_DEIRA       ------------------------------------------------------------
ILVC_LEPBL       ------------------------------------------------------------
ILVC_LEPBJ       ------------------------------------------------------------
ILVC_LEPIC       ------------------------------------------------------------
ILVC_LEPIN       ------------------------------------------------------------
ILVC_CLOD6       ------------------------------------------------------------
ILVC_TREPR       ------------------------------------------------------------
ILVC_HELPH       ------------------------------------------------------------
ILVC_HELPJ       ------------------------------------------------------------
ILVC_HELPY       ------------------------------------------------------------
ILVC_HELAH       ------------------------------------------------------------
ILVC_ECOK1       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECOUT       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECO24       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECOL5       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECOL6       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SHIDS       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SHIBS       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SHISS       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SHIFL       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECOLC       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECOLI       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECOHS       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ECO57       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SALCH       SLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SALPB       SLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SALTI       SLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SALPA       SLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SALTY       SLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SALAR       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_KLEP7       SLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_CITK8       SLLCFDKLVEEGTDPAYAEKLIQYGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_ENT38       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_CROS8       SLLCFDKLVEEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_YERP3       SLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_YERPS       SLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_YERPA       SLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_YERPP       SLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_YERPN       SLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_YERPE       SLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_YERE8       SLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SERP5       SLLCFDKLVAEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_PECAS       SLLGFDKLVSEGTDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_PHOLL       SLLCYDKLVADGAEPGYAGKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQL
ILVC_SODGM       SLLCFDKMVADGVDPAYAGKLIQFGWETTTEALKQGGITLMMDRLSNSAKLRAYALSEQL
ILVC_AERHH       SLLCYDKLVAEGTDPAYAGKLIQFGWETITEALKQGGISLMMDRLSNPAKLRAFELSEQL
ILVC_AERS4       SLLCYDKLVAEGTDPAYAGKLIQFGWETITEALKQGGISLMMDRLSNPAKLRAFELSEQL
ILVC_HAEIE       SIVCYDKLVADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELAEQI
ILVC_HAEIN       SIVCYDKLVADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELAEQI
ILVC_HAEI8       SIVCYDKLVADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELAEQI
ILVC_HAEIG       SIVCYDKLVADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELAEQI
ILVC_PASMU       SIVCYDKLVADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELSEQI
ILVC_MANSM       SIVCYDKLVADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKIRAFELAEEI
ILVC_ACTSZ       SIVCYDKLIADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNAAKLRAFELSEQI
ILVC_ACTP2       SIVCYDKLVADGKDPAYASKLIQYGWETITEALKQGGITLMMDRLSNAAKIRAFELSEEI
ILVC_HISS2       SLVCYDKLIADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFSLSEQI
ILVC_HAES1       SLVCYDKLIADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFSLSEQI
ILVC_VIBVY       SIVCYEKMVAEGIDPGYAGKLLQYGWETITEALKFGGITHMMDRLSNPAKIKAFELSEEL
ILVC_VIBVU       SIVCYEKMVAEGIDPGYAGKLLQYGWETITEALKFGGITHMMDRLSNPAKIKAFELSEEL
ILVC_VIBPA       SIVCYEKMIAEGIDPGYAGKLLQYGWETITEALKFGGITHMMDRLSNPAKIKAFELSEEL
ILVC_ALIF1       SIVSYEKMIADGIEPGYAGKLLQYGWETITEALKFGGVTHMMDRLSNPAKVKAFELSEEL
ILVC_VIBCH       SIVCYEKMVADGIDPGYAGKLLQFGWETITEALKFGGITHMMDRLSNPAKIKAFELSEEL
ILVC_VIBC3       SIVCYEKMVADGIDPGYAGKLLQFGWETITEALKFGGITHMMDRLSNPAKIKAFELSEEL
ILVC_PHOPR       SIVCYEKMIADGIDAGYAGKLLQYGWETITEALKFGGITHMMDRLSNPAKVKAFELSEEL
ILVC_SHEON       AILGYEKMVADGVEPGYAAKLIQQGWETVTEALKHGGITNMMDRLSNPAKIKAFEIAEDL
ILVC_BUCAI       SLLCYEKLITEKCNPAYSAKLIQNGWETITESLKHGGITLMMDRLSNSSKIRAYKLSKEI
ILVC_BUCDN       SLVCYEKLITTQNHPGYAGKLIQFGWETITESLKHGGITLMMDRLSNSSKIRAFKLSQEI
ILVC_BUCAP       SLICYEKLIKDKHNPSYAAKLIQYGWETITESLKHGGITLMMDRLSNPSKIKAFKISKKI
ILVC_BUCMH       SLVCYNQLIFQGVNPSYAGKLIQTGWEVITESVKHGGITLMLDRLSNTAKIRAYFLSKKL
ILVC_BUCSC       SLVCYDQLVSQGKDPNYAGKLIQLGWESITESVKHGGITLMLNRLSNTAKIRAYILSKKL
ILVC_BUCBP       SVLCYDKLISQGHDCHYAVKLVQSGWEVITESLKHGGITLMFDRLSNTAKIRAYKLSNDL
ILVC_BLOFL       SIFCFDKMVEDGLDSGYAGKLVQNGWEVITEALKQGGITLMMDRLSNVSKLRAFELSDQL
                                                                             

ILVC_LEUMM       ------------------------------------------------------------
ILVC_LEUMC       ------------------------------------------------------------
ILVC_STAES       ------------------------------------------------------------
ILVC_STAEQ       ------------------------------------------------------------
ILVC_STAA1       ------------------------------------------------------------
ILVC_STAA9       ------------------------------------------------------------
ILVC_STAAB       ------------------------------------------------------------
ILVC_STAAN       ------------------------------------------------------------
ILVC_STAAM       ------------------------------------------------------------
ILVC_STAAW       ------------------------------------------------------------
ILVC_STAAR       ------------------------------------------------------------
ILVC_STAA2       ------------------------------------------------------------
ILVC_STAA8       ------------------------------------------------------------
ILVC_STAAE       ------------------------------------------------------------
ILVC_STAAC       ------------------------------------------------------------
ILVC_STAAT       ------------------------------------------------------------
ILVC_STAA3       ------------------------------------------------------------
ILVC_STAAS       ------------------------------------------------------------
ILVC_STAHJ       ------------------------------------------------------------
ILVC_STAS1       ------------------------------------------------------------
ILVC_LISMF       ------------------------------------------------------------
ILVC_LISIN       ------------------------------------------------------------
ILVC_LISW6       ------------------------------------------------------------
ILVC_LISMO       ------------------------------------------------------------
ILVC_STRR6       ------------------------------------------------------------
ILVC_STRPN       ------------------------------------------------------------
ILVC_STRP2       ------------------------------------------------------------
ILVC_STRSV       ------------------------------------------------------------
ILVC_STRGC       ------------------------------------------------------------
ILVC_STRT2       ------------------------------------------------------------
ILVC_STRT1       ------------------------------------------------------------
ILVC_STRTD       ------------------------------------------------------------
ILVC_STRTR       ------------------------------------------------------------
ILVC_STRS2       ------------------------------------------------------------
ILVC_STRSY       ------------------------------------------------------------
ILVC_STRMU       ------------------------------------------------------------
ILVC_LACLM       ------------------------------------------------------------
ILVC_LACLS       ------------------------------------------------------------
ILVC_LACLA       ------------------------------------------------------------
ILVC_RHIME       ------------------------------------------------------------
ILVC_SINMW       ------------------------------------------------------------
ILVC_RHIEC       ------------------------------------------------------------
ILVC_RHIL3       ------------------------------------------------------------
ILVC_AGRFC       ------------------------------------------------------------
ILVC_RHILO       ------------------------------------------------------------
ILVC_CHESB       ------------------------------------------------------------
ILVC_BRUO2       ------------------------------------------------------------
ILVC_BRUSU       ------------------------------------------------------------
ILVC_BRUC2       ------------------------------------------------------------
ILVC_BRUAB       ------------------------------------------------------------
ILVC_BRUA2       ------------------------------------------------------------
ILVC_BRUME       ------------------------------------------------------------
ILVC_BRUSI       ------------------------------------------------------------
ILVC_OCHA4       ------------------------------------------------------------
ILVC_BART1       ------------------------------------------------------------
ILVC_BARHE       ------------------------------------------------------------
ILVC_BARQU       ------------------------------------------------------------
ILVC_BARBK       ------------------------------------------------------------
ILVC_RHOPB       ------------------------------------------------------------
ILVC_RHOP5       ------------------------------------------------------------
ILVC_RHOP2       ------------------------------------------------------------
ILVC_RHOPS       ------------------------------------------------------------
ILVC_RHOPA       ------------------------------------------------------------
ILVC_BRASO       ------------------------------------------------------------
ILVC_BRASB       ------------------------------------------------------------
ILVC_NITWN       ------------------------------------------------------------
ILVC_NITHX       ------------------------------------------------------------
ILVC_BRADU       ------------------------------------------------------------
ILVC_AZOC5       ------------------------------------------------------------
ILVC_PARL1       ------------------------------------------------------------
ILVC_MAGSA       ------------------------------------------------------------
ILVC_PHAMO       ------------------------------------------------------------
ILVC_RHORT       ------------------------------------------------------------
ILVC_GRABC       ------------------------------------------------------------
ILVC_ACICJ       ------------------------------------------------------------
ILVC_GLUDA       ------------------------------------------------------------
ILVC_GLUOX       ------------------------------------------------------------
ILVC_CAUSK       ------------------------------------------------------------
ILVC_CAUVC       ------------------------------------------------------------
ILVC_RHOS1       ------------------------------------------------------------
ILVC_RHOS4       ------------------------------------------------------------
ILVC_RHOS5       ------------------------------------------------------------
ILVC_PARDP       ------------------------------------------------------------
ILVC_DINSH       ------------------------------------------------------------
ILVC_ROSDO       ------------------------------------------------------------
ILVC_JANSC       ------------------------------------------------------------
ILVC_RUEPO       ------------------------------------------------------------
ILVC_RUEST       ------------------------------------------------------------
ILVC_ERYLH       ------------------------------------------------------------
ILVC_NOVAD       ------------------------------------------------------------
ILVC_SPHAL       ------------------------------------------------------------
ILVC_SPHWW       ------------------------------------------------------------
ILVC_ZYMMO       ------------------------------------------------------------
ILVC_PELUB       ------------------------------------------------------------
ILVC_HYPNA       ------------------------------------------------------------
ILVC_GEOUR       ------------------------------------------------------------
ILVC_GEOMG       ------------------------------------------------------------
ILVC_GEOSL       ------------------------------------------------------------
ILVC_PELPD       ------------------------------------------------------------
ILVC_MAGMM       ------------------------------------------------------------
ILVC_METCA       ------------------------------------------------------------
ILVC_NITOC       ------------------------------------------------------------
ILVC_VESOH       ------------------------------------------------------------
ILVC_RUTMC       ------------------------------------------------------------
ILVC_ALKEH       ------------------------------------------------------------
ILVC_HALHL       ------------------------------------------------------------
ILVC_NITEU       ------------------------------------------------------------
ILVC_NITEC       ------------------------------------------------------------
ILVC_NITMU       ------------------------------------------------------------
ILVC_CUPMC       ------------------------------------------------------------
ILVC_CUPNH       ------------------------------------------------------------
ILVC_CUPPJ       ------------------------------------------------------------
ILVC_RALSO       ------------------------------------------------------------
ILVC_BURM7       ------------------------------------------------------------
ILVC_BURPS       ------------------------------------------------------------
ILVC_BURP1       ------------------------------------------------------------
ILVC_BURP0       ------------------------------------------------------------
ILVC_BURM9       ------------------------------------------------------------
ILVC_BURMS       ------------------------------------------------------------
ILVC_BURMA       ------------------------------------------------------------
ILVC_BURP6       ------------------------------------------------------------
ILVC_BURTA       ------------------------------------------------------------
ILVC_BURCH       ------------------------------------------------------------
ILVC_BURVG       ------------------------------------------------------------
ILVC_BURCA       ------------------------------------------------------------
ILVC_BURCM       ------------------------------------------------------------
ILVC_BURL3       ------------------------------------------------------------
ILVC_PARXL       ------------------------------------------------------------
ILVC_POLAQ       ------------------------------------------------------------
ILVC_JANMA       ------------------------------------------------------------
ILVC_HERAR       ------------------------------------------------------------
ILVC_POLNA       ------------------------------------------------------------
ILVC_POLSJ       ------------------------------------------------------------
ILVC_RHOFT       ------------------------------------------------------------
ILVC_METPP       ------------------------------------------------------------
ILVC_BORBR       ------------------------------------------------------------
ILVC_BORPA       ------------------------------------------------------------
ILVC_BORPE       ------------------------------------------------------------
ILVC_BORA1       ------------------------------------------------------------
ILVC_CHRVO       ------------------------------------------------------------
ILVC_METFK       ------------------------------------------------------------
ILVC_AZOSB       ------------------------------------------------------------
ILVC_DECAR       ------------------------------------------------------------
ILVC_AROAE       ------------------------------------------------------------
ILVC_ACIAC       ------------------------------------------------------------
ILVC_ACISJ       ------------------------------------------------------------
ILVC_NEIMF       ------------------------------------------------------------
ILVC_NEIMB       ------------------------------------------------------------
ILVC_NEIM0       ------------------------------------------------------------
ILVC_NEIMA       ------------------------------------------------------------
ILVC_NEIG1       ------------------------------------------------------------
