CLUSTAL format seed alignment for MF_00439

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YCF3_TRIV2      MPRTQ-KNDNFVDKSFTVMADIILKILPTNKKA-KEAFVYYRDG--MSAQAEGEYAEALE
YCF3_NOSS1      MPRTQ-KNDNFVDKSFTVMADIILKILPTNKKA-KEAFVYYRDG--MSAQAEGEYAEALE
YCF3_SYNY3      MPRTQ-RNDNFIDKSFTVMADIILKILPTNQKA-KEAFVYYRDG--MSAQADGEYAEALD
YCF3_LACSA      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_VITVI      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_JASNU      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--ISAQSEGNYAEALQ
YCF3_PANGI      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_DAUCA      MPRSR-INGNFIDKTFSIIANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_HELAN      MSRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_PLALA      MSRSR-TNGNFIDKTFSIVANILLQIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_ACOAM      MPRSR-INANFIDKTSTIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_ACOCL      MPRSR-INANFIDKTSTIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_AMBTC      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_ILLOL      MSRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_LIRTU      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CALFG      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_DIOEL      MPRSQ-INGNFIDKTSSIVANILLRIIPTTSGE-KKAFTYYRDGAIMSAQSEGNYAEALQ
YCF3_PHAAO      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KKAFTYYRDG--MSAQSEGNYAEALQ
YCF3_LEMMI      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CHLSC      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSDGNYAEALQ
YCF3_RANMC      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_BUXMI      MSRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CERDE      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_PLAOC      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_DRIGR      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_IPOPU      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_NANDO      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_ARATH      MPRSR-INGNFIDKTFTIVADILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_BRAJU      MPRSR-INGNFIDKTFTIVADILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_SINAL      MPRSR-INGNFIDKTFTIVADILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_SOLLC      MPRSR-INGNFIDKTFSIVADILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_SOLBU      MPRSR-TNGNFIDKTFSIVANILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_SOLTU      MPRSR-TNGNFIDKTFSIVADILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_NICSY      MPRSR-INGNFIDKTFSIVANILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_TOBAC      MPRSR-INGNFIDKTFSIVANILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_NICTO      MPRSR-INGNFIDKTFSIVANILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_ATRBE      MPRSR-INGNFIDQTFSIVANILLRVIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_POPTR      MPRSR-ITGNLIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_POPAL      MPRSR-ITGNLIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_OENEH      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_EUCGG      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_GOSBA      MPRSQ-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_GOSHI      MPRSQ-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_LOTJA      MPRSR-INGNFIDKTFSVVANILLQIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_PELHO      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-REAFTYYRDG--MSAQSEGNYAEALQ
YCF3_LOLPR      MPRSR-ANGNFIDKTSSIVANILLRIIPTTSGE-KKAFTYYRDG--MLAQSEGNYAEALQ
YCF3_AGRST      MPRSR-ANGNFIDKTSSIVANILLRIIPTTSGE-KKAFTYYRDG--MLAQSEGNYAEALQ
YCF3_WHEAT      MPRSR-VNGNFIDKTSSIVANILLRIIPTTSGE-KKAFTYYRDG--MLAQSEGNYAEALQ