ILVC_PSEAB       ------------------------------------------------------------
ILVC_PSEAE       ------------------------------------------------------------
ILVC_PSEA7       ------------------------------------------------------------
ILVC_PSEU5       ------------------------------------------------------------
ILVC_PSEU2       ------------------------------------------------------------
ILVC_PSE14       ------------------------------------------------------------
ILVC_PSESM       ------------------------------------------------------------
ILVC_PSEMY       ------------------------------------------------------------
ILVC_PSEPF       ------------------------------------------------------------
ILVC_PSEF5       ------------------------------------------------------------
ILVC_PSEPK       ------------------------------------------------------------
ILVC_PSEP1       ------------------------------------------------------------
ILVC_PSEPG       ------------------------------------------------------------
ILVC_PSEE4       ------------------------------------------------------------
ILVC_ALCBS       ------------------------------------------------------------
ILVC_MARHV       ------------------------------------------------------------
ILVC_HAHCH       ------------------------------------------------------------
ILVC_SACD2       ------------------------------------------------------------
ILVC_HYDCU       ------------------------------------------------------------
ILVC_PSYCK       ------------------------------------------------------------
ILVC_PSYA2       ------------------------------------------------------------
ILVC_PSYWF       ------------------------------------------------------------
ILVC_ACIAD       ------------------------------------------------------------
ILVC_THIDA       ------------------------------------------------------------
ILVC_CHRSD       ------------------------------------------------------------
ILVC_PRB01       ------------------------------------------------------------
ILVC_ARCB4       ------------------------------------------------------------
ILVC_SULDN       ------------------------------------------------------------
ILVC_NITSB       ------------------------------------------------------------
ILVC_HELHP       ------------------------------------------------------------
ILVC_WOLSU       ------------------------------------------------------------
ILVC_CAMC5       ------------------------------------------------------------
ILVC_CAMC1       ------------------------------------------------------------
ILVC_CAMFF       ------------------------------------------------------------
ILVC_CAMHC       ------------------------------------------------------------
ILVC_CAMJ8       ------------------------------------------------------------
ILVC_CAMJJ       ------------------------------------------------------------
ILVC_CAMJR       ------------------------------------------------------------
ILVC_CAMJE       ------------------------------------------------------------
ILVC_CAMJD       ------------------------------------------------------------
ILVC_MYCSK       ------------------------------------------------------------
ILVC_MYCSJ       ------------------------------------------------------------
ILVC_MYCSS       ------------------------------------------------------------
ILVC_MYCVP       ------------------------------------------------------------
ILVC_MYCGI       ------------------------------------------------------------
ILVC_MYCS2       ------------------------------------------------------------
ILVC_NOCFA       ------------------------------------------------------------
ILVC_RHOJR       ------------------------------------------------------------
ILVC_MYCPA       ------------------------------------------------------------
ILVC_MYCA1       ------------------------------------------------------------
ILVC_MYCAV       ------------------------------------------------------------
ILVC_MYCUA       ------------------------------------------------------------
ILVC_MYCLE       ------------------------------------------------------------
ILVC_MYCBP       ------------------------------------------------------------
ILVC_MYCTA       ------------------------------------------------------------
ILVC_MYCTU       ------------------------------------------------------------
ILVC_MYCBO       ------------------------------------------------------------
ILVC_CORGL       ------------------------------------------------------------
ILVC_CORGB       ------------------------------------------------------------
ILVC_COREF       ------------------------------------------------------------
ILVC_CORJK       ------------------------------------------------------------
ILVC_CORDI       ------------------------------------------------------------
ILVC1_STRCO      ------------------------------------------------------------
ILVC2_STRCO      ------------------------------------------------------------
ILVC_STRAW       ------------------------------------------------------------
ILVC_SALAI       ------------------------------------------------------------
ILVC_SALTO       ------------------------------------------------------------
ILVC_SACEN       ------------------------------------------------------------
ILVC_FRAAA       ------------------------------------------------------------
ILVC_FRACC       ------------------------------------------------------------
ILVC_THEFY       ------------------------------------------------------------
ILVC_CLAMS       ------------------------------------------------------------
ILVC_CLAM3       ------------------------------------------------------------
ILVC_LEIXX       ------------------------------------------------------------
ILVC_ARTS2       ------------------------------------------------------------
ILVC_RENSM       ------------------------------------------------------------
ILVC_KINRD       ------------------------------------------------------------
ILVC_CUTAK       ------------------------------------------------------------
ILVC_TROW8       ------------------------------------------------------------
ILVC_TROWT       ------------------------------------------------------------
ILVC1_BIFLO      ------------------------------------------------------------
ILVC2_BIFLO      ------------------------------------------------------------
ILVC_XYLFA       ------------------------------------------------------------
ILVC_XYLFT       ------------------------------------------------------------
ILVC_XANAC       ------------------------------------------------------------
ILVC_XANC5       ------------------------------------------------------------
ILVC_XANOM       ------------------------------------------------------------
ILVC_XANOR       ------------------------------------------------------------
ILVC_XANCP       ------------------------------------------------------------
ILVC_XANC8       ------------------------------------------------------------
ILVC_CHLPM       ------------------------------------------------------------
ILVC_CHLPD       ------------------------------------------------------------
ILVC_CHLCH       ------------------------------------------------------------
ILVC_PELLD       ------------------------------------------------------------
ILVC_CHLTE       ------------------------------------------------------------
ILVC_SALRD       ------------------------------------------------------------
ILVC_NATPD       ------------------------------------------------------------
ILVC_HALMA       ------------------------------------------------------------
ILVC_DESVV       ------------------------------------------------------------
ILVC_DESVH       ------------------------------------------------------------
ILVC_DESAG       ------------------------------------------------------------
ILVC_RHOBA       ------------------------------------------------------------
ILVC1_BACC1      ------------------------------------------------------------
ILVC1_BACCZ      ------------------------------------------------------------
ILVC1_BACHK      ------------------------------------------------------------
ILVC1_BACAN      ------------------------------------------------------------
ILVC1_BACCR      ------------------------------------------------------------
ILVC_BACCN       ------------------------------------------------------------
ILVC_OCEIH       ------------------------------------------------------------
ILVC_BACVZ       ------------------------------------------------------------
ILVC_BACSU       ------------------------------------------------------------
ILVC_BACLD       ------------------------------------------------------------
ILVC_BACP2       ------------------------------------------------------------
ILVC_GEOKA       ------------------------------------------------------------
ILVC_GEOTN       ------------------------------------------------------------
ILVC_BACSK       ------------------------------------------------------------
ILVC_BACHD       ------------------------------------------------------------
ILVC2_BACAN      ------------------------------------------------------------
ILVC2_BACHK      ------------------------------------------------------------
ILVC2_BACCR      ------------------------------------------------------------
ILVC2_BACCZ      ------------------------------------------------------------
ILVC2_BACC1      ------------------------------------------------------------
ILVC_CALS4       ------------------------------------------------------------
ILVC_CALS8       ------------------------------------------------------------
ILVC_CLOB8       ------------------------------------------------------------
ILVC_ALKMQ       ------------------------------------------------------------
ILVC_CLONN       ------------------------------------------------------------
ILVC_CLOAB       ------------------------------------------------------------
ILVC_LACP7       ------------------------------------------------------------
ILVC_HUNT2       ------------------------------------------------------------
ILVC_THEMA       ------------------------------------------------------------
ILVC_THEP1       ------------------------------------------------------------
ILVC_AQUAE       ------------------------------------------------------------
ILVC_PETMO       ------------------------------------------------------------
ILVC_DESHY       ------------------------------------------------------------
ILVC_DESRM       ------------------------------------------------------------
ILVC_CARHZ       ------------------------------------------------------------
ILVC_SYNWW       ------------------------------------------------------------
ILVC_MOOTA       ------------------------------------------------------------
ILVC_DEHMC       ------------------------------------------------------------
ILVC_DEHMB       ------------------------------------------------------------
ILVC_DEHM1       ------------------------------------------------------------
ILVC_METST       ------------------------------------------------------------
ILVC_METS3       ------------------------------------------------------------
ILVC_METTH       ------------------------------------------------------------
ILVC_METM5       ------------------------------------------------------------
ILVC_METM7       ------------------------------------------------------------
ILVC_METMP       ------------------------------------------------------------
ILVC_METVS       ------------------------------------------------------------
ILVC_METJA       ------------------------------------------------------------
ILVC_PYRIL       ------------------------------------------------------------
ILVC_PYRAE       ------------------------------------------------------------
ILVC_PYRCJ       ------------------------------------------------------------
ILVC_PYRAR       ------------------------------------------------------------
ILVC_PYRAB       ------------------------------------------------------------
ILVC_PYRFU       ------------------------------------------------------------
ILVC_SULTO       ------------------------------------------------------------
ILVC_SULAC       ------------------------------------------------------------
ILVC_SACS2       ------------------------------------------------------------
ILVC_METKA       ------------------------------------------------------------
ILVC_METAC       ------------------------------------------------------------
ILVC_METMA       ------------------------------------------------------------
ILVC_METBF       ------------------------------------------------------------
ILVC_METBU       ------------------------------------------------------------
ILVC_METAR       ------------------------------------------------------------
ILVC_METTP       ------------------------------------------------------------
ILVC_ARCFU       ------------------------------------------------------------
ILVC_METB6       ------------------------------------------------------------
ILVC_METLZ       ------------------------------------------------------------
ILVC_METHJ       ------------------------------------------------------------
ILVC_METMJ       ------------------------------------------------------------
ILVC_KORVE       ------------------------------------------------------------
ILVC_SORC5       ------------------------------------------------------------
ILVC_CHLAA       ------------------------------------------------------------
ILVC_ROSCS       ------------------------------------------------------------
ILVC_SOLUE       ------------------------------------------------------------
ILVC_SYNJA       ------------------------------------------------------------
ILVC_SYNJB       ------------------------------------------------------------
ILVC_NOSS1       ------------------------------------------------------------
ILVC_TRIV2       ------------------------------------------------------------
ILVC_MICAN       ------------------------------------------------------------
ILVC_TRIEI       ------------------------------------------------------------
ILVC_SYNY3       ------------------------------------------------------------
ILVC_ACAM1       ------------------------------------------------------------
ILVC_THEEB       ------------------------------------------------------------
ILVC_SYNE7       ------------------------------------------------------------
ILVC_SYNP6       ------------------------------------------------------------
ILVC_GLOVI       ------------------------------------------------------------
ILVC_SYNPW       ------------------------------------------------------------
ILVC_SYNR3       ------------------------------------------------------------
ILVC_PROM3       ------------------------------------------------------------
ILVC_PROMM       ------------------------------------------------------------
ILVC_SYNSC       ------------------------------------------------------------
ILVC_SYNPX       ------------------------------------------------------------
ILVC_SYNS9       ------------------------------------------------------------
ILVC_SYNS3       ------------------------------------------------------------
ILVC_PROM1       ------------------------------------------------------------
ILVC_PROMT       ------------------------------------------------------------
ILVC_PROMA       ------------------------------------------------------------
ILVC_PROMS       ------------------------------------------------------------
ILVC_PROM2       ------------------------------------------------------------
ILVC_PROM0       ------------------------------------------------------------
ILVC_PROM9       ------------------------------------------------------------
ILVC_PROM5       ------------------------------------------------------------
ILVC_PROMP       ------------------------------------------------------------
ILVC_ANADE       ------------------------------------------------------------
ILVC_THET2       ------------------------------------------------------------
ILVC_THET8       ------------------------------------------------------------
ILVC_RUBXD       ------------------------------------------------------------
ILVC_DEIGD       ------------------------------------------------------------
ILVC_DEIRA       ------------------------------------------------------------
ILVC_LEPBL       ------------------------------------------------------------
ILVC_LEPBJ       ------------------------------------------------------------
ILVC_LEPIC       ------------------------------------------------------------
ILVC_LEPIN       ------------------------------------------------------------
ILVC_CLOD6       ------------------------------------------------------------
ILVC_TREPR       ------------------------------------------------------------
ILVC_HELPH       ------------------------------------------------------------
ILVC_HELPJ       ------------------------------------------------------------
ILVC_HELPY       ------------------------------------------------------------
ILVC_HELAH       ------------------------------------------------------------
ILVC_ECOK1       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECOUT       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECO24       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECOL5       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECOL6       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_SHIDS       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_SHIBS       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_SHISS       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_SHIFL       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECOLC       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECOLI       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECOHS       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ECO57       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_SALCH       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQFEG-KIGE
ILVC_SALPB       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQFEG-KIGE
ILVC_SALTI       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQFEG-KIGE
ILVC_SALPA       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQFEG-KIGE
ILVC_SALTY       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_SALAR       KAIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_KLEP7       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_CITK8       KTIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFETAPQYEG-KIGE
ILVC_ENT38       KEIMAPLFQKHMDDIISGEFSSGMMSDWANDDKNLLTWREETGKTAFETASQFDG-KISE
ILVC_CROS8       KTIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFENAPQYEG-KISE
ILVC_YERP3       KEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEG-KISE
ILVC_YERPS       KEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEG-KISE
ILVC_YERPA       KEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEG-KISE
ILVC_YERPP       KEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEG-KISE
ILVC_YERPN       KEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEG-KISE
ILVC_YERPE       KEIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEG-KISE
ILVC_YERE8       KEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLNWREETGKTAFENAPQFEG-KISE
ILVC_SERP5       KGIMAPLFQKHMDDIISGAFSGGMMADWAEDDVKLLNWREETGKSAFENAPQFEG-KISE
ILVC_PECAS       KGIMAPLFQKHMDDIISGEFSGGMMADWANDDVKLLTWREETGKTAFENAPQFDG-KIAE
ILVC_PHOLL       KEMMTPLFQKHMDDIISGEFSSGMMADWANDDKKLLGWREETGNTSFENSPEYDG-KISE
ILVC_SODGM       KQLMQPLFEKHMDDIITGAFSSGMMADWANGDVKLLGWREETGRSPFENAPQFDG-KISE
ILVC_AERHH       KTLMRPLFEKHMDDIIAGEFSRGMMADWAEDDAKLFGWREETGKSAFENAPAFAG-KIAE
ILVC_AERS4       RTLMRPLFEKHMDDIIAGEFSRGMMADWAEDDAKLFGWREETGKSAFENALAFAG-KIAE
ILVC_HAEIE       KESLGFLYYKHMDDIISGHFSATMMADWANGDKDLFAWREATGKTAFENAPKYDG-KISE
ILVC_HAEIN       KESLGFLYYKHMDDIISGHFSATMMADWANGDKDLFAWREATGKTAFENAPKYDG-KISE
ILVC_HAEI8       KESLGFLYYKHMDDIISGHFSATMMADWANGDKDLFAWREATGKTAFENAPKYDG-KISE
ILVC_HAEIG       KKSLGFLYYKHMDDIVSGHFSATMMADWENDDKDLFAWREATGKTAFENAPKYDG-KISE
ILVC_PASMU       KAKLTFLFEKHMDDIISGEFSATMMADWANGDANLLKWREETGKTAFENAPKYEG-KISE
ILVC_MANSM       KEHLNFLYLKHMDDIISGEFSATMMADWANGDKDLFAWREATGKTAFENAPKADGIKISE
ILVC_ACTSZ       KEKLGFLYLKHMDDIISGEFSRVMMEDWANGDKDLLAWREATGKTAFENAPKADGIKISE
ILVC_ACTP2       KVQLNDLYLKHMDDIISGEFSSTMMADWANGDVNLFKWREETGKTAFENSPKADGIKISE
ILVC_HISS2       KEKLDFLFKKHMDDIISGEFSRVMMEDWANGDANLLEWREQTGKTAFENAPKGENIKISE
ILVC_HAES1       KEKLDFLFKKHMDDIISGEFSRVMMEDWANGDANLLKWREQTGKTAFENAPKGENIKISE
ILVC_VIBVY       KDLMRPLYNKHMDDIISGHFSSTMMADWANDDANLLGWRAETGETAFENYPSTDV-EISE
ILVC_VIBVU       KDLMRPLYNKHMDDIISGHFSSTMMADWANDDANLLGWRAETGETAFENYPSTDV-EISE
ILVC_VIBPA       KDLMRPLYNKHMDDIISGHFSSTMMADWANDDKNLLGWRAETGETAFENYPETDV-EISE
ILVC_ALIF1       KELMRPLYNKHMDDIISGEFSRTMMADWANDDVNLFGWREETGQTAFENYPESDV-EISE
ILVC_VIBCH       KDLMRPLYNKHMDDIISGHFSSTMMADWANDDKDLFGWRAETAETAFENYPTTDV-KIAE
ILVC_VIBC3       KDLMRPLYNKHMDDIISGHFSSTMMADWANDDKDLFGWRAETAETAFENYPTTDV-KIAE
ILVC_PHOPR       KDLMRPLYNKHMDNIITGHFSSTMMADWANDDVNLLGWREETGETAFENYPVTDV-EIPE
ILVC_SHEON       KDILQPLFEKHMDDIISGEFSRTMMQDWANDDANLLRWRAETGETGFENAPVSSE-HIDE
ILVC_BUCAI       KKILSPLFQKHMDDIISGEFSNEMMKDWENQDLKLLNWRYKTKNTSFETA-PVYNEKIPE
ILVC_BUCDN       KEFSQNLFQKHMDDIISGDFSSKMIQDWKNKDQNLLNWRYKTKNTSFEQS-PDYDKKILE
ILVC_BUCAP       KKILSPLFKKHMDDIISGSFSKEMMIDWHNNDKKLLNWREDTKKTPFEKNILSYSEKISE
ILVC_BUCMH       KKIFFPLFRKHMDDIISGEFSKNMMFDWKNNDQQLKEWRTEIQNTDFEKC-NIYYKQIPE
ILVC_BUCSC       KVMFSSLFRKHMDDIISGEFSKNMIDDWNSDDKKLKEWRTQIKKTDFEKC-KICHKEISE
ILVC_BUCBP       KKILSPIFKKHMDDILSGYYSKNMMLDWKNDDKQLKIWRRSIQNTSFEQC-SISHITLLE
ILVC_BLOFL       KNILTPVFEKHMEDILDGSFSKNMMLDWINKDCKLLSYRQNNSQLLFEKAPVYCE-TILE
                                                                             

ILVC_LEUMM       ---------------QLIEAGFNTLVEAGYSPELAYFETSHEMKMIVDLIFEGGFEKMRH
ILVC_LEUMC       ---------------QLIEAGFNTLVEAGYSPELAYFETSHEMKMIVDLIFEGGFEKMRH
ILVC_STAES       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAEQ       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAA1       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAA9       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAB       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAN       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAM       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAW       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAR       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAA2       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAA8       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAE       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAC       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAT       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAA3       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAAS       ---------------KLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGTENVRY
ILVC_STAHJ       ---------------KLIQSGFETLVEAGYQKELAYFEVLHEMKLIVDLMYEGGMENVRY
ILVC_STAS1       ---------------KLVQSGFETLVEAGYQPEIAYFEVLHEMKLIVDLMYEGGMENMRY
ILVC_LISMF       ---------------HLIQAGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMEKMRH
ILVC_LISIN       ---------------HLIQAGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMEKMRH
ILVC_LISW6       ---------------HLIQAGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMEKMRH
ILVC_LISMO       ---------------HLIQAGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMEKMRH
ILVC_STRR6       ---------------ALIEAGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRPN       ---------------ALIEAGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRP2       ---------------ALIEAGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRSV       ---------------ALIEAGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRGC       ---------------ALIEAGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRT2       ---------------ALIETGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRT1       ---------------ALIETGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRTD       ---------------ALIETGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRTR       ---------------ALIETGFEVLTEAGYAPELAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_STRS2       ---------------ALMQAGFEVLTEAGYAPELAYFEVLHEMKLIVDLVYEGGFKKMRQ
ILVC_STRSY       ---------------ALMQAGFEVLTEAGYAPELAYFEVLHEMKLIVDLVYEGGFKKMRQ
ILVC_STRMU       ---------------HLIEAGFEVLTEAGYAPQLAYFEVLHEMKLIVDLIYEGGFKKMRQ
ILVC_LACLM       ---------------ALVEAGFETLTEAGYAGELAYFEVLHEMKLIVDLMYEGGFTKMRQ
ILVC_LACLS       ---------------ALVEAGFETLTEARYAGELAYFEVLHEMKLIVDLMYEGGFTKMRQ
ILVC_LACLA       ---------------ALVEAGFETLTEAGYAGELAYFEVLHEMKLIVDLMYEGGFTKMRQ
ILVC_RHIME       ---------------ELIRAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_SINMW       ---------------ELIRAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHIEC       ---------------ELIRAGFETLTEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHIL3       ---------------ELIRAGFETLTEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_AGRFC       ---------------ELIRAGFETLTEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHILO       ---------------ELIRAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_CHESB       ---------------ELIRAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_BRUO2       ---------------ELIRTGFEVLVEAGYAPEMAYFECLNEMKLIVDLIYEGGIANMNY
ILVC_BRUSU       ---------------ELIRTGFEVLVEAGYAPEMAYFECLNEMKLIVDLIYEGGIANMNY
ILVC_BRUC2       ---------------ELIRTGFEVLVEAGYAPEMAYFECLNEMKLIVDLIYEGGIANMNY
ILVC_BRUAB       ---------------ELIRTGFEVLVEAGYAPEMAYFECLNEMKLIVDLIYEGGIANMNY
ILVC_BRUA2       ---------------ELIRTGFEVLVEAGYAPEMAYFECLNEMKLIVDLIYEGGIANMNY
ILVC_BRUME       ---------------ELIRTGFEVLVEAGYAPEMAYFECLNEMKLIVDLIYEGGIANMNY
ILVC_BRUSI       ---------------ELIRTGFEVLVEAGYAPEMAYFECLNEMKLIVDLIYEGGIANMNY
ILVC_OCHA4       ---------------ELIRTGFEVLVEAGYAPEMAYFECLHEMKLIVDLIYEGGIANMNY
ILVC_BART1       ---------------ELIRAGYETLTQAGYAPEMAYFECLHEVKLIVDLMYEGGISNMNY
ILVC_BARHE       ---------------ELIRAGYETLTEAGYAPEMAYFECLHEVKLIVDLMYEGGIANMNY
ILVC_BARQU       ---------------ELIRAGYETLTEAGYAPEMAYFECLHEVKLIVDLLYEGGIANMNY
ILVC_BARBK       ---------------ELIRAGFETLTEAGYAPEMAYFECLHEIKIIADLIYECGIANMNY
ILVC_RHOPB       ---------------ELIKGGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHOP5       ---------------ELIKGGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHOP2       ---------------ELIKAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHOPS       ---------------ELIKAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHOPA       ---------------ELIKAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_BRASO       ---------------ELIKAGYETLTEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_BRASB       ---------------ELIKAGYETLTEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_NITWN       ---------------ELIKNGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_NITHX       ---------------ELIKNGYETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_BRADU       ---------------ELIKGGYETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_AZOC5       ---------------ELIRAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_PARL1       ---------------ELIRAGFETLTEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_MAGSA       ---------------KLIQYGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMRY
ILVC_PHAMO       ---------------KLIQYGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMRY
ILVC_RHORT       ---------------ELIKNGFETLVEAGYAPEMAYFECLHEVKLIVDLMYEGGMANMRY
ILVC_GRABC       ---------------ELIRAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_ACICJ       ---------------ELIKAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_GLUDA       ---------------ELIRAGFETLVEAGYAPEMAYFECLHETKLIVDLIYEGGIANMNY
ILVC_GLUOX       ---------------DLIRAGFETLVEGGYAPEMAYFECLHEMKLIVDLIYEGGIANMNY
ILVC_CAUSK       ---------------DLIRCGFEVLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_CAUVC       ---------------ELVRAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_RHOS1       ---------------ELIRMGFETLVEAGYEPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHOS4       ---------------ELIRMGFETLVEAGYEPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RHOS5       ---------------ELIRMGFETLVEAGYEPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_PARDP       ---------------ELIRMGFETLVEAGYEPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_DINSH       ---------------ELIRMGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_ROSDO       ---------------ELIRMGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_JANSC       ---------------ELIRMGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_RUEPO       ---------------ELIRCGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMDY
ILVC_RUEST       ---------------ELIRCGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMDY
ILVC_ERYLH       ---------------HLIQAGFETLTEAGYAPEMAYFECLHETKLIVDLLYEGGIANMRY
ILVC_NOVAD       ---------------ALIQAGFETLVEAGYAPEMAYFECLHELKLIVDLLYEGGIANMRY
ILVC_SPHAL       ---------------HLIQAGFETLVEAGYAPEMAYFECLHETKLIVDLLYEGGIANMRY
ILVC_SPHWW       ---------------HLIMAGFETLVEAGYAPEMAYFECLHEVKLIVDLMYEGGIANMRY
ILVC_ZYMMO       ---------------ALITAGFETLTEAGYAPEMAFFECMHEMKLIVDLIYEAGIANMRY
ILVC_PELUB       ---------------ELIKNGFETLTEAGYEPEMAYFECLHEVKLIVDLIYEGGIANMNY
ILVC_HYPNA       ---------------ELIKAGYETLVEAGYAPEMAYFECLHETKLIVDLIYEGGIANMNY
ILVC_GEOUR       ---------------ALIQAGFETLVEAGYAPEMAYFECLHETKLIVDLIYEGGIANMRY
ILVC_GEOMG       ---------------ALIQAGFETLVEAGYAPEMAYFECLHETKLIVDLIYEGGIANMRY
ILVC_GEOSL       ---------------ALIQAGFETLVEAGYSPEMAYFECLHETKLIVDLIYEGGIANMRY
ILVC_PELPD       ---------------ALIQAGFETLVEAGYAPEMAYFECLHETKLIVDLIYEGGIANMRY
ILVC_MAGMM       ---------------ALIQAGFETLVEAGYAPEMAYFECLHETKLIVDLIYEGGIANMRY
ILVC_METCA       ---------------ALVQAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMRY
ILVC_NITOC       ---------------ALVQAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMRY
ILVC_VESOH       ---------------ALVQAGFETLVEAGYEPEMAYFECLHELKLIVDLMYEGGIANMRY
ILVC_RUTMC       ---------------ALVQAGFETLVEAGYEPEMAYFECLHELKLIVDLMYEGGIANMRY
ILVC_ALKEH       ---------------SLIQAGFETLVEAGYAPEMAYFECLHETKLIVDLLYQGGIANMRY
ILVC_HALHL       ---------------ALIEAGFETLVEAGYAPEMAYFECLHETKLIVDLLYEGGLANMRY
ILVC_NITEU       ---------------SLIQAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMRY
ILVC_NITEC       ---------------SLIQAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMRY
ILVC_NITMU       ---------------ALIQAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYEGGIANMRY
ILVC_CUPMC       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_CUPNH       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_CUPPJ       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_RALSO       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIGNMNY
ILVC_BURM7       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURPS       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURP1       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURP0       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURM9       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURMS       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURMA       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURP6       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURTA       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURCH       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURVG       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURCA       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURCM       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BURL3       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_PARXL       ---------------DLIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_POLAQ       ---------------DLIKTGFEVLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_JANMA       ---------------ELIKAGFETLTEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_HERAR       ---------------ELIKAGFETLTEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_POLNA       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_POLSJ       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_RHOFT       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDMIYEGGIANMNY
ILVC_METPP       ---------------ELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BORBR       ---------------ELIKAGFDTLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BORPA       ---------------ELIKAGFDTLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BORPE       ---------------ELIKAGFDTLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_BORA1       ---------------ELIKAGFDTLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_CHRVO       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_METFK       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_AZOSB       ---------------ELVKMGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_DECAR       ---------------ELVKMGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_AROAE       ---------------ELVKMGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_ACIAC       ---------------ELIKMGFETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_ACISJ       ---------------ELIKMGYETLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNY
ILVC_NEIMF       ---------------ELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEGGIANMNY
ILVC_NEIMB       ---------------ELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEGGIANMNY
ILVC_NEIM0       ---------------ELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEGGIANMNY
ILVC_NEIMA       ---------------ELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEGGIANMNY
ILVC_NEIG1       ---------------ELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEGGIANMNY
ILVC_PSEAB       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEAE       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEA7       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEU5       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMFEGGIANMNY
ILVC_PSEU2       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSE14       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSESM       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEMY       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEPF       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEF5       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEPK       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEP1       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEPG       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PSEE4       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_ALCBS       ---------------ELVKAGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_MARHV       ---------------ELVKAGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_HAHCH       ---------------ELVKAGFETLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_SACD2       ---------------ELVKMGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_HYDCU       ---------------ELVKAGFDTLVEAGYEPEMAYFECLHELKLIVDLMFEGGIADMNY
ILVC_PSYCK       ---------------ELVKMGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIADMNY
ILVC_PSYA2       ---------------ELVKMGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIADMNY
ILVC_PSYWF       ---------------ELVKMGFETLTEAGYAPEMAYFECLHELKLIVDLMYEGGIADMNY
ILVC_ACIAD       ---------------ELVKMGFETLVEAGYSPEMAYFECLHELKLIVDLMFEGGIADMNY
ILVC_THIDA       ---------------ELVKAGFDTLVEAGYAPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_CHRSD       ---------------ELVKAGFETLTEAGYEPEMAYFECLHELKLIVDLMYEGGIANMNY
ILVC_PRB01       ---------------ALIKAGFETLVEAGYSEEMAYFECLHETKLITDLIQEGGIANMHY
ILVC_ARCB4       ---------------ALVQAGFETLVEAGYEPEMAYFECLHELKLIVDLMYEGGIADMRY
ILVC_SULDN       ---------------SLVQAGFETLTEAGYAPELAYFECLHELKLIVDLMFQGGIADMRY
ILVC_NITSB       ---------------ALIQAGFETLTEAGYPEEMAYFECLHELKLIVDLIYEGGLANMRY
ILVC_HELHP       ---------------SLVKAGFETLVEAGYPEEMAYFECLHELKLIVDLIYEGGLANMRY
ILVC_WOLSU       ---------------ALVKAGFETLVEAGYPEEMAYFECLHELKLIVDLIFQGGLSDMRY
ILVC_CAMC5       ---------------ALVNAGFETLVEAGYEPEMAYFECLHELKLIVDLMYQGGMADMRY
ILVC_CAMC1       ---------------ALVNAGFDTLVEAGYEPEMAYFECLHELKLIVDLMYQGGMADMRY
ILVC_CAMFF       ---------------ALINAGFETLTEAGYEPEMAYFECLHEMKLIVDLIYQGGMADMRY
ILVC_CAMHC       ---------------ALINAGFNTLTEAGYEPEMAYFECLHEMKLIVDLIYQGGMSDMRY
ILVC_CAMJ8       ---------------ALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRY
ILVC_CAMJJ       ---------------ALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRY
ILVC_CAMJR       ---------------ALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRY
ILVC_CAMJE       ---------------ALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRY
ILVC_CAMJD       ---------------ALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRY
ILVC_MYCSK       ---------------ELVKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCSJ       ---------------ELVKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCSS       ---------------ELVKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCVP       ---------------ELVKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCGI       ---------------ELVKTGFDVMVEAGYEPELAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCS2       ---------------ELIKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLIYEGGIARMNY
ILVC_NOCFA       ---------------ELVKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_RHOJR       ---------------ELVKTGFEVMVEAGYAPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCPA       ---------------ELVKAGFDVMVEAGYPPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCA1       ---------------ELVKAGFDVMVEAGYPPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCAV       ---------------ELVKAGFDVMVESGYPPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCUA       ---------------ELVKTGFDVMVEAGYPPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCLE       ---------------ELVKAGFDVMVEAGYPPEMAYFEVLHELKLIVDLMYEGGIARMNY
ILVC_MYCBP       ---------------ELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYY
ILVC_MYCTA       ---------------ELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYY
ILVC_MYCTU       ---------------ELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYY
ILVC_MYCBO       ---------------ELVKAGFEVMVEAGYPAELAYFEVLHELKLIVDLMYEGGLARMYY
ILVC_CORGL       ---------------ELVKVGFEVLTEAGYEPEMAYFEVLHELKLIVDLMFEGGISNMNY
ILVC_CORGB       ---------------ELVKVGFEVLTEAGYEPEMAYFEVLHELKLIVDLMFEGGISNMNY
ILVC_COREF       ---------------ELVKTGFEVLTEAGYEPEMAYFEVLHELKLIVDLMFEGGITNMNY
ILVC_CORJK       ---------------ELIKTGFEVLVEAGYEPEMAYFECLHEMKLIVDLMFEGGIANMNY
ILVC_CORDI       ---------------HLMMKGFEVLAEAGYAPEMAYFEVLHEMKLIVDLIWEGGIENMNY
ILVC1_STRCO      ---------------ALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMYEGGLEKMRW
ILVC2_STRCO      ---------------ALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMYEGGLEKMRW
ILVC_STRAW       ---------------ALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMYEGGLEKMRW
ILVC_SALAI       ---------------ALVQTGFEVLTEAGYAPEVAYFECLHELKLIVDLMYEGGIARMRY
ILVC_SALTO       ---------------ALVQTGFEVLTEAGYAPEVAYFECLHELKLIVDLMYEGGIARMRY
ILVC_SACEN       ---------------ALVQTGFEVLVEAGYQPEIAYFEVLHELKLIVDLMWEGGIAGQRY
ILVC_FRAAA       ---------------ALVQAGFETLVEAGYTPEVAYFECLHELKLIVDLMYEGGISQMRY
ILVC_FRACC       ---------------ALVQAGFETLVEAGYTPEVAYFECLHELKLIVDLMYEGGISQMRY
ILVC_THEFY       ---------------ELIKAGFATLVEAGYQPEVAYFECLHEMKLIVDLMYEGGISKMYW
ILVC_CLAMS       ---------------QLVQYGFETLIEAGYQPQIAYFEVLHELKLIVDLMWEGGIAKQRW
ILVC_CLAM3       ---------------QLVQYGFETLMEAGYQPQIAYFEVLHELKLIVDLMWEGGIAKQRW
ILVC_LEIXX       ---------------QLVQYGFETLTEAGYQPQVAYFEVLHELKLIVDLMWEGGIAKQRW
ILVC_ARTS2       ---------------QLVQYGFETLTEAGYQPQIAYFEVLHELKLIVDLMWEGGIAKQRW
ILVC_RENSM       ---------------QLIQYGFETLTEAGYKPEVAYFEVLHELKLIVDLMVEGGIAKQRW
ILVC_KINRD       ---------------ALVQTGFEVLTEAGYQPEVAYFECLHELKLIVDLMYEGGIAKQRW
ILVC_CUTAK       ---------------HLIQAGFETLVTAGYQPEMAYFEVCHEMKMIVDLIIEGGISKLRW
ILVC_TROW8       ---------------QLIQYGYETLVEAGYQPEVAYFEVLHELKLIIDLIVEGGLSKSRW
ILVC_TROWT       ---------------QLIQYGYETLVEAGYQPEVAYFEVLHELKLIIDLIVEGGLSKSRW
ILVC1_BIFLO      ---------------KLVEMGFEVLTDAGYQPEIAYFEVCHELKMLVDLMNEGGLNKARW
ILVC2_BIFLO      ---------------HLCDLGFDVLTEAGYQPEIAYFEVFHELKMLVDLANEGGLNKARW
ILVC_XYLFA       ---------------SLVQAGFETLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_XYLFT       ---------------SLVQAGFETLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_XANAC       ---------------SLVQAGFEVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_XANC5       ---------------SLVQAGFEVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_XANOM       ---------------SLVQAGFEVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_XANOR       ---------------SLVQAGFEVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_XANCP       ---------------SLVQAGFEVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_XANC8       ---------------SLVQAGFEVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLE
ILVC_CHLPM       ---------------ELIKAGFETLVEAGYPEELAYFECMHELKLIVDLFYEGGLSRMNY
ILVC_CHLPD       ---------------ELIKAGFETLVEAGYPEELAYFECMHELKLIVDLYYEGGLSRMNY
ILVC_CHLCH       ---------------ELIKAGFETLVEAGYPEELAYFECMHELKLIVDLYYEGGLSRMNY
ILVC_PELLD       ---------------ELIKAGFETLVEAGYPEELAYFECMHELKLIVDLYYEGGLSRMNY
ILVC_CHLTE       ---------------ELIKAGFETLTEAGYPAELAYFECMHELKLIVDLYYEGGLSRMNY
ILVC_SALRD       ---------------ALIQAGFETLVDAGYPEELAYFECLHELKLIVDLYYEGGLEYMNH
ILVC_NATPD       ---------------SLVKTGYETLVDAGYSPEMAYFECLNELKLIVDLMYEGGNSEMWD
ILVC_HALMA       ---------------EMVKAGFETLVDAGYAPEMAYFECLNELKLIVDLMYEGGHMGMWN
ILVC_DESVV       ---------------SLIKAGFETLVEAGYQPEIAYFECLHEVKLIVDLIYEGGLERMRY
ILVC_DESVH       ---------------SLIKAGFETLVEAGYQPEIAYFECLHEVKLIVDLIYEGGLERMRY
ILVC_DESAG       ---------------ALIQAGFETLVEAGYQPEIAYFECLHETKLIVDLIYEGGLAKMRH
ILVC_RHOBA       ---------------ELVKAGFDTLVEAGYQPEMAYFECMHELKLIVDLLYEGGLSYMRY
ILVC1_BACC1      ---------------ALVKAGFETLVDAGYQPELAYFECLHELKLIVDLMYEGGLENMRY
ILVC1_BACCZ      ---------------ALVKAGFETLVDAGYQPELAYFECLHELKLIVDLMYEGGLENMRY
ILVC1_BACHK      ---------------ALVKAGFETLVDAGYQPELAYFECLHELKLIVDLMYEGGLENMRY
ILVC1_BACAN      ---------------ALVKAGFETLVDAGYQPELAYFECLHELKLIVDLMYEGGLENMRY
ILVC1_BACCR      ---------------ALVKAGFETLVDAGYQPELAYFECLHELKLIVDLMYEGGLENMRY
ILVC_BACCN       ---------------ALVKAGFETLVDAGYQPELAYFECLHELKLIVDLMYEGGLENMRY
ILVC_OCEIH       ---------------SLIKAGFETLTDAGYQPEVAYFECLHEMKLIVDLLYEGGLENMRY
ILVC_BACVZ       ---------------ALVKAGFETLTEAGYQPELAYFECLHELKLIVDLMYEEGLAGMRY
ILVC_BACSU       ---------------ALVKAGFETLTEAGYQPELAYFECLHELKLIVDLMYEEGLAGMRY
ILVC_BACLD       ---------------SLVKAGFETLTEAGYQPELAYFECLHELKLIVDLMYEEGLAGMRY
ILVC_BACP2       ---------------SLVKAGFETLTEAGYQPELAYFECLHELKLIVDLMYEEGLEGMRY
ILVC_GEOKA       ---------------ALIKAGFETLVEAGYQPEVAYFECLHEMKLIVDLLYEGGLSWMRY
ILVC_GEOTN       ---------------ALIKAGFETLVEAGYQPEVAYFECLHEMKLIVDLLYEGGLSWMRY
ILVC_BACSK       ---------------ALVKAGFETLVEAGYQPEIAYFECLHELKLIVDLMYEGGLEYMRY
ILVC_BACHD       ---------------ALVKAGFETLVEAGYQPEVAYFECLHELKLIVDLMYEGGLEYMRY
ILVC2_BACAN      ---------------ALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEGGLTNMRH
ILVC2_BACHK      ---------------ALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEGGLTNMRH
ILVC2_BACCR      ---------------ALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEGGLTTMRH
ILVC2_BACCZ      ---------------ALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEGGLTNMRH
ILVC2_BACC1      ---------------ALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEGGLTNMRH
ILVC_CALS4       ---------------ELMKAGFETLVEAGYQPEIAYFECVNEMKLIVDLIYEGGFSYMRY
ILVC_CALS8       ---------------ELIKAGFDTLVEAGYQPEIAYFECLHEMKLIVDLIWQGGLSLMRY
ILVC_CLOB8       ---------------ELIKAGFETLVEAGYAPENAYFECMHEMKLIVDLLYQGGLSMMRY
ILVC_ALKMQ       ---------------ELMKVGFEVLVEAGYEPESAYFECVHEMKLIIDMVVEGGLGNMRQ
ILVC_CLONN       ---------------ALMKAGFETLVEAGYAPENAYFECVHEMKLIVDLIYEGGFNSMRH
ILVC_CLOAB       ---------------ALINAGYDTLREAGYSAENAYFECFHEMKMIVDLMYEGGMAKMRY
ILVC_LACP7       ---------------ALMKCGFEVLVEAGYEPESAYFECIHEMKLIVDLINESGFAGMRY
ILVC_HUNT2       ---------------ELMKAGFETLVEAGYQPEIAYFECIHEMKLIVDLINQGGFSYMRY
ILVC_THEMA       ---------------ALIKAGFETLVDAGYQPEIAYFECLNELKLIVDLIYEGGLSFMRY
ILVC_THEP1       ---------------ALIKAGFETLVEAGYQPEIAYFECLNELKLIVDLIYEGGLSFMRY
ILVC_AQUAE       ---------------ALIKAGFETLVNAGYQPEVAYFECLHELKLIVDLIYEHGISGMRY
ILVC_PETMO       ---------------SLIKAGFETLVEAGYQPEIAYFECLNELKLIVDLLYEGGLKKMRY
ILVC_DESHY       ---------------ELIRAGFDTLVEAGYQPESAYFECLHELKLIVDLIYEGGISRMRY
ILVC_DESRM       ---------------ELIKAGFDTLVEAGYAPEMAYFECLHELKLIVDLIYEGGLSRMRY
ILVC_CARHZ       ---------------HLIKAGFETLVEAGYAPEMAYFECLHEMKLIVDLIYEGGFSLMRY
ILVC_SYNWW       ---------------ELVKAGFETLVEAGYQPEIAYFECMHELKLIVDLMYEGGMSYMRY
ILVC_MOOTA       ---------------ALVKAGFETLVEAGYQPEIAYFECLHELKLIVDLMYEGGIKYMRY
ILVC_DEHMC       ---------------SLVKAGFETLVEAGYQPEVAYFECLHELKLIVDLMYQGGIAYMRD
ILVC_DEHMB       ---------------SLVKAGFETLVEAGYQPEVAYFECLHELKLIVDLMYQGGIAYMRD
ILVC_DEHM1       ---------------SLVKAGFETLVEAGYQPEVAYFECLHELKLIVDLMYQGGIAYMRD
ILVC_METST       ---------------GLIQAGFETLVEAGYKPEMAYFETCHEMKLIVDLIYEKGFGNMWH
ILVC_METS3       ---------------ALINAGFQTLVEAGYQPEIAYFETCHEVKLIVDDIYEHGFGGMWK
ILVC_METTH       ---------------ELINTAFKTLVRAGYQPEIAYFETCHELKLIVDLIYERGFRGMWH
ILVC_METM5       ---------------ELIKAGFETLVEAGYAPEMAYFETCHELKLIVDLIYQKGFKNMWN
ILVC_METM7       ---------------ELIKAGFETLVEAGYAPEMAYFETCHELKLIVDLIYQKGFKNMWN
ILVC_METMP       ---------------ELIKAGFETLVEAGYAPEMAYFETCHELKLIVDLIYQKGFKNMWN
ILVC_METVS       ---------------ELIKAGFETLVEAGYSPEMAYFETCHELKLIVDLIYQKGFKNMWH
ILVC_METJA       ---------------ELIKAAFETLVEAGYAPEMAYFETCHELKLIVDLIYQKGLQGMWE
ILVC_PYRIL       ---------------ELIKKGFEVLVEMGYQPEVAYFEVLNEAKLIMDLIWQRGIYGMLN
ILVC_PYRAE       ---------------ELIKKGFEVLVEMGYQPEVAYFEVLNEAKLIMDLIWQRGIYGMLN
ILVC_PYRCJ       ---------------ELIKKGFEVLVEMGYQPEVAYFEVLNEAKLIMDLIWQRGIYGMLN
ILVC_PYRAR       ---------------ELIKKGFETLVELGYQPEVAYFEVLNEAKLIMDLIWQRGIYGMLN
ILVC_PYRAB       ---------------ELIKKGFEVLVELGYPPELAYFEACNEAKLIMDLIYERGFTGMLK
ILVC_PYRFU       ---------------ELIKKGFEVLVELGYPPELAYFEACNEAKLIMDLIYERGFTGMLK
ILVC_SULTO       ---------------QLMRTAFQVLVEAGYQPEIAYYETINEMKMIVDLIYEKGFTGMLK
ILVC_SULAC       ---------------QLMRYAFQTLVEAGYQPEVAYFETINEMKLIVDLVYEKGFSGMLT
ILVC_SACS2       ---------------ELMRAAFETLVEEGYQPEVAYFETINELKMLVDLVYEKGISGMLK
ILVC_METKA       ---------------YMILYAFETLVEAGYQPEVAYFETLHELKLIVDLIYEKGLSGMLD
ILVC_METAC       ---------------ALIKTAFEVLVEAGYQPEMAYFETCHEVKLIVDLIYEGGLERMWH
ILVC_METMA       ---------------ALIKTAFEVLVEAGYQPEMAYFETCHEVKLIVDLIYEGGLERMWH
ILVC_METBF       ---------------SLIKTAFETLVEAGYQPEMAYFETCHEVKLIVDLIYEGGLERMWH
ILVC_METBU       ---------------SLIKTSFEVLVEAGYQPEMAYFETLHELKLIVDLIHEGGLEKMWY
ILVC_METAR       ---------------EMVKASFETLVNAGYQPEIAYFETLHELKLIVDLMYEGGMAAMWD
ILVC_METTP       ---------------AMIKAAFETMVQAGYQPEIAYFEACHELKLITDLIHEGGLMKMWN
ILVC_ARCFU       ---------------EMIKMSFETLVEAGYQPEIAYFEVLHELKLIVDLIYEGGIYNMWS
ILVC_METB6       ---------------SLIKAGFETLVDAGYAPEMAYLEVCHELKLIVDLIYEGGLTNMRQ
ILVC_METLZ       ---------------SLIKAGFDTLVDAGYAPEMAYLEVLHEMKLIVDLIYEGGFTKMRE
ILVC_METHJ       ---------------SLIKAGFETLVEAGYAPEMAYLEVLHETKLIVDLIYEGGFTKMRN
ILVC_METMJ       ---------------SLIKAGFETLVDAGYAPEMAYLEVLHETKLIVDLIYEGGFTKMRD
ILVC_KORVE       ---------------ALVKAGFETLVEAGYQPELAYFECLHELKLIVDLMYRGGLNYMRY
ILVC_SORC5       ---------------ELVKAGFETLVNAGYQPEIAYFECLHELKLIVDLMYRGGLNYMRY
ILVC_CHLAA       ---------------ALVKAAFETLVEAGYQPEVAYFECMHELKLIVDLFYQGGLNYMRY
ILVC_ROSCS       ---------------ALVKAAFETLVEAGYQPEVAYFECMHELKLIVDLFYQGGLNYMRY
ILVC_SOLUE       ---------------ELVRAGFQTLVDAGYAPEIAYFECLHELKLIVDLIQEGGLSYMRY
ILVC_SYNJA       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLIVEGGLEKMRH
ILVC_SYNJB       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLIVEGGLEKMRH
ILVC_NOSS1       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLVVEGGLAKMRD
ILVC_TRIV2       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLVVEGGLAKMRD
ILVC_MICAN       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLIVEGGLAKMRD
ILVC_TRIEI       ---------------ALIKAGFETLVKAGYQPELAYFECLHEVKLIVDLVVEGGLANMRD
ILVC_SYNY3       ---------------ALIKAGFDTLVEAGYQPELAYFECLHEVKLIVDLIVEGGLAKMRD
ILVC_ACAM1       ---------------ALIKAGFETLVEAGYQPELAYFECMHEVKLIVDLIVEGGLAKMRD
ILVC_THEEB       ---------------ALIKAGFETLVQAGYQPELAYFECLHEVKLIVDLIVEGGLAKMRD
ILVC_SYNE7       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLIVEGGLAAMRD
ILVC_SYNP6       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLIVEGGLAAMRD
ILVC_GLOVI       ---------------ALIKAGFETLVEAGYQPELAYFECLHEVKLIVDLIVEGGLAKMRD
ILVC_SYNPW       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSAMRD
ILVC_SYNR3       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSAMRD
ILVC_PROM3       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLTAMRD
ILVC_PROMM       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLTAMRD
ILVC_SYNSC       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLTSMRD
ILVC_SYNPX       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLTSMRD
ILVC_SYNS9       ---------------ELVKAGFETLVEAGYQPELAYFECMHEVKLIVDLMVKGGLTSMRD
ILVC_SYNS3       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSSMRD
ILVC_PROM1       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLTAMRD
ILVC_PROMT       ---------------ELVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLTAMRD
ILVC_PROMA       ---------------ALVKAGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLTAMRD
ILVC_PROMS       ---------------ELVKSGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSQMRD
ILVC_PROM2       ---------------ELVKSGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSQMRD
ILVC_PROM0       ---------------ELVKSGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSQMRD
ILVC_PROM9       ---------------ELVKSGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSQMRD
ILVC_PROM5       ---------------ELVKSGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSQMRD
ILVC_PROMP       ---------------ELVKSGFETLVEAGYQPELAYFECLHEVKLIVDLMVKGGLSQMRD
ILVC_ANADE       ---------------ALVKNGFEVLVEAGYQPESAYFECLHELKLIVDLMYEGGLAWMRH
ILVC_THET2       ---------------RLIRAGFETLVEAGYPPEMAYFETVHEVKLIVDLIYEAGLKGMRY
ILVC_THET8       ---------------RLIRAGFETLVEAGYPPEMAYFETVHEVKLIVDLIYEAGLKGMRY
ILVC_RUBXD       ---------------ALLKAGFETLVEAGYQPELAYYECVNELKLIVDLIYEGGLARMRY
ILVC_DEIGD       ---------------HLIQAGFETLVEAGYQPEIAYFETLHEVKLIVDLIYEKGFEGMRH
ILVC_DEIRA       ---------------HLIQAGFETLVEAGYQPEIAYFETLHEVKLIVDLIYEKGFEGMRH
ILVC_LEPBL       ---------------NLIMAGFETLTEAGYDPEIAYFECLHEVKLITDLIYEGGLARMRF
ILVC_LEPBJ       ---------------NLIMAGFETLTEAGYDPEIAYFECLHEVKLITDLIYEGGLARMRF
ILVC_LEPIC       ---------------NLIMAGFETLTEAGYDPEIAYFECLHEVKLITDLIYEGGLARMRF
ILVC_LEPIN       ---------------NLIMAGFETLTEAGYDPEIAYFECLHEVKLITDLIYEGGLARMRF
ILVC_CLOD6       ---------------ELIKLGYKTLVDAGYQKEVAYFECLHEMKLIVDLIYEGGFERMRY
ILVC_TREPR       ---------------ELIRAGFDTLVSSGYEPELAYFECMHEMKLIVDVMNRGGVAALNE
ILVC_HELPH       ---------------AIVRMGFETLIKAGYPEELAYFECVHEVKLVADLLHYKGVEGLRK
ILVC_HELPJ       ---------------AIVRMGFETLIKAGYPEELAYFECVHEVKLVADLLHYKGVEGLRK
ILVC_HELPY       ---------------AIVRMGFETLIKAGYPEELAYFECVHEVKLVADLLHYKGVEGLRK
ILVC_HELAH       ---------------AVVRMGFETLIKAGYPEELAYFECVHEVKLVADLLHYKGVEGLRK
ILVC_ECOK1       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ECOUT       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ECO24       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ECOL5       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ECOL6       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SHIDS       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SHIBS       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SHISS       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SHIFL       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIVRKRLYEMNV
ILVC_ECOLC       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ECOLI       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ECOHS       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ECO57       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SALCH       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SALPB       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SALTI       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SALPA       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SALTY       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SALAR       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_KLEP7       QEYFDKGVLMIAMVKAGVELAFETMVASGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_CITK8       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ENT38       QEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_CROS8       QEYFDKGVLMIAMVKAGVELAFETMVAAGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_YERP3       QEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_YERPS       QEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_YERPA       QEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_YERPP       QEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_YERPN       QEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_YERPE       QEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_YERE8       QEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_SERP5       QEYFDHGVLMVAMVKAGVELAFETMVDAGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_PECAS       QEYFDNGVLMVAMVKAGVELAFETMVSSGIIEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_PHOLL       QEYFDHGVLMVAMVKAGVELAFEIMVDTGIIAESAYYESLHELPLIANTISRKRLYEMNV
ILVC_SODGM       QTYFDHGVLMIAMAKAGVELAFETMTRSGIIAESAYYESLHELPLIANTVARKRLYEMNV
ILVC_AERHH       QEYFDNGVVMVAMVKAGVELAFETMVASGIYEESAYYESLHELPLIANTVARKRLYEMNV
ILVC_AERS4       QEYFDNGVVMVAMVKAGVELAFETMVASGIYEESAYYESLHELPLIANTVARKRLYEMNV
ILVC_HAEIE       QEYFDNGVLMIAMVKAGVELAFDAMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_HAEIN       QEYFDNGVLMIAMVKAGVELAFDAMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_HAEI8       QEYFDNGVLMIAMVKAGVELAFDAMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_HAEIG       QEYFDNGVLMIAMVKAGVELAFDAMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_PASMU       QEYFDHGVLMVAMVKAGVELAFDTMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_MANSM       QEYFDNGVVMVAMVKAGVEMAFDAMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ACTSZ       QEYFDNGVLMVAMVKAGVEMAFDAMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ACTP2       QEYFDNGVVMVAMVKAGVEMAFDAMVASGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_HISS2       QEYFDHGVLMVAMVKAGVELAFDTMVETGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_HAES1       QEYFDHGVLMVAMVKAGVELAFDTMVETGIYEESAYYESLHELPLIANTIARKRLYEMNV
ILVC_VIBVY       QEYFDNGILMVAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIANTIARKRLYEMNV
ILVC_VIBVU       QEYFDNGILMVAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIANTIARKRLYEMNV
ILVC_VIBPA       QEYFDNGILMVAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIANTIARKRLYEMNV
ILVC_ALIF1       QEYFDNGILLVAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIANTVARKRLYEMNV
ILVC_VIBCH       QEYFDNGILMIAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIANTVARKRLYEMNV
ILVC_VIBC3       QEYFDNGILMIAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIANTVARKRLYEMNV
ILVC_PHOPR       QEYFDNGILMVAMVRAGVELAFEAMTASGIVEESAYYESLHELPLIANTVARKRLYEMNV
ILVC_SHEON       QTYFDKGIFLVAMIKAGVELAFDTMVSAGIVEESAYYESLHETPLIANTIARKRLYEMNV
ILVC_BUCAI       QEYYDHGILMIAILKSGIELSFEKMIETGIKEESAYYESLHELPLIANTIARKKLYEMNK
ILVC_BUCDN       QEYYDHGILMVAILKAGIELSFETMIQSGIMEESAYYESLHELPLIANTIARKKLYEMNM
ILVC_BUCAP       QEYYDHGTLMVSILKSGIELAFETMINTGIINESAYYESLHELPLIANTIARKKLYEMNI
ILVC_BUCMH       QEYFDNGLLMVAILKAGIELSFEIMIETGIKEESAYYESLHELPLIANTIARKRLYEMNL
ILVC_BUCSC       QEYFDQGLLMVAILKAGIELSFEIMVETGIKEESAYYESLHELPLIANTIARKRLYEMNL
ILVC_BUCBP       HEYFENGLLMVAIIRAGVELAFEIMIEAGIKEESAYYESLHELPLIANTIARKRLYEMNL
ILVC_BLOFL       QTYFDHGVLMVAIIKASVELAFDIMVKSGIKPESAYYESLHELPLIANTIARKRLYEMNM
                   *:  * ::: :       .:  :    :  : *::*  :*  :: :            

ILVC_LEUMM       DCSNTCEYGEMLNGPRIIT-EESKQGMRDVLKDIQD---GTYAKKWLAEYNSG-----LK
ILVC_LEUMC       DCSNTCEYGEMLNGPRIIT-EESKQGMRDVLKDIQD---GTYAKKWLAEYNSG-----LK
ILVC_STAES       SISNTAEFGDYVSGPRVIT-PNVKENMKKVLEDIQN---GNFSRRFVEDNKNG-----FK
ILVC_STAEQ       SISNTAEFGDYVSGPRVIT-PNVKENMKKVLEDIQN---GNFSRRFVEDNKNG-----FK
ILVC_STAA1       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAA9       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAB       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAN       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAM       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAW       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAR       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAA2       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAA8       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAE       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAC       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAT       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAA3       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAAS       SISNTAEFGDYVSGPRVIT-PDVKENMKAVLTDIQN---GNFSNRFIEDNKNG-----FK
ILVC_STAHJ       SISNTAEYGDYVSGPRVIT-PDVKDNMKAVLKDIQN---GNFANSFVKDNENG-----FK
ILVC_STAS1       SISNTAEFGDYVSGPRIIT-PDVKDNMKAVLDDIQK---GNFSDRFIKDNQNN-----FE
ILVC_LISMF       SISNTAEYGDYVSGPRVVT-ADTKKAMKEVLTDIQN---GNFAKSFIDDNKNG-----FK
ILVC_LISIN       SISNTAEYGDYVSGPRVVT-ADTKKAMKEVLTDIQN---GNFAKSFIDDNKNG-----FK
ILVC_LISW6       SISNTAEYGDYVSGPRVVT-ADTKKAMKEVLTDIQN---GNFAKSFIDDNKNG-----FK
ILVC_LISMO       SISNTAEYGDYVSGPRVVT-ADTKKAMKEVLTDIQN---GNFAKSFINDNKNG-----FK
ILVC_STRR6       SISNTAEYGDYVSGPRVIT-EQVKENMKAVLADIQN---GKFANDFVNDYKAG-----RP
ILVC_STRPN       SISNTAEYGDYVSGPRVIT-EQVKENMKAVLADIQN---GKFANDFVNDYKAG-----RP
ILVC_STRP2       SISNTAEYGDYVSGPRVIT-EQVKENMKAVLADIQN---GKFANDFVNDYKAG-----RP
ILVC_STRSV       SISNTAEYGDYVSGPRVIT-EQVKENMKAVLADIQN---GKFANDFVDDYKAG-----RP
ILVC_STRGC       SISNTAEYGDYVSGPRVIT-EQVKENMKAVLADIQN---GKFANDFVNDYKAG-----RP
ILVC_STRT2       SISNTAEFGDYVSGPRVIT-EQVKENMKAVLTDIQN---GKFANDFVNDYKAG-----RP
ILVC_STRT1       SISNTAEFGDYVSGPRVIT-EQVKENMKAVLTDIQN---GKFANDFVNDYKAG-----RP
ILVC_STRTD       SISNTAEFGDYVSGPRVIT-EQVKENMKAVLADIQN---GKFANDFVNDYKAG-----RP
ILVC_STRTR       SISNTAEFGDYVSGPRVIT-EQVKENMKAVLADIQN---GKFANDFVNDYKAG-----RP
ILVC_STRS2       SISNTAEFGDYVSGPRVIT-DQVKENMKAVLADIQS---GKFANDFVNDYKAG-----RP
ILVC_STRSY       SISNTAEFGDYVSGPRVIT-DQVKENMKAVLADIQS---GKFANDFVNDYKAG-----RP
ILVC_STRMU       SCSNTAEFGDFVTGPRVIG-PEVKENMKAALADIQS---GKFAREFVEDHDAG-----FP
ILVC_LACLM       SISNTAEFGDYVTGPRIIT-DEVKKNMKLVLADIQS---GKFAQDFVDDFKAG-----RP
ILVC_LACLS       SISNTAEFGDYVTGPRIIT-DEVKKNMKLVLADIQS---GKFAQDFVDDFKAG-----RP
ILVC_LACLA       SISNTAEFGDYVTGPRIIT-DAVKKNMKLVLADIQS---GKFAQDFVDDFKAG-----RP
ILVC_RHIME       SISNTAEWGEYVTGPRIIT-EDTKAEMKRVLKDIQT---GKFTSEWMQEYR-----SGAA
ILVC_SINMW       SISNTAEWGEYVTGPRIIT-EETKAEMKRVLKDIQT---GKFTSEWMQEYR-----SGAA
ILVC_RHIEC       SISNTAEWGEYVTGPRIIT-EETKAEMKRVLKDIQT---GKFTSEWMQEYR-----SGAA
ILVC_RHIL3       SISNTAEWGEYVSGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEYR-----AGGS
ILVC_AGRFC       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLHDIQT---GKFTSDWMQEYR-----SGAA
ILVC_RHILO       SISNTAEWGEYVSGPRIIT-AETKAEMKRVLKDIQT---GKFTSEWMQEYR-----AGLS
ILVC_CHESB       SISNTAEWGEYVSGPRIIT-PETKAEMKRVLKDIQT---GKFTAEWMQEWH-----SGAA
ILVC_BRUO2       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEWK-----AGAA
ILVC_BRUSU       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEWK-----AGAA
ILVC_BRUC2       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEWK-----AGAA
ILVC_BRUAB       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEWK-----AGAA
ILVC_BRUA2       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEWK-----AGAA
ILVC_BRUME       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEWK-----AGAA
ILVC_BRUSI       SISNTAEWGEYVTGPRIIT-AETKAEMKRVLKDIQT---GKFTSDWMQEWK-----AGAA
ILVC_OCHA4       SISNTAEWGEYVTGPRIIT-AETKEEMKRVLKDIQT---GKFTSDWMQEYR-----AGAA
ILVC_BART1       SISNTAEWGEYMSGPRVIT-DETRAEMKRILKDIQT---GKFTSNWIQEYK-----AGAA
ILVC_BARHE       SISNTAEWGEYMSGPRVIT-DETRAEMKRILKDIQT---GKFTSNWIQEYK-----AGAA
ILVC_BARQU       SISNTAEWGEYISGPRVIT-DKTKAEMRRILKDIQT---GKFTSNWIQECK-----AGAI
ILVC_BARBK       SISNTAEWGEYVSGPRVIT-HETKAEMKRILKDIQT---GKFTSEWIQEYR-----AGAA
ILVC_RHOPB       SISNTAEYGEYVTGPRIVT-PETKKEMKKVLEDIQN---GIFTRNWMLENK-----VNQT
ILVC_RHOP5       SISNTAEYGEYVTGPRIVT-SETKKEMKKVLEDIQN---GIFTRNWMLENK-----VNQT
ILVC_RHOP2       SISNTAEYGEYVTGPRIVT-AETKAEMKRVLADIQN---GIFTRNWMLENK-----VNQT
ILVC_RHOPS       SISNTAEYGEYVTGPRIVT-AETKAEMKRVLADIQN---GIFTRNWMLENK-----VNQT
ILVC_RHOPA       SISNTAEYGEYVTGPRIVT-PETKAEMKRVLADIQN---GIFTRNWMLENK-----VNQT
ILVC_BRASO       SISNTAEYGEYVTGPRIIT-PETKAEMKRVLDDIQS---GRFARDWMLENK-----VNQS
ILVC_BRASB       SISNTAEYGEYVTGPRIIT-PETKAEMKRVLDDIQS---GRFARDWMLENK-----VNQS
ILVC_NITWN       SISNTAEYGEYVTGPRIVT-AETKKEMKRVLDDIQS---GKFARDWMLENK-----VNQT
ILVC_NITHX       SISNTAEYGEYVTGPRIVT-EETKKEMKRVLNDIQS---GKFARDWMLENK-----VNQT
ILVC_BRADU       SISNTAEYGEYVTGPRIVT-AETKAEMKRVLADIQG---GKFARDWMLENK-----VNQT
ILVC_AZOC5       SISNTAEYGEYVTGPRIIT-PETKAEMKRVLTDIQT---GKFTRDWMLENK-----VNQA
ILVC_PARL1       SISNTAEYGEYVTGPRIIT-PETKAEMKRVLHDIQS---GKFTRDWMLENK-----VNQT
ILVC_MAGSA       SISNTAEYGDYVTGPRIIT-DETKAEMKRVLEDIQA---GRFVRDWMLECK-----AGQP
ILVC_PHAMO       SISNTAEYGDYVTGSRIIT-EATKAEMKRVLADIQS---GRFVRDWMLECK-----AGQP
ILVC_RHORT       SISNTAEYGDYVTGPRIVT-PETKAEMKRVLDDIQS---GRFVRDWMIECK-----AGQP
ILVC_GRABC       SISNTAEYGEYVTGPRIVT-PETKAEMKRVLEDIQS---GRFVRDFMLEMK-----VNGA
ILVC_ACICJ       SISNTAEYGEYVTGPRMIT-PETKAEMKRVLDDIQK---GRFTRDWMLENK-----VNQT
ILVC_GLUDA       SISNTAEYGEYATGPRIVT-PETKAEMKRVLTDIQD---GTFVRNFILENQ-----SGNV
ILVC_GLUOX       SISNTAEYGEYVTGPRIIT-PETKAEMKRVLTDIQD---GTFVRNFILENQ-----SGGV
ILVC_CAUSK       SISNTAEYGEYVTGPRIVT-AETKAEMKRVLEDIQS---GKFVRDFMLENA-----VGQP
ILVC_CAUVC       SISNTAEYGEYVTGPRIIT-PETKAEMKRVLEDIQS---GKFVRDFMLENA-----VGQP
ILVC_RHOS1       SISNTAEYGEYVSGPRILPYEETKARMKAVLTDIQT---GKFVRDFMQENA-----VGQP
ILVC_RHOS4       SISNTAEYGEYVSGPRILPYEETKARMKAVLTDIQT---GKFVRDFMQENA-----VGQP
ILVC_RHOS5       SISNTAEYGEYVSGPRILPYEETKARMKAVLTDIQT---GKFVRDFMQENA-----VGQP
ILVC_PARDP       SISNTAEYGEYVSGPRVLPYEETKARMKAVLTDIQT---GKFVRDFMQENA-----VGQP
ILVC_DINSH       SISNTAEYGEYVSGPRVLPYDETKARMKAILTDIQT---GKFVRDFMQENT-----VGQP
ILVC_ROSDO       SISNTAEYGEYVSGPRVLPYDETKARMKAILTDIQN---GKFVRDFMQENA-----VGQP
ILVC_JANSC       SISNTAEYGEYVSGPRILPYDETKARMKAVLRDIQT---GAFVRDFMQENQ-----AGQP
ILVC_RUEPO       SISNTAEYGQYVTGPRILPYEQTKASMKAVLTDIQQ---GKFVRDFMLENA-----VGQP
ILVC_RUEST       SISNTAEYGQYVTGPRILKYDETKARMKEVLADIQQ---GKFVRDFMLENA-----VGQP
ILVC_ERYLH       SISNTAEYGDITTGPRIIT-DETKAEMKRVLGDIQS---GRFVKNFVLDNR-----AGQP
ILVC_NOVAD       SISNTAEYGDIKTGPRIIT-EETKKEMKRVLADIQE---GRFVKDFVLDNR-----AGQP
ILVC_SPHAL       SISNTAEYGDIKTGPRIIT-EETKKEMKRVLADIQS---GRFVKDFVLDNQ-----AGQP
ILVC_SPHWW       SISNTAEYGDIHTGPRVIT-SETKAEMKRVLDDIQK---GKFVKRFVLDNR-----AGQP
ILVC_ZYMMO       SISNTAEYGDIVSGPRVIN-EESKKAMKAILDDIQS---GRFVSKFVLDNR-----AGQP
ILVC_PELUB       SISNTAEYGEYVSGKKVVD-SESKKRMKEVLADIQS---GKFTKDWMKECE-----GGQK
ILVC_HYPNA       SISNTAEYGEYVTGPRLVN-AETKKEMKKVLEDIQN---GTFARNWVLENQ-----AGAP
ILVC_GEOUR       SVSNTAEYGDLTRGPRVIT-GETKKEMKKILTEIQE---GEFAREWMLENK-----VNNP
ILVC_GEOMG       SISNTAEYGDLTRGPRVVT-DETKKEMKRILDEIQT---GQFAKEWMLENK-----ANKP
ILVC_GEOSL       SISNTAEYGDLTRGPRVIT-DETKKEMKQILWEIQS---GQFAKEWMLENK-----ANKP
ILVC_PELPD       SVSNTAEYGDLTRGPRVVN-EETKWEMKKILDEIQT---GEFCKEWMLENK-----ANKP
ILVC_MAGMM       SISNTAEYGDLTRGPRVIT-EETKKEMKKILDEIQT---GEFPREWISENI-----SGRP
ILVC_METCA       SISNTAEYGDLTRGPRIVT-EQTKQEMKKILREIQT---GEFAREFILENQ-----AGAA
ILVC_NITOC       SISNTAEYGDFTRGPRIID-DKTKTEMRRILSEIQS---GEFAREFILENQ-----AGAP
ILVC_VESOH       SISNTAEYGDITRGSRIVT-ADTKDEMKKILIEIQN---GVFAKEFV---------ANVG
ILVC_RUTMC       SISNTAEYGDVTRGPRIVT-ADTKTEMKKILSEIQD---GTFAKEFV---------ANVD
ILVC_ALKEH       SISNTAEYGDFTRGPRVIN-EESREAMREILAEIQE---GEFAREFVLENQ-----AGCP
ILVC_HALHL       SVSNTAEYGDFTRGPRVIN-EESREAMREILEEIQN---GDFAKEYVLENK-----AGAP
ILVC_NITEU       SVSNNAEYGDVSRGPRIIT-DATRNEMRKILREIQT---GEYAREFILENR-----AGAP
ILVC_NITEC       SVSNNAEYGDVSRGPRIIT-EATRNEMRKILREIQT---GEYAREFILEHR-----AGAP
ILVC_NITMU       SISNNAEYGDISRGPRVIT-DATRAEMRKILRQIQT---GEYAREFILENR-----AGAP
ILVC_CUPMC       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLKDIQT---GEYAKSFLLENK-----AGAP
ILVC_CUPNH       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFLLENK-----AGAP
ILVC_CUPPJ       SISNNAEYGEYVTGPRIVT-EETKKAMKQCLKDIQT---GEYAKSFLLENK-----AGAP
ILVC_RALSO       SISNNAEYGEYVTGPRVVT-AETKQAMKQCLHDIQT---GEYAKSFLLENK-----AGAP
ILVC_BURM7       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURPS       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURP1       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURP0       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURM9       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURMS       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURMA       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURP6       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURTA       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURCH       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURVG       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURCA       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURCM       SISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_BURL3       SISNNAEYGEYVTGPRIVT-EETKKAMKQCLTDIQT---GEYAKSFILENK-----AGAP
ILVC_PARXL       SISNNAEYGEYVTGPRIVT-AETKKAMKAVLTDIQT---GEYAKSFILENK-----AGAP
ILVC_POLAQ       SISNNAEYGEYVTGPRVVT-EDTKNAMRQCLKDIQT---GEYAKSFILENK-----AGAP
ILVC_JANMA       SISNNAEYGEYVTGPKVVT-EDTKNAMRQCLKDIQT---GEYAKSFILENK-----AGAP
ILVC_HERAR       SISNNAEYGEYVTGPRIVT-EDTKNAMRQCLKDIQT---GEYAKSFILENK-----AGAP
ILVC_POLNA       SISNNAEYGEYVTGPRIVT-EDTKNAMRAVLKDIQT---GEYAKSFLLENI-----AGAP
ILVC_POLSJ       SISNNAEYGEYVTGPNIVT-SATKEAMRKCLKDIQT---GEYAKSFLLENR-----VGAP
ILVC_RHOFT       SISNNAEYGEYVTGPKIIT-SASKDAMRQCLKDIQT---GEYAKSFILENK-----AGAP
ILVC_METPP       SISNNAEYGEYVTGPRVVT-EDTKAAMRQCLKDIQT---GEYAKSFILENR-----AGAP
ILVC_BORBR       SISNNAEFGEYETGPKVVT-DATRQAMRECLTAIQT---GEYAKKFILENA-----AGAP
ILVC_BORPA       SISNNAEFGEYETGPKVVT-DATRQAMRECLTAIQT---GEYAKKFILENA-----AGAP
ILVC_BORPE       SISNNAEFGEYETGPKVVT-DATRQAMRECLTAIQT---GEYAKKFILENA-----AGAP
ILVC_BORA1       SISNNAEFGEYETGPKVVT-DETRKAMRQCLTDIQT---GEYAKRFILENA-----AGAP
ILVC_CHRVO       SISNNAEYGEYVTGPEVVT-AATKEAMKKALYRIQS---GEYAKMFILEGK-----TNYP
ILVC_METFK       SISNNAEYGEYVTGPRVIA-DQARAAMKECLKNIQN---GDYAKQFILEGR-----TGYP
ILVC_AZOSB       SISNNAEYGEYVTGPEVIN-AQSREAMRNALKRIQT---GEYAKMFIQEGK-----TNYP
ILVC_DECAR       SISNNAEYGEYVTGTEVIN-EQSRVAMRNALKRIQT---GEYAKMFIQEGK-----TNYP
ILVC_AROAE       SISNNAEYGEYVTGPEVIN-EQSREAMRAALKRIQT---GEYAKMFIQEGR-----TNYP
ILVC_ACIAC       SISNNAEFGEYVTGPEVIN-EQSRAAMRNALKRIQN---GDYAKMFIQEGR-----LNYP
ILVC_ACISJ       SISNNAEFGEYVTGPEVIN-EQSRAAMRNALKRIQN---GDYAKMFIQEGR-----LNYP
ILVC_NEIMF       SISNNAEYGEYVTGPEVVN-ASSKEAMRNALKRIQT---GEYAKMFIQEGN-----VNYA
ILVC_NEIMB       SISNNAEYGEYVTGPEVVN-ASSKEAMRNALKRIQT---GEYAKMFIQEGN-----VNYA
ILVC_NEIM0       SISNNAEYGEYVTGPEVVN-ASSKEAMRNALKRIQT---GEYAKMFIQEGN-----VNYA
ILVC_NEIMA       SISNNAEYGEYVTGPEVVN-ASSKEAMRNALKRIQT---GEYAKMFIQEGN-----VNYA
ILVC_NEIG1       SISNNAEYGEYVTGPEVVN-ASSKEAMRNALKRIQT---GEYAKMFIQEGN-----VNYA
ILVC_PSEAB       SISNNAEYGEYVTGPEVIN-AESRAAMRNALKRIQD---GEYAKMFITEGA-----ANYP
ILVC_PSEAE       SISNNAEYGEYVTGPEVIN-AESRAAMRNALKRIQD---GEYAKMFITEGA-----ANYP
ILVC_PSEA7       SISNNAEYGEYVTGPEVIN-AESRAAMRNALKRIQD---GEYAKMFITEGA-----ANYP
ILVC_PSEU5       SISNNAEYGEYVTGPEVIN-AESRAAMRNALKRIQD---GEYAKMFITEGA-----ANYP
ILVC_PSEU2       SISNNAEYGEYVTGPEVIN-AESRQAMRNALKRIQD---GEYAKMFISEGA-----TGYP
ILVC_PSE14       SISNNAEYGEYVTGPEVIN-AESRQAMRNALKRIQD---GEYAKMFISEGA-----TGYP
ILVC_PSESM       SISNNAEYGEYVTGPEVIN-AESRQAMRNALKRIQD---GEYAKMFITEGA-----TGYP
ILVC_PSEMY       SISNNAEYGEYVTGPEVIN-AESRQAMRNALKRIQD---GEYAKMFISEGA-----TGYP
ILVC_PSEPF       SISNNAEYGEYVTGPEVIN-AESRQAMRNALKRIQD---GEYAKMFISEGA-----TGYP
ILVC_PSEF5       SISNNAEYGEYVTGPEVIN-AESRQAMRNALKRIQD---GEYAKMFISEGA-----TGYP
ILVC_PSEPK       SISNNAEYGEYVTGPEVIN-EESRKAMRNALKRIQD---GEYAKMFISEGA-----TNYP
ILVC_PSEP1       SISNNAEYGEYVTGPEVIN-EESRKAMRNALKRIQD---GEYAKMFISEGA-----TNYP
ILVC_PSEPG       SISNNAEYGEYVTGPEVIN-EESRKAMRNALKRIQD---GEYAKMFISEGA-----TNYP
ILVC_PSEE4       SISNNAEYGEYVTGPEVIN-EESRKAMRNALKRIQD---GEYAKMFISEGA-----TNYP
ILVC_ALCBS       SISNNAEYGEYVTGPEVIN-DESRAAMRNALKRIQS---GEYAKMFIAEGA-----HNYP
ILVC_MARHV       SISNNAEYGEYVTGPEVIN-EQSREAMRNALKRIQS---GEYAKMFISEGA-----LNYP
ILVC_HAHCH       SISNNAEYGEYVTGPEVIN-DQSRAAMRNALKRIQD---GEYAKMFIAEGA-----HNYP
ILVC_SACD2       SISNNAEYGEYVTGPKVIN-EESRKAMRQALKDIQQ---GEYAKNFILEGQ-----SNYP
ILVC_HYDCU       SISNNAEYGEYVTGPRVIN-DESRAAMREALKNIQT---GEYAKQFILEGQ-----SNYP
ILVC_PSYCK       SISNNAEYGEYVTGPEVIN-EQSREAMRNALKRIQS---GEYAKMFISEGA-----TNYP
ILVC_PSYA2       SISNNAEYGEYVTGPEVIN-EQSREAMRNALKRIQS---GEYAKMFISEGA-----TNYP
ILVC_PSYWF       SISNNAEYGEYVTGPEVIN-EQSREAMRNALKRIQS---GEYAKMFITEGA-----TNYP
ILVC_ACIAD       SVSNNAEYGEYVTGVEVIN-EQSREAMRNALKRIQS---GEYAKMFIQEGA-----LNYP
ILVC_THIDA       SISNNAEYGEYVTGVKVIN-EQSRAAMKECLANIQN---GAYAKRFILEGQ-----ANYP
ILVC_CHRSD       SISNNAEYGEYVTGPEVIN-EQSREAMRNALKRIQN---GEYAKMFISEGN-----SNYP
ILVC_PRB01       SISNTAEYGDYVSGPKVIT-SDTKKAMKGILENIQS---GKFADDFLNDCRQSNDGTGGP
ILVC_ARCB4       SISNTAEYGDYVSGPRVIN-DESRAAMKQILKEIQN---GVFAKDFILEGQ-----AGYP
ILVC_SULDN       SISNTAEYGDYVSGKRVIN-AESKAAMREILKEIQD---GRFAKDFILEGQ-----SGYP
ILVC_NITSB       SISNTAEYGDYVSGPRVIN-EASRQAMKDILKEIQN---GKFAKDFILEGM-----AGYP
ILVC_HELHP       SISNTAEYGDMVSGPRVIN-EESKKAMKQILKDIQE---GRFAKDFILERK-----AGYA
ILVC_WOLSU       SVSNTAEYGDMVSGPRVVN-ETSKAAMKEILKDIQE---GRFAKDFILERK-----AGYA
ILVC_CAMC5       SISNTAEYGDYVSGGRVVG-EESKRAMKEVLKEIQN---GKFAKDFILERK-----AGYV
ILVC_CAMC1       SISNTAEYGDYVSGVRVVG-EESRKAMKEVLKEIQN---GKFAKDFILERK-----AGYV
ILVC_CAMFF       SISNTAEYGDYVSGVRVVN-ESSKAAMKAILKEIQD---GTFAKNFILERK-----AGYT
ILVC_CAMHC       SISNTAEYGDYISGKKVIN-EDSKKAMKEILGSIQD---GSFAKDFILERK-----AGYA
ILVC_CAMJ8       SISNTAEYGDYITGPKIIT-EETKKAMKGVLKDIQN---GVFAKDFILERR-----AGFA
ILVC_CAMJJ       SISNTAEYGDYITGPKIVT-EETKKAMKGVLKDIQN---GVFAKDFILERR-----AGFA
ILVC_CAMJR       SISNTAEYGDYITGPKIIT-EETKKAMKGVLKDIQN---GVFAKDFILERR-----AGFA
ILVC_CAMJE       SISNTAEYGDYITGPKIIT-EETKKAMKGVLKDIQN---GVFAKDFILERR-----AGFA
ILVC_CAMJD       SISNTAEYGDYITGSKIIT-EETKKAMKGVLKDIQN---GVFAKDFILERR-----AGFA
ILVC_MYCSK       SVSDTAEFGGYLSGPRVIDAD-TKERMRAILKDIQD---GTFVKRLVANVEGG-----NK
ILVC_MYCSJ       SVSDTAEFGGYLSGPRVIDAD-TKERMRAILKDIQD---GTFVKRLVANVEGG-----NK
ILVC_MYCSS       SVSDTAEFGGYLSGPRVIDAD-TKERMRAILKDIQD---GTFVKRLVANVEGG-----NK
ILVC_MYCVP       SVSDTAEFGGYLSGPRVIDAD-TKKRMQDILKDIQD---GTFVKRLVANVEGG-----NK
ILVC_MYCGI       SVSDTAEFGGYLSGPRVIDAD-TKKRMQDILKDIQD---GTFVKRLVANVEGG-----NK
ILVC_MYCS2       SVSDTAEFGGYLSGPRVIDAD-TKKRMQDILKDIQD---GSFVKRLVANVEGG-----NK
ILVC_NOCFA       SVSDTAEFGGYLSGPRVIDAG-TKERMKEILKDIQD---GTFVKRLVANVEGG-----NK
ILVC_RHOJR       SVSDTAEFGGYLSGPRVIDAG-TKERMKAILADIQS---GEFTRRLVANVENG-----NT
ILVC_MYCPA       SVSDTAEFGGYLSGPRVIDAG-TKDRMREILRDIQN---GDFVKKLVANVEGG-----NK
ILVC_MYCA1       SVSDTAEFGGYLSGPRVIDAG-TKDRMREILRDIQN---GDFVKKLVANVEGG-----NK
ILVC_MYCAV       SVSDTAEFGGYLSGPRVIDAG-TKDRMREILRDIQN---GDFVKKLVANVEGG-----NK
ILVC_MYCUA       SVSDTAEFGGYLSGPRVIDAG-TKERMRAILRDIQS---GDFVKKLVANVEGG-----NK
ILVC_MYCLE       SVSDTAEFGGYLSGPRVIDAD-TKERMRGILRDIQD---GSFVKKLVANVEGG-----NK
ILVC_MYCBP       SVSDTAEFGGYLSGPRVIDAG-TKERMRDILREIQD---GSFVHKLVADVEGG-----NK
ILVC_MYCTA       SVSDTAEFGGYLSGPRVIDAG-TKERMRDILREIQD---GSFVHKLVADVEGG-----NK
ILVC_MYCTU       SVSDTAEFGGYLSGPRVIDAG-TKERMRDILREIQD---GSFVHKLVADVEGG-----NK
ILVC_MYCBO       SVSDTAEFGGYLSGPRVIDAG-TKERMRDILREIQD---GSFVHKLVADVEGG-----NK
ILVC_CORGL       SVSDTAEFGGYLSGPRVIDAD-TKSRMKDILTDIQD---GTFTKRLIANVENG-----NT
ILVC_CORGB       SVSDTAEFGGYLSGPRVIDAD-TKSRMKDILTDIQD---GTFTKRLIANVENG-----NT
ILVC_COREF       SVSDTAEFGGYLSGPRVINAD-TKERMKDILTDIQD---GTFTKRLIANVENG-----NT
ILVC_CORJK       SVSDTAEFGGYLSGPRVIDAD-TKKRMKDILTDIQD---GTFTKRLVANVEGG-----NK
ILVC_CORDI       SISETAELGGYVAGPRIITPE-VKENMKAVLADIQS---GKFVRDMVADVEAG-----QP
ILVC1_STRCO      SISETAEWGDYVTGPRIITDA-TKAEMKKVLAEIQD---GTFAKNWMDEYHGG-----LK
ILVC2_STRCO      SISETAEWGDYVTGPRIITDV-TKAEMRKVLAEIQD---GTFAKNWMDEYHGG-----LK
ILVC_STRAW       SISETAEWGDYVTGPRIITDA-TKAEMKKVLAEIQD---GTFAQAWMDEYHGG-----LK
ILVC_SALAI       SISDTAEYGDLSRGPRVIDSQ-VKERMRAILGEIRS---GEFAREWVAEDEAG-----RP
ILVC_SALTO       SISDTAEYGDLSRGPRVIDSQ-VKERMRAVLGEIQS---GEFAREWVAEDEAG-----RP
ILVC_SACEN       SISDTAEYGDLTRGPRVIDAH-VKESMRKILAEVQD---GTFAKEWVAEDEAG-----RP
ILVC_FRAAA       SISDTAEYGDVTRGPRVVTPA-VKAEMRKILDEIRD---GTFAREWVAEDDNG-----RP
ILVC_FRACC       SISDTAEYGDVTRGPRVITPA-VKAEMRKILDEIRD---GAFAREWVAEDDNG-----RP
ILVC_THEFY       SVSDNAEYGGYTRGPRVITES-TREEMRKILQEVQD---GTYAKELVEEFDKG-----RP
ILVC_CLAMS       SISDTAEYGDYVSGPRVISPD-VKENMKAVLADIQS---GAFADRFIKDQDAG-----AP
ILVC_CLAM3       SISDTAEYGDYVSGPRVISPD-VKENMKAVLADIQS---GAFADRFIKDQDAG-----AP
ILVC_LEIXX       SVSDTAEYGDYVSGPRVIGPH-VKENMKAVLSDIQD---GTFAKRFIADQDAG-----AP
ILVC_ARTS2       SVSDTAEYGDYVSGPRVITPE-VKENMKAVLADIQN---GAFAKRFIEDQDNG-----GV
ILVC_RENSM       SVSDTAEYGDYVSGPLVIDAH-VKDNMKAVLKDIQD---GTFAKRFIDDQDAG-----AP
ILVC_KINRD       SVSDTAEWGDYVSGPRVIDAS-VKERMKDVLKDIQD---GTFARNFIEDQDAG-----AP
ILVC_CUTAK       SISDTAEYGDYVSGPRVIDDH-VKKNMKAVLDDIQN---GAFAKRFIADQDAG-----AP
ILVC_TROW8       SISDTAEYGSYVSGPRVIDKH-VKENMKKILGEIRS---GEFANRFIKDQDSG-----AN
ILVC_TROWT       SISDTAEYGSYVSGPRVIDKH-VKENMKKILGEIRS---GEFANRFIKDQDSG-----AN
ILVC1_BIFLO      SCSDTAQYGDYVN--TVINED-CRKRMEYHLQRIQD---GSFAKEFIDDQDAG-----AP
ILVC2_BIFLO      SCSDTAQYGDYTS--TVITEE-TKKRMQYQLKRIQD---GSFAKEFMDDQAAG-----AP
ILVC_XYLFA       FVSETAQYGDYVSGPRVIDGS-TKERMKAVLKDIQD---GTFTKHWIAEYQAG-----LP
ILVC_XYLFT       FVSETAQYGDYVSGPRVIDRS-TKERMKAVLKDIQD---GTFTKHWIAEYQAG-----LP
ILVC_XANAC       FVSETAQYGDYVSGPRVIDAG-TKARMKDVLTDIQN---GTFTKNWVAEYDAG-----LP
ILVC_XANC5       FVSETAQYGDYVSGPRVIDAG-TKARMKDVLTDIQN---GTFTKNWVAEYDAG-----LP
ILVC_XANOM       FVSETAQYGDYVSGPRVIDAS-TKARMKDVLTDIQN---GTFTKNWVAEYEAG-----LP
ILVC_XANOR       FVSETAQYGDYVSGPRVIDAS-TKARMKDVLTDIQN---GTFTKNWVAEYEAG-----LP
ILVC_XANCP       FVSETAQYGDYVSGPRVIDAS-TKARMKDVLTDIQN---GTFTKNWVAEYEAG-----LP
ILVC_XANC8       FVSETAQYGDYVSGPRVIDAS-TKARMKDVLTDIQN---GTFTKNWVAEYEAG-----LP
ILVC_CHLPM       SVSDTAEYGGMTRGPRLITPA-VKAEMKKILEEVQD---GRFAKEFIDECNGG-----YK
ILVC_CHLPD       SVSDTAEYGGMTRGPRLITPA-VKAEMKKILEEVQD---GRFAREFIDECQNG-----YP
ILVC_CHLCH       SVSDTAEYGGMTRGPRLITPA-VKAEMKKILEEVQD---GRFAKEFIDECNGG-----YQ
ILVC_PELLD       SVSDTAEYGGMTRGPRLITSA-VKAEMKKVLEEVQD---GRFAREFIDECNGG-----YK
ILVC_CHLTE       SVSDTAEYGGMTRGPRVVTSA-AKAEMKKILEEIQD---GRFAKEFIDECNSG-----YK
ILVC_SALRD       SVSDTAEYGGYTRGPRVIDDA-VREQMQEILEEVQS---GEFADEWIEEYEQG-----AP
ILVC_NATPD       SVSDTAEYGGLTRGDRIVDDH-AREKMEEVLEEVQN---GTFAREWISENQAG-----RP
ILVC_HALMA       SVSDTAEYGGLTRGEEVID----REGMEKILEEVQN---GEFAREWINENQAN-----RP
ILVC_DESVV       SISDTAEYGDYVTGKRIVT-EETKKEMKKVLRDIQD---GTFARNFILEAKAG-----YP
ILVC_DESVH       SISDTAEYGDYVTGKRIVT-EETKKEMKKVLRDIQD---GTFARNFILEAKAG-----YP
ILVC_DESAG       SISDTAEYGDYVTGRRIVT-EETKKEMKAALKDIQE---GRFARDFILECKAN-----YP
ILVC_RHOBA       SISNTAEYGDYVTGPRIIT-DETKAEMKKVLEEIQQ---GEFARKWISENRAG-----AP
ILVC1_BACC1      SVSDTAQWGDFVSGPRVVT-EDTKKAMGTVLAEIQD---GTFARGWIAEHKAG-----RP
ILVC1_BACCZ      SVSDTAQWGDFVSGPRVVT-EDTKKAMGAVLAEIQD---GTFARGWIAEHKAG-----RP
ILVC1_BACHK      SVSDTAQWGDFVSGPRVVT-EDTKKAMDTVLAEIQD---GTFARGWIAEHKAG-----RP
ILVC1_BACAN      SVSDTAQWGDFVSGPRVVT-EDTKKAMGTVLAEIQD---GTFARGWIAEHKAG-----KP
ILVC1_BACCR      SVSDTAQWGDFVSGPRVVT-EDTKKAMGAVLAEIQD---GTFARGWIAEHKAG-----RP
ILVC_BACCN       SVSDTAQWGDFVSGPRVVT-EHTKKAMGDVLKEIQD---GTFAKGWIAEHQAG-----RP
ILVC_OCEIH       SISDTAQWGDFVSGQRVVD-DQTKERMKSILDDIQT---GSFAKGWILENQAG-----RP
ILVC_BACVZ       SISDTAQWGDFVSGPRVVD-AKVKESMKQVLTDIQN---GTFAKEWIVENQVN-----RP
ILVC_BACSU       SISDTAQWGDFVSGPRVVD-AKVKESMKEVLKDIQN---GTFAKEWIVENQVN-----RP
ILVC_BACLD       SISDTAQWGDFVSGPRVVD-EKVKESMKEVLKDIQN---GTFAKEWIVENQVN-----RP
ILVC_BACP2       SISDTAQWGDFVSGPRVVD-ANVKESMKAVLTDIQN---GTFAKEWIVENQVN-----RP
ILVC_GEOKA       SISDTAQWGDFITGPRIIN-DAVKAEMKKVLDDIQT---GKFAKSWILENQAN-----RP
ILVC_GEOTN       SISDTAQWGDFTSGPRVIN-EAVKAEMKNILHDIQT---GKFAKGWILENQAN-----RP
ILVC_BACSK       SISDTAQWGDFQAGPRIVT-DETKAAMKEILSDIQK---GKFAKGWILENKLN-----RP
ILVC_BACHD       SISDTAQWGDFQAGPRVVT-AETKQAMKDILSDIQT---GKFAKGWILENQAN-----RP
ILVC2_BACAN      SISDTAEFGDYVTGSRIVT-DETKKEMKRVLTEIQQ---GEFAKKWILENQAG-----RP
ILVC2_BACHK      SISDTAEFGDYVTGSRIVT-DETKKEMKRVLTEIQQ---GEFAKKWILENQAG-----RP
ILVC2_BACCR      SISDTAEFGDYVTGSRIVT-DETKKEMKRVLTEIQQ---GEFAKKWILENQAG-----RP
ILVC2_BACCZ      SISDTAEFGDYVTGSRIVT-DGTKKEMKRVLTEIQQ---GEFAKKWILENQAG-----RP
ILVC2_BACC1      SISDTAEFGDYVTGSRIVT-DETKKEMKRVLTEIQQ---GEFAKKWILENQAG-----RP
ILVC_CALS4       SISDTAEFGDYMTGKRIIT-EETRKEMKKILEEIQT---GKFAKEWLLENQVG-----RP
ILVC_CALS8       SISDTAEYGDYMTGKRIIT-EETRKEMKKVLEEIQN---GTFAKKWILENMAG-----RP
ILVC_CLOB8       SISDTAEYGDYQIGRRIIT-DETKKEMKKVLTEIQD---GTFAKNWLLENQTN-----RP
ILVC_ALKMQ       SISDTAEYGDYSVGKRIIT-DETKKEMKKVLHEVQD---GTFARNWILENKAN-----RP
ILVC_CLONN       SISDTAEFGEYSVGNRIVT-EETKKEMKKVLREIQD---GTFANAWLVENQVN-----RP
ILVC_CLOAB       SISDTAEYGDYVVGNRLIN-DNVRAEMKKVLTEIQD---GTFAKNWLLENQTG-----RP
ILVC_LACP7       SISNTAEYGDYITGPKIIT-EDTKNAMRQVLKDIQE---GVFARNWLLENQVG-----CP
ILVC_HUNT2       SISDTAEYGDYITGKKIIT-EETRKAMKAVLKDIQD---GVFASKWITENKAGG----RA
ILVC_THEMA       SVSNTAEYGDYISQEKIVT-KEVRENMKQMLKDIQT---GKFAKDWILENQAG-----RP
ILVC_THEP1       SVSNTAEYGDYISQEKIVT-KEVRENMKQMLKDIQT---GKFAKDWILENQAG-----RP
ILVC_AQUAE       SISDTAKYGDVTRGER-IY-KVVKPVMEKTLEEIQK---GEFAREWILENKAG-----RP
ILVC_PETMO       SISDTAQYGDITIGPKIID-DRVKETMKDVLANIQN---GNFAKDWILENKAN-----RP
ILVC_DESHY       SISDTAEYGDMMIGKRIIT-DETRKEMKKVLAEIQD---GTFAKNWLLENQIN-----RP
ILVC_DESRM       SVSNTAEYGDYMIGPRIVN-EETREEMRQVLMEIQD---GTFARNWMLENQVK-----SP
ILVC_CARHZ       SISDTAEYGDYMVGPRIIT-EETKKEMKKVLEEIQN---GTFAKNWILENMAG-----RP
ILVC_SYNWW       SISDTAEWGDYTKGPEIIG-EEARYAMYEALQDIQD---GSFAKGWLLENMVG-----RP
ILVC_MOOTA       SISDTAEYGDVTRGPRLID-DHVKSTMKSILKEIQD---GVFAREWILENQAG-----RP
ILVC_DEHMC       SISDTAKYGDFTRGPRVIN-EDTYETMGEILGEIQD---GSFAKEWILENQAG-----RP
ILVC_DEHMB       SISDTAKYGDFTRGPRVIN-EDTYETMGEILGEIQD---GSFAKEWILENQAG-----RP
ILVC_DEHM1       SISDTAKYGDFTRGPRVIN-EETYETMGEILGEIQD---GSFAKEWILENQAG-----RP
ILVC_METST       DVSNTAEFGGLTRRDRVIT-EESKENMKKILREIQD---GTFATEFAVDADTS-----YP
ILVC_METS3       DVSNTAEYGGLTRRDYVIT-EETKKGMKKVLSEIQD---GTFKKQFADENATD-----AA
ILVC_METTH       NVSNTAEFGGLTRRGRIIT-EETEKEMDEILKEIQN---GKFAKEWALENRAG-----AP
ILVC_METM5       DVSNTAEYGGLTRRSRIVT-ADSKAAMKEILKEIQD---GRFTKEFVLEKQVN-----HA
ILVC_METM7       DVSNTAEYGGLTRRSRIVT-ADSKAAMKEILKEIQD---GRFTKEFVLEKQVN-----HA
ILVC_METMP       DVSNTAEYGGLTRRSRIVT-ADSKAAMKEILREIQD---GRFTKEFLLEKQVS-----YA
ILVC_METVS       DVSNTAEYGGLTRRSRIVT-ADSKAAMKEILKEIQD---GRFTKEFVLENQAK-----MA
ILVC_METJA       NVSNTAEYGGLTRRARVIN-EESRKAMKEILKEIQD---GRFAKEWSLEREAG-----FP
ILVC_PYRIL       GVSDTAKYGGLTVGPKIID-EEVKKKMRIFALRVKS---GEFAKEWVEEYARG-----GL
ILVC_PYRAE       GVSDTAKYGGLTVGPRVID-ENVKRKMKEAAMRVKS---GEFAKEWVEEYNRG-----AP
ILVC_PYRCJ       GVSDTAKYGGLTVGPRVID-DEVKEKMRRAAARVKS---GEFAKEWVEEYQRG-----AP
ILVC_PYRAR       GVSDTAKYGGLTVGPKIID-ESVKQRMREAAARVRS---GEFAKEWVTEYNRG-----GP
ILVC_PYRAB       AVSDTAKYGGLTVGPKVID-DHVKENMKKFAERVRS---GEFAKEWISKADKA-----SE
ILVC_PYRFU       AVSDTAKYGGLTVGPKVID-EHVKENMRKYAERVRS---GEFAKEWISKADKA-----DE
ILVC_SULTO       AVSETAKYGGFTAGKYVIN-EDVKKRMKEVLDRIRS---GKFAEEWIEEYNKG-----AP
ILVC_SULAC       AVSDTAKYGGMTVGKMVID-ESVKERMKKALDNIRS---GKFAEKWVEEYGKG-----AN
ILVC_SACS2       AVSDTAKYGGMTVGKFVID-ESVRKRMKEALQRIKS---GKFAEEWVEEYGRG-----MP
ILVC_METKA       NVSNTAEYGGLTRGKRIIN----KEEMRKVLEEIRS---GEFAREWTLENESG-----RI
ILVC_METAC       SVSNTAEYGGMTVGPRIIN-EESREAMYEALARIQN---GEFAKEFVLEGMVN-----HP
ILVC_METMA       SVSNTAEYGGMTVGPRVIN-EYSREAMYEALERIQN---GEFAKEFVLEGMVN-----HP
ILVC_METBF       SVSNTAEYGGMTVGPRIIN-DESREAMREALKRIQN---GEFAKEFVLEGMVN-----HP
ILVC_METBU       SVSNTAEYGGLTVGPQIIN-EESREAMYVALERIQN---GEFAREFVLEGQTN-----HA
ILVC_METAR       SVSDTAQYGGMTRGRRIIN-EQSRMEMWRTLEEIQD---GRFAREWVLENMAG-----RP
ILVC_METTP       SVSNTAEYGGLTRGDRIIN-EQSREAMWEILEEIQS---GKFAREWILESQAG-----LP
ILVC_ARCFU       AVSETAKYGGMTRGKRIFT-EQTREEMRKILKEIQT---GEFAREWILENMAG-----RP
ILVC_METB6       YVSNTAQYGDMTRGPRVIG-PEAYEAMEEILAEIQS---GEFAKEWMLENMVN-----RP
ILVC_METLZ       AISNTAQYGDITRGPRVIG-NESYEAMREILYEIQS---GEFAKEWILENMVN-----RP
ILVC_METHJ       SISNTAQFGDLTRGPRVIG-QESYLAMQEILEEIQT---GAFAKEWMLENMVN-----RP
ILVC_METMJ       SISNTAQYGDLTRGPRVIG-PETYMAMQEILEEIQN---GKFAKEWMLENMVN-----RP
ILVC_KORVE       SVSDTAEYGDYIAGPRIIT-DETRKNMKQLLTDIQD---GTFAKNWINENKTG-----RP
ILVC_SORC5       SISDTAEHGDYVSGPRVIT-DKTREEMKRILAEIQS---GEFARKWIAENEAG-----RP
ILVC_CHLAA       SVSDTAEWGDYTAGPKIIT-DQTRAAMRQILADIQS---GAFAEDWIDENHNG-----RP
ILVC_ROSCS       SVSDTAEWGDYTAGPKIIT-DETRATMKRILADIQS---GAFAEDWIEENHNG-----RP
ILVC_SOLUE       SVSDTAEYGDYTRGPRVVN-DQTRAEMKKILSEIQS---GEFARQWIEENKTG-----RK
ILVC_SYNJA       SISNTAEYGDYTRGPRIIT-EQTRAEMKRILSEIQS---GQFAREFVLENQAG-----KP
ILVC_SYNJB       SISNTAEYGDYTRGPRIIT-EQTRAEMKRILAEIQS---GQFAREFVLENQAG-----KP
ILVC_NOSS1       SISNTAEYGDYTRGPRIVN-EQTKAEMRKVLSEIQS---GQFAREFVLENQSG-----KP
ILVC_TRIV2       SISNTAEYGDYTRGPRIVN-EQTKAEMRKVLSEIQS---GQFAREFVLENQSG-----KP
ILVC_MICAN       SISNTAEYGDYTRGPRVVT-EATKAEMRKILGEIQS---GQFAREFVLENQAG-----KP
ILVC_TRIEI       SISNTAEFGDYTRGPRIVT-DETRAQMQKILSEIQS---GQFAREFVMENQTG-----KP
ILVC_SYNY3       SISNTAEYGDLTRGPRIVT-EETKAEMRQILDEIQS---GQFAREFVLENQAG-----KP
ILVC_ACAM1       SISNTAEYGDYTRGPRIVD-DRTKAEMRRVLHEIQT---GQFAKEFVLENMSG-----KA
ILVC_THEEB       SISNTAEYGDLTRGPRIIT-EETRAEMRKILHEIQT---GQFAREFVLENMAG-----KP
ILVC_SYNE7       SISNTAEYGDYVTGPRLIT-EETKAEMKRVLADIQQ---GRFALDFVQECGAG-----KP
ILVC_SYNP6       SISNTAEYGDYVTGPRLIT-EETKAEMKRVLADIQQ---GRFALDFVQECGAG-----KP
ILVC_GLOVI       SISNTAEFGDYTRGPRIVD-ERTKAEMKKILAEIQN---GEFAKQWVLDSQAN-----YA
ILVC_SYNPW       SISNTAEYGDYVSGPRLIT-ADTKAEMKRILGDIQD---GTFAKNFVAECEAG-----KP
ILVC_SYNR3       SISNTAEYGDYVSGPRLIT-AETKAEMKRILGDIQD---GTFAKNFVAECEAG-----KP
ILVC_PROM3       SISNTAEYGDYVSGPRLIN-ADTKAEMKRILADIQD---GTFAKNFVAECESG-----KP
ILVC_PROMM       SISNTAEYGDYVSGPRLIN-ADTKAEMKRILADIQD---GTFAKNFVAECESG-----KP
ILVC_SYNSC       SISNTAEYGDYVSGPRLIT-ADTKAEMKRVLADIQD---GTFARNFVAECEAG-----KP
ILVC_SYNPX       SISNTAEYGDYVSGPRLIT-ADTKAEMKRVLADIQD---GTFAKNFVAECEAG-----KP
ILVC_SYNS9       SISNTAEYGDYVSGPRLIT-ADTKAEMKRVLADIQD---GTFARNFVAECDAG-----KP
ILVC_SYNS3       SISNTAEYGDYVSGPRLIT-ADTKAEMKRILSDIQD---GTFAKNFVAECAAG-----KP
ILVC_PROM1       SISNTAEYGDYVSGPRLIT-KETKEEMKNILADIQD---GTFAKNFVKECDAG-----KP
ILVC_PROMT       SISNTAEYGDYVSGPRLIT-KETKEEMKNILADIQD---GTFAKNFVKECDEG-----KP
ILVC_PROMA       SISNTAEYGDYVSGPRLIN-ADTKKEMKKILADIQD---GTFAKNFVAECEAG-----KP
ILVC_PROMS       SISNTAEYGDYVSGKRLIN-SDTKKEMQKILKDIQD---GTFAKNFVEECDKN-----KP
ILVC_PROM2       SISNTAEYGDYVSGKRLIN-SDTKKEMQKILKDIQD---GTFAKNFVEECDKN-----KP
ILVC_PROM0       SISNTAEYGDYVSGKRLIN-SDTKKEMQKILKDIQD---GTFAKNFVEECDKD-----KP
ILVC_PROM9       SISNTAEYGDYVSGKRLIN-SDTKKEMQKILKDIQD---GTFAKNFVEECDKN-----KP
ILVC_PROM5       SISNTAEYGDYVSGKRLIN-SDTKKEMQKILKDIQD---GTFAKNFVEECDRD-----KP
ILVC_PROMP       SISNTAEYGDYVSGKRLIN-NETKKEMQKILKDIQD---GTFAKNFVDECDNN-----KP
ILVC_ANADE       SISDTAEYGDYTRGPRVVD-GRSKDEMRKILKEIQG---GHFAKEFILENQAG-----GP
ILVC_THET2       SISNTAEYGDYTRGDLAVPLEETKRRMREILRQIQS---GEFAREWMLENQVG-----SP
ILVC_THET8       SISNTAEYGDYTRGDLAVPLEETKRRMREILRQIQS---GEFAREWMLENQVG-----SP
ILVC_RUBXD       SVSNTAEYGDYTAGPKVID-EGVRERMREILADIQS---GRFAKEWVLENQAG-----GS
ILVC_DEIGD       SISNTAEYGDYVTGPRIIT-DETKATMKDVLSDIQS---GKFARDFIHEAESG-----FP
ILVC_DEIRA       SISNTAEFGDYVTGPRIIT-DQTKAEMKNVLGDIQS---GKFAESFIKDAESG-----FP
ILVC_LEPBL       SISDTAEYGDYVSGPRVID-PGVKQRMKEVLNDIQKDKGAKFATNWMAETKAG-----YP
ILVC_LEPBJ       SISDTAEYGDYVSGPRVID-PGVKQRMKEVLNDIQKDKGAKFATNWMAETKAG-----YP
ILVC_LEPIC       SISDTAEYGDYVSGPRVID-PGVKQRMKEVLNDIQKDKGAKFATNWMAETKAG-----YP
ILVC_LEPIN       SISDTAEYGDYVSGPRVID-PGVKQRMKEVLNDIQKDKGAKFATNWMAETKAG-----YP
ILVC_CLOD6       SISDTAEYGDYVSGKRVIT-DAAKQGMQNVLEDIQN---GKFAKAWIKENEEG-----RE
ILVC_TREPR       SISNNAEYGEYVSGPRVIG-AAVRSAMRRVLNDIRT---GRYAKDFIMEGRSN-----SP
ILVC_HELPH       HISNTAEFGAIKAREPMGN--LLEKRMQKILKKIQN---GSFAKDFLLEKSLN-----YP
ILVC_HELPJ       HISNTAEFGAIKAREPMGN--LLEKRMQKILKKIQN---GAFAKDFLLEKSLN-----YP
ILVC_HELPY       HISNTAEFGAIKAREPMGK--LLKKRMQKILKKIQN---GSFAKDFLLEKSLN-----YP
ILVC_HELAH       HISNTAEFGAIKAREPMEN--LLEKRMQKILKKIQN---GSFAKDFLLEKSLN-----YP
ILVC_ECOK1       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_ECOUT       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_ECO24       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_ECOL5       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_ECOL6       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_SHIDS       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_SHIBS       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_SHISS       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_SHIFL       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_ECOLC       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNG
ILVC_ECOLI       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNG
ILVC_ECOHS       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNG
ILVC_ECO57       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIPEG------AVDNA
ILVC_SALCH       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGSAIPEG------AVDNA
ILVC_SALPB       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGSAIPEG------AVDNA
ILVC_SALTI       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGSAIPEG------AVDNA
ILVC_SALPA       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGSAIPEG------AVDNA
ILVC_SALTY       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGSAIPEG------AVDNA
ILVC_SALAR       VISDTAEYGNYLFSYACVP-----LLKP-FMAELQP---GDLGKAIAEG------SVDNA
ILVC_KLEP7       VISDTAEYGNYLFSYACVP-----LLKE-FMTTLQT---GDLGTAIAEG------AVDNA
ILVC_CITK8       VISDTAEYGNYLFSYACVP-----LLKA-FMTEIQP---GDLGKAIAEG------AVDNA
ILVC_ENT38       VISDTAEYGNYLFSYACVP-----LLKE-FMTTLQT---GDLGKAVAEG------AVDNA
ILVC_CROS8       VISDTAEYGNYLFANAAVP-----LLKE-FMTKLQP---GDLGKAVEGT------AVDNA
ILVC_YERP3       VISDTAEYGNYLFANAAVP-----LLKEKFMDSLQA---GDLGKSIPGS------AVDNA
ILVC_YERPS       VISDTAEYGNYLFANAAVP-----LLKEKFMDSLQA---GDLGKSIPGS------AVDNA
ILVC_YERPA       VISDTAEYGNYLFANAAVP-----LLKEKFMDSLQA---GDLGKSIPGS------AVDNA
ILVC_YERPP       VISDTAEYGNYLFANAAVP-----LLKEKFMDSLQA---GDLGKSIPGS------AVDNA
ILVC_YERPN       VISDTAEYGNYLFANAAVP-----LLKEKFMDSLQA---GDLGKSIPGS------AVDNA
ILVC_YERPE       VISDTAEYGNYLFANAAVP-----LLKEKFMDSLQA---GDLGKSIPGS------AVDNA
ILVC_YERE8       VISDTAEYGNYLFANAAVP-----LLKGKFMDSLQA---GDLGKSVAGT------AVDNA
ILVC_SERP5       VISDTAEYGNYLFANAAVP-----LLKE-FMTTLQA---GDLGKSVAGT------SVDNA
ILVC_PECAS       VISDTAEYGNYLFANAAVP-----LLKGAFMASLQP---GDLGKAVAGT------EVDNA
ILVC_PHOLL       VISDTAEYGNYLFSHVAVP-----LLKEKFMGSLQA---GDLGKPVVDN------GIDNA
ILVC_SODGM       VISDTAEYGNYLFANAAVP-----LLKEAFMGNLQV---GDLGKPVADG------EIDNA
ILVC_AERHH       VISDTAEYGNYLFANAAVP-----LLREHFMPTLKA---GDLGASKAEGQ-----SVDNL
ILVC_AERS4       VISDTAEYGNYLFANAAVP-----LLREHFMPTLKA---GDLGASKAEGQ-----NVDNL
ILVC_HAEIE       VISDTAEYGNYLFSNVATP-----ILAKEIIPNLQK---GDLGEPTPAV------EVDNI
ILVC_HAEIN       VISDTAEYGNYLFSNVATP-----ILAKEIIPNLQK---GDLGEPTPAV------EVDNI
ILVC_HAEI8       VISDTAEYGNYLFSNVATP-----ILAKEIIPNLQK---GDLGEPTPAV------EIDNI
ILVC_HAEIG       VISDTAEYGNYLFSNVATP-----ILAKEIIPNLQK---GDLGEPTPAV------EVDNI
ILVC_PASMU       VISDTAEYGNYLFANVATP-----ILAKEIMPTLQK---GDLGEPTPTV------EIDNI
ILVC_MANSM       VISDTAEYGNYLFSNVATP-----ILAKEIVSQLKR---GDLGEPTPAA------EIDNV
ILVC_ACTSZ       VISDTAEYGNYLFSNVATP-----ILAKEIIPALQK---GDLGEPTPAV------DIDNV
ILVC_ACTP2       VISDTAEYGNYLFSHVATP-----ILAEKLIPMLQK---GDLGEPTPAA------EIDNV
ILVC_HISS2       VISDTAEYGNYLFANVAAP-----ILAKEIIPTLKR---GDLGESTPAT------EIDNI
ILVC_HAES1       VISDTAEYGNYLFANVAAP-----ILAKEIIPTLKR---GDLGESTPAT------EIDNI
ILVC_VIBVY       VISDTAEYGNYLFANVATP-----LLREKFMPSVGT---DVIGKGLGETSN----QVDNA
ILVC_VIBVU       VISDTAEYGNYLFANVATP-----LLREKFMPSVGT---DVIGKGLGETSN----QVDNA
ILVC_VIBPA       VISDTAEYGNYLFANVATP-----LLREKFMPSVGT---DVIGKGLGETSN----QVDNA
ILVC_ALIF1       VISDTAEYGNYLFANVATP-----LLREKFMPSVET---DVIGRGLGEASN----QVDNA
ILVC_VIBCH       VISDTAEYGNYLFANVAVP-----LLREKFMPKVGT---DVIGKGLGVVSN----QVDNA
ILVC_VIBC3       VISDTAEYGNYLFANVAVP-----LLREKFMPKVGT---DVIGKGLGVVSN----QVDNA
ILVC_PHOPR       VISDTAEYGNYLFANVATP-----LLREKFMTDVDT---DVIGRGLGEVSN----QVSNE
ILVC_SHEON       VISDTAEYGCYLFNHAAVP-----LLRD-YVNAMSP---EYLGAGLKDSSN----SVDNL
ILVC_BUCAI       VISDTAEYGSYLFSESAYP-----ILKE-FISTLNK---SDLGCALSHQ------SVNNI
ILVC_BUCDN       VISDTAEYGNYLFSESAYP-----ILKE-FVKNINN---TDLGSALPRN------SVNNI
ILVC_BUCAP       VISDTAEYGSYLFSEAAYP-----ILKD-FIMSLEK---NVLGLSLPNT------KIDNI
ILVC_BUCMH       VISDTAEYGSYLFSHAAIP-----LLKK-FMNELQP---GDLGNKISTS------ELDNI
ILVC_BUCSC       VISDTAEYGSYLFSQSAIP-----LLKE-FMNELCP---GDLGEKISDL------QFDNV
ILVC_BUCBP       IISDTAEYGSHLFFQSAFP-----LLQD-FMNTLEH---GDLGNKMLDQ------AINNV
ILVC_BLOFL       VISDTAEYGNYLFSDFVLP-----LLKKEFVPYLKR---GDLDLSHVNNIV----HIDNI
                   *:..: *                        :                          

ILVC_LEUMM       DLEKMRTEYKSGLYEQTGKKVRAMMPWISDADKYSTAADTEQFSAAK-----
ILVC_LEUMC       DLEKMRTEYKSGLYEQTGKKVRAMMPWISDADKYSTAADTEQFSAAK-----
ILVC_STAES       EFYQLREDQHGHQIEQVGRELREMMPFIKSKSIEK-----------------
ILVC_STAEQ       EFYQLREDQHGHQIEQVGRELREMMPFIKSKSIEK-----------------
ILVC_STAA1       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAA9       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAB       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAN       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAM       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAW       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAR       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAA2       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAA8       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAE       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAC       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAT       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAA3       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAAS       EFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEK-----------------
ILVC_STAHJ       EFYKLREQQHGHEIEAVGRELRKMMPFIKSKSIQK-----------------
ILVC_STAS1       EFHKLREEQHGHQIEAVGRELRDMMPFIKSKSIEK-----------------
ILVC_LISMF       EFHRMRKEQQGHQIEKVGAELREMMPFVKPQH--------------------
ILVC_LISIN       EFHRMRKEQQGHQIEKVGAELREMMPFVKPQH--------------------
ILVC_LISW6       EFHRMRKEQQGHQIEKVGAELREMMPFVKPQH--------------------
ILVC_LISMO       EFHRMRKEQQGHQIEKVGAELREMMPFVKPQH--------------------
ILVC_STRR6       KLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN------------
ILVC_STRPN       KLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN------------
ILVC_STRP2       KLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN------------
ILVC_STRSV       KLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN------------
ILVC_STRGC       KLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN------------
ILVC_STRT2       KLTAYREEAANLEIEKVGAELRKAMPFVGQNDDDAFKIYN------------
ILVC_STRT1       KLTAYREEAANLEIEKVGAELRKAMPFVGQNDDDAFKIYN------------
ILVC_STRTD       KLTAYREEAANLEIEKVGAELRKAMPFVGQNDDDAFKIYN------------
ILVC_STRTR       KLTAYREEAANLEIEKVGAELRKAMPFVGQNDDDAFKIYN------------
ILVC_STRS2       RMEAYRKEAENLEIEKVGAELRKAMPFVGRNDDDAFKIYN------------
ILVC_STRSY       RMEAYRKEAENLEIEKVGAELRKAMPFVGRNDDDAFKIYN------------
ILVC_STRMU       RLKAFRKEAEGLEIEKIGAELRKAMPFVNQNDDDAFKIYN------------
ILVC_LACLM       KLTAYREAAKNLEIEKIGAELRKAMPFTQSGDDDAFKIYQ------------
ILVC_LACLS       KLTAYREAAKNLEIEKIGAELRKAMPFTQSGDDDAFKIYQ------------
ILVC_LACLA       KLTAYREAAKNLEIEKIGAELRKAMPFTQSGDDDAFKIYQ------------
ILVC_RHIME       RFKGIRRVNDSHQIEEVGAKLRAMMPWIGKNKLVDKAKN-------------
ILVC_SINMW       RFKGIRRVNDAHQIEEVGAKLRGMMPWIGKNKLVDKAKN-------------
ILVC_RHIEC       RFKGIRRNNDSHQIEEVGAKLRGMMPWIGKNKLVDKSVN-------------
ILVC_RHIL3       RFKGIRRLNDSHPIEEVGAKLRGMMPWIGKNKLVDKSVN-------------
ILVC_AGRFC       RFKGIRRMNDTHQIEEVGAKLRGMMPWIGKNKLVDKAVN-------------
ILVC_RHILO       RFKGIRRMNDSHQIEEVGAKLRAMMPWISKNKLVDKAKN-------------
ILVC_CHESB       RFKATRRLNDSHQIEEVGEKLRAMMPWISKNKLVDKAKN-------------
ILVC_BRUO2       RFKGIRRLNDAHQIEEVGGKLRAMMPWIEKNKLVDKARN-------------
ILVC_BRUSU       RFKGIRRLNDAHQIEEVGGKLRAMMPWIEKNKLVDKARN-------------
ILVC_BRUC2       RFKGIRRLNDAHQIEEVGGKLRAMMPWIEKNKLVDKARN-------------
ILVC_BRUAB       RFKGIRRLNDAHQIEEVGGKLRAMMPWIEKNKLVDKARN-------------
ILVC_BRUA2       RFKGIRRLNDAHQIEEVGGKLRAMMPWIEKNKLVDKARN-------------
ILVC_BRUME       RFKGIRRLNDAHQIEEVGGKLRAMMPWIEKNKLVDKARN-------------
ILVC_BRUSI       RFKGIRRLNDAHQIEEVGGKLRAMMPWIEKNKLVDKARN-------------
ILVC_OCHA4       RFKGIRRNNDSHQIEEVGEKLRGMMPWIAANKLVDKARN-------------
ILVC_BART1       HFKSMRRLNDNHPIEEVGKKLRSMMPWIKSNALVDKERN-------------
ILVC_BARHE       HFKGMRRLNDSHPIEEVGKKLRSMMPWIKANALVDKERN-------------
ILVC_BARQU       HFKSMRRLNDSHPIEEVGKKLRSMMPWIKSNALVDKKRN-------------
ILVC_BARBK       RFKDMRRLNSNHLIEQTGDKIRSMMALTKSSAPVDKKHS-------------
ILVC_RHOPB       SFKATRAKLAEHQIEEVGAKLRDMMPWIKKGALVDKSKN-------------
ILVC_RHOP5       SFKATRAKLAEHQIEEVGAKLREMMPWIKKGALVDKSKN-------------
ILVC_RHOP2       SFKATRAKLAAHPIEEVGAKLRDMMPWIKKGALVDKSKN-------------
ILVC_RHOPS       SFKATRAKLAQHPIEEVGAKLREMMPWIKKGALVDKTKN-------------
ILVC_RHOPA       SFKATRAKLAQHPIEEVGAKLRDMMPWIKKGALVDKSKN-------------
ILVC_BRASO       SFKATRARLSQHPIEEVGARLRDMMPWIKKGALVDKSKN-------------
ILVC_BRASB       SFKATRARLAQHPIEEVGARLRDMMPWIKKGALVDKSKN-------------
ILVC_NITWN       SFKATRARLAAHPIEEVGARLRDMMPWIKKAAMVDKAKN-------------
ILVC_NITHX       SFKATRARLAAHPIEQVGAKLRDMMPWIKKGALVDKSKN-------------
ILVC_BRADU       SFKATRAKLAAHPIEEVGAKLRDMMPWIKKGALVDKSKN-------------
ILVC_AZOC5       SFKATRARHNAHQIEAVGEKLREMMPWIKAKALVDKSKN-------------
ILVC_PARL1       SFKATRAAAAAHPIEEVGARLREMMPWISANKLVDKAKN-------------
ILVC_MAGSA       SFKATRRIQAEHGIEVVGEKLRAMMPWIAKNKLVDKAKN-------------
ILVC_PHAMO       SFKATRRIQXEHVIEVVGEKLRGMMPWISKNKLVDKARN-------------
ILVC_RHORT       SFKATRRRNAEHQIEEVGGRLRAMMPWIAANRLVDKDKN-------------
ILVC_GRABC       SFKSIRRRNNEHQIEQVGERLRAMMPWIAKGKLVDKARN-------------
ILVC_ACICJ       NFKAMRRANAAHPIEEVGEKLRAMMPWIKKGALVDKTRN-------------
ILVC_GLUDA       GFKAIRARNNAHQIEQVGEKLRGMMPWIGKNKLVDKTRN-------------
ILVC_GLUOX       GFKAIRARNDAHPIEKTGEKLRAMMPWIAKGKLVDKAKN-------------
ILVC_CAUSK       SFKATRRRASEHQIEEVGARLRGMMPWIAKNKLVDVTKN-------------
ILVC_CAUVC       SFKATRRRSAEHQIEEVGARLRGMMPWIAKNKLVDQAKN-------------
ILVC_RHOS1       FFKATRRINDEHQIEQVGEKLRGMMPWISKGKMVDRARN-------------
ILVC_RHOS4       FFKATRRINDEHQIEQVGEKLRGMMPWISKGKMVDRARN-------------
ILVC_RHOS5       FFKATRRINDEHQIEKVGEKLRGMMPWISKGKMVDRARN-------------
ILVC_PARDP       FFKATRRINDEHQIEKVGEKLRGMMPWISKGKMVDKERN-------------
ILVC_DINSH       FFKGTRRLNDEHQIEAVGKELRGMMPWISAGKLVDQEKN-------------
ILVC_ROSDO       HFKATRRINDEHQIEATGETLRGMMPWISAGKMVDKSKN-------------
ILVC_JANSC       YFKGTRRLNDEHQIEQVGETLRGMMPWISEGKMVDKAKN-------------
ILVC_RUEPO       TIKASRRANDEHQIEQVGQKLRDMMPWISAGKMVDKSKN-------------
ILVC_RUEST       TIKASRRANDEHAIEATGAKLREMMPWISAGKMVDKSKN-------------
ILVC_ERYLH       ELKAARKRAEAHPIEQTGAKLRAMMPWIGKNKLVDKDRN-------------
ILVC_NOVAD       ELKAARGLAKRHQIEETGAKLRAMMPWIGANKLVDQTKN-------------
ILVC_SPHAL       ELKASRKAAAAHPIEQTGEKLRAMMPWIAKNKLVDKAKN-------------
ILVC_SPHWW       ELKASRKLVAEHPIEKVGAELRAMMPWISKNQLVDKAKN-------------
ILVC_ZYMMO       ELKAARKRMAAHPIEQVGARLRKMMPWIASNKLVDKARN-------------
ILVC_PELUB       NFLKMRKDLADHPIEKVGAELRAMMPWIGKKKLIDSDKS-------------
ILVC_HYPNA       GFHAMRQRMSSHPIEEVGEKLRGMMHWAQNDRLVDKSRN-------------
ILVC_GEOUR       RFNALRRKGTEHQIEEVGARLRSMMAWIGKSKIVDKTKN-------------
ILVC_GEOMG       VFTALRRKGAEHQIEEVGARLRSMMSWIGASKIVDKAKN-------------
ILVC_GEOSL       TFNALRRKGMEHPIEDVGARLRSMMSWIGSSKIVDKSKN-------------
ILVC_PELPD       TFNALRRRGSEHQIEEVGARLRAMMPWIGKNKIVDKAKN-------------
ILVC_MAGMM       KFLGLRRRGEAHQIEQVGAKLRAMMPWIQASKLVDKAKN-------------
ILVC_METCA       TLKAKRRLGREHLIESVGARLRDMMPWIKANRIVDTSKN-------------
ILVC_NITOC       TLKAKRRLGQEHLIEQVGERLRSMMPWIGKSRIVDKSKN-------------
ILVC_VESOH       ELPAHREVQRAHQIEQVGESLRSMMPWINKNKIVDQSKN-------------
ILVC_RUTMC       ELPAHRDVQRKHQIEQVGESLRSMMPWINKNKIVDQSKN-------------
ILVC_ALKEH       TLTARRRLAAEHEIEVVGERLRGMMPWINANKLVDKDKN-------------
ILVC_HALHL       TLHARRRLAAEHPIEEVGERLRGMMPWIAANKLVDRD---------------
ILVC_NITEU       VLKSSRRLASEHPIETVGAKLRDMMPWISKNKLVDQAKN-------------
ILVC_NITEC       VLKSSRRLASEHLIETVGSRLRDMMPWIKKNKLVDQAKN-------------
ILVC_NITMU       MLKASRRLASEHQIEQVGAKLRDMMPWIKKNKLVDQAKN-------------
ILVC_CUPMC       TLISRRRLTAEHQIEEVGGKLRAMMPWIAKNKLVDQSKN-------------
ILVC_CUPNH       TLISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN-------------
ILVC_CUPPJ       TLSSRRRLNAEHQIEVVGEKLRAMMPWIAKNKMVDQSKN-------------
ILVC_RALSO       TLISRRRLTADHQIEQVGAKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURM7       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURPS       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURP1       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURP0       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURM9       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURMS       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURMA       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURP6       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURTA       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_BURCH       TLQSRRRLTAEHQIEQVGAKLRAMMPWIAKNKLVDQTKN-------------
ILVC_BURVG       TLQSRRRLTAEHQIEQVGAKLRAMMPWIAKNKLVDQTKN-------------
ILVC_BURCA       TLQSRRRLTAEHQIEQVGAKLRAMMPWIAKNKLVDQTKN-------------
ILVC_BURCM       TLQSRRRLTAEHQIEQVGAKLRAMMPWIAKNKLVDQTKN-------------
ILVC_BURL3       TLQSRRRLTAEHQIEQVGAKLRAMMPWIAKNKLVDQSKN-------------
ILVC_PARXL       TLQSRRRLTAEHQIEQVGSKLRAMMPWIAKNKLVDQSKN-------------
ILVC_POLAQ       TLISRRRLNAEHEIEIVGAKLRAMMPWIAKNKLVDQTKN-------------
ILVC_JANMA       TLISRRRLTAEHQIEEVGAKLRAMMPWIAKNKLVDQTKN-------------
ILVC_HERAR       TLISRRRLNAEHDIEQVGAKLRAMMPWIAKNKLVDQSKN-------------
ILVC_POLNA       TLISRRRLNAEHQIEQVGGKLRAMMPWIAKNKLVDQTRN-------------
ILVC_POLSJ       TLLSRRRLNAEHQIEIVGEKLRAMMPWIAKNKLVDQTRN-------------
ILVC_RHOFT       TLLSRRRLTSEHQIEQVGEKLRAMMPWIKKNKLVDQTRN-------------
ILVC_METPP       TLLSRRRLTAEHDIEVVGEKLRAMMPWIKANKLVDKSRN-------------
ILVC_BORBR       TLTSRRRINAESQIEQVGGKLRAMMPWIAANKLVDKAKN-------------
ILVC_BORPA       TLTSRRRINAESQIEQVGGKLRAMMPWIAANKLVDKAKN-------------
ILVC_BORPE       TLTSRRRINAESQIEQVGGKLRAMMPWIAANKLVDKAKN-------------
ILVC_BORA1       TLTSRRRINAESQIEVVGAKLRAMMPWIAANKLVDKSKN-------------
ILVC_CHRVO       SMTARRRLTAAHPIEKVGAELRAMMPWIAKNKLVDQSKN-------------
ILVC_METFK       SMTARRRLNAAHPIEQVGSQLRAMMPWIAKNKLVDQSKN-------------
ILVC_AZOSB       SMTARRRLNAEHPIEQVGGQLRDMMPWIKAKALVDKSKN-------------
ILVC_DECAR       SMTARRRLNAVHPIETVGGQLRDMMPWIRKNKLVDQTKN-------------
ILVC_AROAE       SMTARRRLNAAHPIEQVGGQLRDMMPWIKKNKLVDQSKN-------------
ILVC_ACIAC       SMTARRRNTADHKIEVVGAQLRAMMPWIAKNKLVDQSRN-------------
ILVC_ACISJ       SMTARRRNTADHSIEVVGAQLRAMMPWIAKNKLVDQTRN-------------
ILVC_NEIMF       SMTARRRLNADHQVEKVGAQLRAMMPWITANKLVDQDKN-------------
ILVC_NEIMB       SMTARRRLNADHQVEKVGAQLRAMMPWITANKLVDQDKN-------------
ILVC_NEIM0       SMTARRRLNADHQVEKVGAQLRAMMPWITANKLVDQDKN-------------
ILVC_NEIMA       SMTARRRLNADHQVEKVGAQLRAMMPWITANKLVDQDKN-------------
ILVC_NEIG1       SMTARRRLNADHQVEKVGARLRAMMPWITANKLVDQDKN-------------
ILVC_PSEAB       SMTAYRRNNAAHPIEQIGEKLRAMMPWIAANKIVDKSKN-------------
ILVC_PSEAE       SMTAYRRNNAAHPIEQIGEKLRAMMPWIAANKIVDKSKN-------------
ILVC_PSEA7       SMTAYRRNNAAHPIEQIGEKLRAMMPWIAANKIVDKSKN-------------
ILVC_PSEU5       SMTAYRRNNAAHGIEVVGEKLRAMMPWIAANKIVDKSKN-------------
ILVC_PSEU2       SMTAKRRNNAAHGIEIIGEKLRSMMPWIAANKIVDKDKN-------------
ILVC_PSE14       SMTAKRRNNAAHGIEIIGEKLRSMMPWIAANKIVDKDKN-------------
ILVC_PSESM       SMTAKRRNNAEHGIEVIGEKLRSMMPWIAANKIVDKDKN-------------
ILVC_PSEMY       SMTAKRRNNAAHGIEVIGEQLRAMMPWIAANKIVDKTKN-------------
ILVC_PSEPF       SMTAKRRNNAAHGIEIIGEQLRSMMPWIGANKIVDKAKN-------------
ILVC_PSEF5       SMTAKRRNNAAHGIEIIGEQLRSMMPWIGANKIVDKAKN-------------
ILVC_PSEPK       SMTAKRRNNAAHGIEIIGEQLRSMMPWISANKIVDKTKN-------------
ILVC_PSEP1       SMTAKRRNNAAHGIEIIGEQLRSMMPWISANKIVDKTKN-------------
ILVC_PSEPG       SMTAKRRNNAAHGIEIIGEQLRSMMPWISANKIVDKTKN-------------
ILVC_PSEE4       SMTAKRRNNAAHGIEIIGEQLRSMMPWISANKIVDKTKN-------------
ILVC_ALCBS       SMTAARRNNAAHPIEQVGEKLRGMMPWIQANQIVDKTKN-------------
ILVC_MARHV       SMTARRRQNAAHEIETVGEKLRSMMPWISANKIVDKDKN-------------
ILVC_HAHCH       SMTAYRRNNAAHPIEQVGEKLRSMMPWIASNKIVDKSKN-------------
ILVC_SACD2       SMTAWRRNNAAHPIEQVGGKLRAMMPWIESNKIIDKTKN-------------
ILVC_HYDCU       SMTAARRLNEEHGIEVVGRKLRAMMPWIASNKIVDQEKN-------------
ILVC_PSYCK       SMTARRRNNAEHQIEITGAKLRGMMPWIGGNKIIDKDKN-------------
ILVC_PSYA2       SMTARRRNNAEHQIEITGAKLRGMMPWIGGNKIIDKDKN-------------
ILVC_PSYWF       SMTARRRNNADHEIEKTGAKLRSMMPWIGGNKIIDKEKN-------------
ILVC_ACIAD       SMTARRRQNAAHGIEVTGSKLRAMMPWIQANKIVDKEKN-------------
ILVC_THIDA       EMTAWRRNNAAHQIEVVGAKLRSMMPWIAANKLVDHSKN-------------
ILVC_CHRSD       SMHARRRLNAEHPVEQVGEKLRGMMPWIAANQLVDKSKN-------------
ILVC_PRB01       VMKSNREATKIHPIESVGAELRSKMKFLNSQKLVDKEIN-------------
ILVC_ARCB4       RMNAERAYTKASLLEQTGVKLRNMMPWIASKKIVNQETN-------------
ILVC_SULDN       RMNAERANAKASLIEQTGVKLRTMMPWIAANKIVDTSKN-------------
ILVC_NITSB       RMTAERRNCEAHPIEQVGKRLRAMMPWITANKIVDQEKN-------------
ILVC_HELHP       RMNAERKNLANHKIEQVGGRLRAMMPWIGANKLVDKERN-------------
ILVC_WOLSU       RMNAERKNLAAHPIEQTGERLRAMMPWIGANKIIDKNRN-------------
ILVC_CAMC5       RMNAERSIAERSLLNQTGKKLRAMMPWISAGKLVDQNKN-------------
ILVC_CAMC1       RMNAERGIAERSLLNKTGKKLRAMMPWITNGKLIDQSKN-------------
ILVC_CAMFF       KMNAERKISEASLLNKTGEKLRGMMPWINKGRLVNKDKN-------------
ILVC_CAMHC       RMNAERKIADASLLNKTGEKLRAMMPWIKNGKLVDKDKN-------------
ILVC_CAMJ8       RMHAERKNMNDSLIEKTGRNLRAMMPWISAKKLVDKDKN-------------
ILVC_CAMJJ       RMHAERKNMNDSLIEKTGRNLRAMMPWISAKKLVDKDKN-------------
ILVC_CAMJR       RMHAERKNMNDSLIEKTGRNLRAMMPWISAKKLVDKDKN-------------
ILVC_CAMJE       RMHAERKNMNDSLIEKTGRNLRAMMPWISAKKLVDKDKN-------------
ILVC_CAMJD       RMHAERKNMNDSLIEKTGRNLRAMMPWISAKKLVDKDKN-------------
ILVC_MYCSK       ELEDLRKKNAEHPIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCSJ       ELEDLRKKNAEHPIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCSS       ELEDLRKKNAEHPIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCVP       ELEALRKKNAEHPIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCGI       ELEGLRKQNAEHPIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCS2       ELEALRKANAEHPIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_NOCFA       ELEGLRKQNAEHPIEVTGAKLRGLMSWVD---------RPITETA-------
ILVC_RHOJR       ELEGLRKANAEHPIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCPA       QLEQLRKENAEHPIEVVGKRLRDLMSWVD---------RPITETA-------
ILVC_MYCA1       QLEQLRKENAEHPIEVVGKRLRDLMSWVD---------RPITETA-------
ILVC_MYCAV       QLEQLRKENVEHPIEVVGKRLRDLMSWVD---------RPITETA-------
ILVC_MYCUA       QLEALRKENAEHSIEVTGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCLE       QLEVLRKENAEHPIEVTGKKLRDLMSWVD---------RQSTETA-------
ILVC_MYCBP       QLEELRRQNAEHPIEVVGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCTA       QLEELRRQNAEHPIEVVGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCTU       QLEELRRQNAEHPIEVVGKKLRDLMSWVD---------RPITETA-------
ILVC_MYCBO       QLEELRRQNAEHPIEVVGKKLRDLMSWVD---------RPITETA-------
ILVC_CORGL       ELEGLRASYNNHPIEETGAKLRDLMSWVKV--------DARAETA-------
ILVC_CORGB       ELEGLRASYNNHPIEETGAKLRDLMSWVKV--------DARAETA-------
ILVC_COREF       ELEGLRAKYAEHPIEETGAKLRDLMSWVK---------NPLTETA-------
ILVC_CORJK       ELEELRASYNDHQIEKTGAKLRDLMSWVKV--------DARAETA-------
ILVC_CORDI       ELKRYREEIAAHPIEATGSKLRDLMSWVK---------NPLDETA-------
ILVC1_STRCO      KYNEYKKQDSEHLLETTGKELRKLMSWVD------------EEA--------
ILVC2_STRCO      KYNEYKKQDSEHLLETTGKELRKLMSWVD------------EEA--------
ILVC_STRAW       KYNEYKTQDENHLLETTGKELRKLMSWVN------------DEEA-------
ILVC_SALAI       NFAKWRAESAAHPIEETGSKLRGMMSWVD---------RPITETA-------
ILVC_SALTO       NFAKWRAEGAAHPIEETGGRLRAMMSWVD---------RPITETA-------
ILVC_SACEN       NFNKLQDQGNAHQIEEVGKKLRSLMSWTQ---------RP------------
ILVC_FRAAA       NFTKLVEEGKQHPIEQVGAKLRPLMSWIA---------K-------------
ILVC_FRACC       NFTKLVAEGKQHPIEQVGAKLRPMMSWIA-----------------------
ILVC_THEFY       NFLKRREAEQGEQIEKVGTELRSLMSWLK---------N-------------
ILVC_CLAMS       EFLELRKKGEEHPIESTGRELRKLFAWNKA------DDDYTDGSVAR-----
ILVC_CLAM3       EFLELRKKGEEHPIESTGRELRKLFAWNKA------DDDYTDGSVAR-----
ILVC_LEIXX       EFLALRVKGEQHPIEATGRELRKLFAWNASN-----DDDYVDGEVAR-----
ILVC_ARTS2       EFKALRAKAEQHPIESVGRELRGLFSWQQQ------DEDYVEGSAAR-----
ILVC_RENSM       EFKALRAKGEQHPIETTGRELRKLFSWIQN------DDDYTEGSVAR-----
ILVC_KINRD       KFKELRAKAEQHPIEATGRELRKLMAWVKSD-----DSDYVEGSAAR-----
ILVC_CUTAK       QSKKFREGEAKHPIEATGKELRKMYSWLAAA-----DDDYTEGSVAR-----
ILVC_TROW8       EFTQLREIAARHPIEEVGARLRALFSWSK-----------------------
ILVC_TROWT       EFTQLREIAARHPIEEVGARLRALFSWSK-----------------------
ILVC1_BIFLO      HFKELQEKYSNERIETVGPKLRAMFSWNKDGVKDADEANSFTGKIARAQVQ-
ILVC2_BIFLO      KFKKLQEEYSHPHLETVGPKLRAMFSWNNAEAKDKDETESFNGKIARTQVQ-
ILVC_XYLFA       NYKKYKQADLEHPIEKVGKQLRAKMVWLNSE-------KTNDTTPPMSSKVV
ILVC_XYLFT       NYKKYKQADLEHPIEKVGKQLRAKMVWLNSE-------KTNDTTHPMSSKVV
ILVC_XANAC       NYNKFKQADLEHPIEEVGKKLRAKMVWLNGQ-------QQAAAAPANQQAA-
ILVC_XANC5       NYNKFKQADLEHPIEEVGKKLRAKMVWLNGQ-------QQAAAAPANQQAA-
ILVC_XANOM       NYTKFKQADLEHPIEEVGKKLRAKMVWLNGE-------QQAAAAPANQQAA-
ILVC_XANOR       NYTKFKQADLEHPIEEVGKKLRAKMVWLNGE-------QQAAAAPANQQAA-
ILVC_XANCP       NYTKFKQADLEHPIEEVGKKLRAKMVWLNGE-------QQAAATPAKQQAA-
ILVC_XANC8       NYTKFKQADLEHPIEEVGKKLRAKMVWLNGE-------QQAAATPAKQQAA-
ILVC_CHLPM       NLNRLRKENSSHPIETVGAKLRNMMSWLIKK---------------------
ILVC_CHLPD       NLNRLREENRTHSIEKVGARLREMMSWLIKK---------------------
ILVC_CHLCH       NLSKLRESNSNHAIEKVGAKLRNMMSWLIKK---------------------
ILVC_PELLD       NLNRLREENSGHAIEKVGAKLRNMMSWLVRK---------------------
ILVC_CHLTE       KMNELRESNRNHPIEVVGAKLRGMMSWLKKK---------------------
ILVC_SALRD       QLQEERAALTEHPIEQVGQTLRGMMPWLNGDETSADEDAPDAADTAPASSS-
ILVC_NATPD       SYKQLRAAEKNHDIEAVGEDLRALFAWGDD----------------------
ILVC_HALMA       AYKQYRDAEQNHQIEAVGENLRELFAWGEDADAET-------TEAPADD---
ILVC_DESVV       GFKATRRLEAEHQIEKVGGELRGMMPWLKKKV--------------------
ILVC_DESVH       GFKATRRLEAEHQIEKVGGELRGMMPWLKKKV--------------------
ILVC_DESAG       TFTARRRIEAEHPIEEVGARLRSMMPWLKK----------------------
ILVC_RHOBA       FFKATRRRERLHGVEQIGLGLRRMMNWIDEKEV-------------------
ILVC1_BACC1      NFHATNEKENEHEIEVVGRKLREMMPFVQPRVKVGMK---------------
ILVC1_BACCZ      NFHATNEKENEHEIEVVGRKLREMMPFVQPRVKAGVK---------------
ILVC1_BACHK      NFHATNEKENEHEIEVVGRKLREMMPFVQPRVKAGVK---------------
ILVC1_BACAN      NFYATNEKENEHEIEVVGRKLRGMMPFVQPRVKAGVK---------------
ILVC1_BACCR      NFHATNEKENKHEIEVVGRKLREMMPFVQPRVKVGVK---------------
ILVC_BACCN       HFHAINAKENEHQIEVVGRQLREMMPFVKPKVKTGVK---------------
ILVC_OCEIH       QFNAINRRENRHPIETVGRELRELMPFVKQPINAKKKDVNVHVPN-------
ILVC_BACVZ       RFNAINASENEHQIEKVGRQLREMMPFVKQGKKKEAVVSVAQN---------
ILVC_BACSU       RFNAINASENEHQIEVVGRKLREMMPFVKQGKKKEAVVSVAQN---------
ILVC_BACLD       RFNAINASENEHQIEVVGRKLREMMPFVKQGKKKEAVVAGAKN---------
ILVC_BACP2       RFNAINANENEHQIEVVGRKLREMMPFVKQGKKKEAVSVGAEN---------
ILVC_GEOKA       EFNAINRRENEHLIEIVGRELRSMMPFVKAKQVEAVVPGAKN----------
ILVC_GEOTN       EFNAINQRENEHLIEVVGRELRSMMPFVKAKQKEVVVPGAKN----------
ILVC_BACSK       EYNAINEAEKNHPLEVVGRELREMMPFVKASKSKGVVANAKN----------
ILVC_BACHD       EFTAINEREKNHPLEVVGRELREMMPFVKA-KSKGVVGSAKN----------
ILVC2_BACAN      TYNAMKKAEQNHQLEKVGEELREMMSWIHAPKELVKK---------------
ILVC2_BACHK      TYNAMKKAEQNHQLEKVGEELREMMSWIHAPKELVKK---------------
ILVC2_BACCR      TYNAMKKAEQNHQLEKVGAELREMMSWIHAPKELVKK---------------
ILVC2_BACCZ      THNAMKKAEQNHGLEKVGAELREMMSWIHAPKELVKK---------------
ILVC2_BACC1      TYNAMKKAEQNHQLEKVGAELREMMSWIDAPKELVKK---------------
ILVC_CALS4       QYNAIKEREANHPIEKVGKSLREMMPWLSKK---------------------
ILVC_CALS8       EFNSIRRREQNLLIEQVGKELRKMMPWIKPIKE-------------------
ILVC_CLOB8       GFNARRRMEAEHPIEKVGKELRGMMSWIDTAKVD------------------
ILVC_ALKMQ       AFTARRRMEQSHQVEVVGKELRDMMSWSKQSKK-------------------
ILVC_CLONN       KFNAKRRIESEHPIEKVGVELRAMMPWLKEN---------------------
ILVC_CLOAB       AFNARRRIEADREIEKVGKRLRGMMSWINENPSNE-----------------
ILVC_LACP7       NFNAKRRMESEHQLEKVGAELRGLMSWTQKKKLIDN----------------
ILVC_HUNT2       QFLAMRRNEAEHQLEKVGAELRKMMSWLKK----------------------
ILVC_THEMA       YFYTMRKKESEHLIEKVGKELRKMMPWLKERNVDEE----------------
ILVC_THEP1       YFYTMRKKESEHLIEKVGKELRKMMPWLKERNVDEE----------------
ILVC_AQUAE       VYYALLERDREHLVEKVGEELRKMMPWLGKKELK------------------
ILVC_PETMO       VFNALTEKDNNSLLEQVGEKLRAMMPWIES----------------------
ILVC_DESHY       SFNAIERKDAEHPIEKVGAELRAMMPFIKKPGE-------------------
ILVC_DESRM       QFNAVRKMEQEHPIEEVGARLREMMPWLKK----------------------
ILVC_CARHZ       VYNAIKRREQEHLIEKVGAELRQMMPWLKK----------------------
ILVC_SYNWW       RFNALKRQNREHLIEEVGAELRGMMPWLKETK--------------------
ILVC_MOOTA       SFNAFRKKEREHLIEQVGDQLREMMSWLKK----------------------
ILVC_DEHMC       VYNSLRRMESEHLIEEVGAELRSMMSWLKKKR--------------------
ILVC_DEHMB       VYNSLRRMESEHLIEEVGAELRSMMSWLKKKK--------------------
ILVC_DEHM1       VYNSLRRMESEHLIEEVGAELRSMMSWLKKKK--------------------
ILVC_METST       KLLTQRRLEGEKQIEKVGKNLRIACGLQKEE---------------------
ILVC_METS3       NLKEMRAAEDQETIEVVGERLRKACGLQKDD---------------------
ILVC_METTH       MLKRMRKLESELEIEEVGSKLRKLCGLEK-----------------------
ILVC_METM5       HLKAMRRIEGDLQIEEVGAKLRKMCGLEKEE---------------------
ILVC_METM7       HLKAMRRLEGELQIEEVGAKLRKMCGLEKEE---------------------
ILVC_METMP       HLKSMRRLEGDLQIEEVGAKLRKMCGLEKEE---------------------
ILVC_METVS       HLKAMRRLEGELQIEEVGSKLRKMCGLEKDE---------------------
ILVC_METJA       HLNALRRLEKEHLIEKVGKELRKMCGLEKE----------------------
ILVC_PYRIL       TLKKLMESARTHPIEIVGAEMRKLLFGRQQE---------------------
ILVC_PYRAE       TLRKLMEEARTHPIEKVGEEMRKLLFGP------------------------
ILVC_PYRCJ       RLRELMEKAKNHPIEAVGAEMRKLLFGP------------------------
ILVC_PYRAR       TLRKLMEEVKNHQIEKVGIEMRRLLFGQ------------------------
ILVC_PYRAB       VLEELMKPIEEHEIEKVGRFIRKMSGLER-----------------------
ILVC_PYRFU       VLKELMKEIEEHEIEKVGRFIRRMSGLEK-----------------------
ILVC_SULTO       TLVNGMKEVENSLEEQVGRQIREISLRGKPKS--------------------
ILVC_SULAC       TIKEGMKEVDNSTEEKVGRSLRDIILRGKPKS--------------------
ILVC_SACS2       TVVNGLSNVQNSLEEKIGNQLRDLVQKGKPKS--------------------
ILVC_METKA       VMKRLREEIENHEIEKVGERLRKMMGFED-----------------------
ILVC_METAC       VLKAMERQEKEHPLEVVGKEIRANIPWLNKKIDDD-----------------
ILVC_METMA       VLKAMERQEKEHQLEVVGKQIRANIPWLNKKIDDD-----------------
ILVC_METBF       VLKAMERQEKEHQLEVVGKQIRANIPWLNREIDDD-----------------
ILVC_METBU       VLTSMERLEKEHPVEVVGKKLRAMMPWLNSELNEE-----------------
ILVC_METAR       HFNALTQQDAEHPIEIVGKELRSMMPWLKQKK--------------------
ILVC_METTP       VKKALEQQESEHLIEKVGAELRAMMPWLGEKK--------------------
ILVC_ARCFU       VYNKLLQMEREHPIEKIGKELRAMMPWLKKD---------------------
ILVC_METB6       VFNALTKADEEHLLEETGKEVRAMMPQFRK----------------------
ILVC_METLZ       TFTALTRADEEHLIEEVGSELRAMMPQFKKN---------------------
ILVC_METHJ       VFNALTRADEEHLIEEVGKEIRATMPQFKDLK--------------------
ILVC_METMJ       VFNALTRADEEHLIEQVGAEIRGFMPQFRK----------------------
ILVC_KORVE       WFEKKRTDEQEQQLEDVGAQLRDMMTFLNPVKIKQKSEQKEAVAQ-------
ILVC_SORC5       KFEATRAKEREQRLEIVGANLRKMMPFIDPVTIKPGD---------------
ILVC_CHLAA       RFNAYRQADINHPIEQIGRELRRMMPFVNPREVKPGEGGA------------
ILVC_ROSCS       RFNAYRTRDIAHPIEQVGRELRRMMPFVNPREVVPGEGGA------------
ILVC_SOLUE       NFLAMREKGHNDQIEVVGRELREMMTFLK-KKKEVGVPVA------------
ILVC_SYNJA       VLTAMRRREAEHPIEKVGKELRAMFSWLKK----------------------
ILVC_SYNJB       GLTAMRRREAEHPIEQVGRELRAMFSWLKK----------------------
ILVC_NOSS1       GFTAMRRQEAEHPIEEVGKDLRAMFSWLKKV---------------------
ILVC_TRIV2       GFTAMRRQEAEHPIEEVGKDLRAMFSWLKKV---------------------
ILVC_MICAN       GFTAMRRQEAEHSIEEVGQDLRAMMSWLKR----------------------
ILVC_TRIEI       VFTAMRRQEAEHSIEEVGKDLRAMFSWLKKR---------------------
ILVC_SYNY3       GFTAMRRRESEELIEEVGKDLRAMFSWLKDR---------------------
ILVC_ACAM1       GFTATRRRESEHAIEEVGKDLRAMFSWTDKA---------------------
ILVC_THEEB       GFTAMRRREAEHPIEQVGQELRSMFSWLKRA---------------------
ILVC_SYNE7       VMTATRRLEAEHPIESVGKDLRAMFSWLKK----------------------
ILVC_SYNP6       VMTATRRLEAEHPIESVGKDLRAMFSWLKK----------------------
ILVC_GLOVI       SFKAMRRREAEHPIEEVGADLRKMMSWLRP----------------------
ILVC_SYNPW       EMNKIREQDRHHKIEEVGKGLRSMFSWLKAS---------------------
ILVC_SYNR3       EMNKIRERDSAHKIEEVGKGLRAMFSWLKAA---------------------
ILVC_PROM3       EMKKIRDRDAAHPIEQVGKGLRAMFSWLKTA---------------------
ILVC_PROMM       EMKKIRDRDANHPIEQVGKGLRAMFSWLKTA---------------------
ILVC_SYNSC       EMKKVRDRDSQHPIEKVGKGLRSMFSWLKDA---------------------
ILVC_SYNPX       EMKKVRDRDSQHPIEKVGKGLRSMFSWLKDA---------------------
ILVC_SYNS9       EMKKIRDRDAQHPIEKVGKGLRSMFSWLKDA---------------------
ILVC_SYNS3       EMNKVRARDAEHPIEKVGKGLRSMFSWLKAA---------------------
ILVC_PROM1       EMKRIRQKDSELPIEKVGKTLRSMFSWLKSD---------------------
ILVC_PROMT       EMKRIRKKDSELPIEKVGKTLRSMFSWLKSD---------------------
ILVC_PROMA       EMKRIREEDSLLPIEKVGKGLRAMFSWLKTD---------------------
ILVC_PROMS       LMTKLREENSKHEIEKVGKGLRSMFSWLK-----------------------
ILVC_PROM2       LMTKLREENSKHEIEKVGKGLRSMFSWLK-----------------------
ILVC_PROM0       LMTKLREENSKHEIEKVGKSLRSMFSWLK-----------------------
ILVC_PROM9       LMTKLREENSKHEIEKVGKGLRSMFSWLK-----------------------
ILVC_PROM5       LMTKLRAENSQHEIEKVGKGLRAMFSWLK-----------------------
ILVC_PROMP       LMTKLREENSKHEIEKVGKGLRAMFSWLK-----------------------
ILVC_ANADE       TMARYRAAEAAHPIEEVGKRLRDMMSWIREAKKDSSDPGSR-----------
ILVC_THET2       VLEANRKRWAAHPIEEVGSRLRAMMPFLKARVMEEVG---------------
ILVC_THET8       VLEANRKRWAAHPIEEVGSRLRAMMPFLKARVMEEVG---------------
ILVC_RUBXD       SFLAMRRREAEHMVEKVGAELRALAAEGAQSPAGSPAGGESR----------
ILVC_DEIGD       FMKEQRQKMRHHTLEVVGRELRSKMPFISKQELEV-----------------
ILVC_DEIRA       YMNEQRSKMRDHTVEKVGKELRDQMPFINKKELEV-----------------
ILVC_LEPBL       NFKNMRDKNAAHPIESVGKKLRSMMKWLSK----------------------
ILVC_LEPBJ       NFKNMRDKNAAHPIESVGKKLRSMMKWLSK----------------------
ILVC_LEPIC       NFKNMRDKNASHPIESVGKKLRSMMKWLSK----------------------
ILVC_LEPIN       NFKNMRDKNASHPIESVGKKLRSMMKWLSK----------------------
ILVC_CLOD6       NFLKTREEEYNTEIAEVGRNLRSMMSFLK-----------------------
ILVC_TREPR       TLTACRRAVGEHPIEAVGARLRSRMTCAHGT---------------------
ILVC_HELPH       RLNTERKALKETKIEQIGEILRAPFNHKK-----------------------
ILVC_HELPJ       RLNTERKALKETKIEQIGEILRAPFNHKK-----------------------
ILVC_HELPY       RLNTERKALKETKIEQIGEILRAPFNHKK-----------------------
ILVC_HELAH       RLNTERKALKETKIEQVGEILRTPFNHEK-----------------------
ILVC_ECOK1       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECOUT       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECO24       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECOL5       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECOL6       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SHIDS       QLHDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SHIBS       QLRDVNEAIRCHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SHISS       QLRDVNEAIRCHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SHIFL       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECOLC       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECOLI       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECOHS       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_ECO57       QLRDLNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SALCH       QLRDVNDAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SALPB       QLRDVNDAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SALTI       QLRDVNDAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SALPA       QLRDVNDAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SALTY       QLRDVNDAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_SALAR       QLRDVNDAIRSHAIEKVGQKLRGYMTDMKRIAVAG-----------------
ILVC_KLEP7       QLRDVNEAIRSHAIEQVGKKLRGYMTDMKRIAVAG-----------------
ILVC_CITK8       QLRDVNEAIRGHAIEKVGQKLRGYMTDMKRIAVAG-----------------
ILVC_ENT38       QLRDVNEAIRSHAIESVGHTLRGYMKDMKRIAVAG-----------------
ILVC_CROS8       QLRDVNDAIRSHEIEKVGQKLRGYMTDMKRIAVAG-----------------
ILVC_YERP3       QLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG-----------------
ILVC_YERPS       QLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG-----------------
ILVC_YERPA       QLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG-----------------
ILVC_YERPP       QLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG-----------------
ILVC_YERPN       QLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG-----------------
ILVC_YERPE       QLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG-----------------
ILVC_YERE8       QLRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG-----------------
ILVC_SERP5       QLRDVNEAVRNHPIESVGRKLRGYMTDMKRIAVAG-----------------
ILVC_PECAS       QLRDVNEAIRNHPIETVGHTLRGYMKDMKRIAVAG-----------------
ILVC_PHOLL       QLRDVNEAIRHHPIEVVGRVLRGYMTDMKRIAVGG-----------------
ILVC_SODGM       RLRDVNEAIRQHPIEIVGAELRGYMKDMKRIAVAN-----------------
ILVC_AERHH       ALLAANEATRNHPIEKIGQVLRGYMKDMKRIAVGG-----------------
ILVC_AERS4       ALLAANEATRNHPIEKIGQVLRGYMKDMKRIAVGG-----------------
ILVC_HAEIE       TLRDVNDAIRNHPVELIGQELRGYMTDMKRIAVAG-----------------
ILVC_HAEIN       TLRDVNDAIRNHPVELIGQELRGYMTDMKRIAVAG-----------------
ILVC_HAEI8       TLRDVNDAIRNHPVELIGQELRGYMTDMKRIAVAG-----------------
ILVC_HAEIG       TLRAVNDAIRNHPVELIGQELRGYMTDMKRIAVAG-----------------
ILVC_PASMU       TLRDVNDAIRNHPIELIGQELRGYMTDMKRISSH------------------
ILVC_MANSM       YLRDINDTIRNHPVELIGQELRGYMTDMKRISSQG-----------------
ILVC_ACTSZ       TLRDVNDEIRNHPVELIGLELRGYMTDMKRISSQG-----------------
ILVC_ACTP2       YLRDINDAIRNHPVELIGQELRGYMTDMKRISSQG-----------------
ILVC_HISS2       LLRDVNDAIRQHPIELIGQELRGYMTDMKRISSQE-----------------
ILVC_HAES1       LLRDVNDAIRQHPIELIGQELRGYMTDMKRISSQG-----------------
ILVC_VIBVY       TLIAVNETIRNHPVEYIGEELRGYMTDMKRIAVGG-----------------
ILVC_VIBVU       TLIAVNETIRNHPVEYIGEELRGYMTDMKRIAVGG-----------------
ILVC_VIBPA       TLIAVNETIRNHPVEYIGEELRGYMTDMKRIAVGG-----------------
ILVC_ALIF1       TLIAVNDAIRNHPVEYIGEELRSYMSDMKRIAVGG-----------------
ILVC_VIBCH       TLIEVNSIIRNHPVEYIGEELRGYMKDMKRIAVGD-----------------
ILVC_VIBC3       TLIEVNSIIRNHPVEYIGEELRGYMKDMKRIAVGD-----------------
ILVC_PHOPR       TLIVVNETLRSHPVELVGQELRGYMTDMKRIAVGD-----------------
ILVC_SHEON       QLIAINDAIRHTAVEYVGAELRGYMTDMKSIVGA------------------
ILVC_BUCAI       ELYRINQKIQNHPIEIIGCTLRNYMKKMKAITVAK-----------------
ILVC_BUCDN       ELYNVNTMIRNHPIEIIGRKLRSYMKNMKTIIVG------------------
ILVC_BUCAP       ELYKINEEIRNHPIEIVGKKLRKHMKEMKSICVAK-----------------
ILVC_BUCMH       TLYKVNAKIESHPIEIIGKKLRLYMTSMVPIKTK------------------
ILVC_BUCSC       TLNKINHDIENHPVEIIGKKLRKYMVDMKPIKLS------------------
ILVC_BUCBP       DLNYINTTIRNHPVEHIGQKLRRYMTNIKQINCY------------------
ILVC_BLOFL       LLRDINEMIRTHPIEKVGVQLRSYMKDMVSLSF-------------------
                                  *  :*