YCF3_HORVU      MPRSR-VNGNFIDKTFSIIANILLRIIPTTSGE-KKAFTYYRDG--MLAQSEGNYAEALQ
YCF3_SACHY      MPRSR-INGNFIDKTFSIVANILLQIIPTTSGE-KRAFTYYRDG--MLAQSEGNYAEALQ
YCF3_MAIZE      MPRSR-INGNFIDKTFSIVANILLQIIPTTSGE-KRAFTYYRDG--MLAQSEGNYAEALQ
YCF3_SACOF      MPRSR-INGNFIDKTSSIVANILLQIIPTTSGE-KRAFTYYRDG--MLAQSEGNYAEALQ
YCF3_SORBI      MPRSR-INGNFIDKTSSIVANILLQIIPTTSGE-KRAFTYYRDGAIMLAQSEGNYAEALQ
YCF3_ORYNI      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KRAFTYYRDG--MLAQSEGNYAEALQ
YCF3_ORYSA      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KRAFTYYRDG--MLAQSEGNYAEALQ
YCF3_ORYSI      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KRAFTYYRDG--MLAQSEGNYAEALQ
YCF3_ORYSJ      MPRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KRAFTYYRDG--MLAQSEGNYAEALQ
YCF3_NUPAD      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_NYMAL      MPRSR-INGNFIDKTSSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_PHAVU      MPRSR-INENFIDKTFSIVANILLRIIPTTSGE-KRAFTYYRDG--MSAQSEGNYAEALQ
YCF3_SOYBN      MPRSR-INENFIDKTFSIVANILLRIIPTTSGE-KRAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CITSI      MPRSR-INGNFIDKTFSIVANILLRIIPTTVGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CUCSA      MPRSGGINGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_COFAR      MPRSQ-INGNFIDKTFSIVANILLRIIPTTSGE-REAFTYYRDG--MSAQSEGNYAEALQ
YCF3_PIPCE      MPRSQ-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CUSEX      MSRSR-INGNFLDKTFSIVANILLRIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CUSRE      MPRSR-INGNFLDKTFSIVANILLRIIPTTSGE-KEAFTYYRDR--MSAQSEGNYAEALQ
YCF3_MORIN      MSRSR-INGNFIDKTFSIVANILLRIIPTTSGE-KEAFAYYRDG--MSAQSEGNYAEALQ
YCF3_SPIOL      --MSR--NGNFIDKTFSVVANILLQIIPTTSGE-KEAFTYYRDG--MSAQSEGNYAEALQ
YCF3_CUSGR      MPISQ-KNQNFIDRTFSIIANILLRIIPTTSGE-KEAFAYYING--MSAQSEGNYAEALQ
YCF3_CUSOB      MPISQ-KNQNFIDRTFSIIANILLRIIPTTSGE-KEAFAYYING--MSAQSEGNYAEALQ
YCF3_PINKO      MPRSQ-RNDNFIDKTFTIIADILLRIIPMAPGE-KEAFTYYRDG--MSAQSEGEYAEALQ
YCF3_PINTH      MPRSQ-RNDNFIDKTFTIVADILLRIIPMAPGE-KEAFTYYRDG--MSAQSEGEYAEALQ
YCF3_GNEPA      MPKSQ-KNENFLDKTFTILANIILRIVPMAPTE-KKAFAYYRDG--MSAQSEGEYAEALQ
YCF3_CYCTA      MPRSQ-RNDNFTDKTFTIVADILLRIIPTAPGE-KEAFTYYRDGV-MSAQSEGEYAEALQ
YCF3_ADICA      MPRSQ-RNDNFIDKTFTILADILIRILPTTKRE-REAFIYYRDG--MSAQSEGEYAEALG
YCF3_ANGEV      MPRSQ-RNDNFIDKTFTIVADILLRVIPTTQRE-KEAFTYYRDG--MSAQSEGEYAEALQ
YCF3_ZYGCR      MPRSQ-RNDNFIDKTFTIVADILLRVIPTTQRE-KEAFTYYRDG--MSAQSEGEYAEALQ
YCF3_PSINU      MPRSQ-RNDNFIDKTFTIAADILLRVIPTTRRE-KEAFTYYRDG--MSAQSEGEYAEALQ
YCF3_HUPLU      MPRSQ-RNDNFIDKTFTLVADTSLQVIPTTQGE-KKAFTYYRDG--MSAQSEGEYAEASQ
YCF3_ANTAG      MPRSQ-KNDNFIDKTFTIIADILLQIIPTTQRE-KEAFTHYRDG--MSAQSEGEYAEALQ
YCF3_PHYPA      MPRSQ-KNDNFIDKTFTIVADILLRIIPTTQRE-KEAFTYYRDG--MSAQSEGEYAEALQ
YCF3_CHAVU      MPRSQ-KNDNFIDKTFTIIADILLRIVPTSQRE-REAFTYYRDG--MSAQAEGEYAEALQ
YCF3_MARPO      MPRSQ-KNDNFIDKTFTIVADILLRIIPTTQRE-KEAFTYYRDG--MSAQSEGEYAEALQ
YCF3_CHAGL      MPRSQ-RNDNFIDKTFTVVADILLRVIPTTRRE-KEAFSYYRDG--MSAQSEGEYAEALQ
YCF3_STAPU      MPRSQ-RNDNFIDKTFTIVADILLRIIPTTQRE-KEAFTYYRDG--MSAQSEGEYAEALL
YCF3_CHLAT      MPRSQ-RNDNFIDKTFTVVADILLKILPTTGRE-KEAFAYYRDG--MSAQAEGEYAEALQ
YCF3_MESVI      MPRSQ-KNDNFIDKTFTVVADIILKVLPTTVRE-KAAFSYYRDG--MSAQAEGEYAEALQ
YCF3_CHLRE      MPRTQ-RNDNFIDKTFTVVADILLKVLPTSQRE-KQAFSYYRNG--MSAQAEGEYAEALQ
YCF3_TETOB      MPRSQ-RNDNFIDKTFTVIADILLKVLPTSQRE-KQAFTYYRDG--MSAQAEGEYAEALQ
YCF3_STIHE      MPRSQ-RNDNFIDKTFTVVADILLKVLPTSQRE-KRAFAYYRDG--MSAQSEGEYAEALQ
YCF3_PLETE      MPRSQ-RNDNFIDKTFTVIADILLKVLPTSNRE-KQAFTYYREG--MSAQSEGEYAEALQ
YCF3_CHLVU      MPRSQ-RNDNFIDKTFTVIADILLKILPTSNKE-KQAFSYYRDG--MSAQSEGEYAEALQ
YCF3_OLTVI      MPRSQ-RNDNFIDKTFTVVADILVKVLPTSNRE-KQAFTYYRDG--MAAQAEGEYAEALQ
YCF3_TUPAK      MPRSQ-KNDNFIDKTFTVVADILIKVLPTSNRE-KQAFTYYRDG--MSAQAEGEYAEALQ
YCF3_BIGNA      MPRSQ-KNDNFIDKTFTVVADILLKVLPTSIDE-KRAFTYYRNG--MSAQSEGEYAEALQ
YCF3_NEPOL      MPRSQ-RNDNFIDKTFTVVADILLKVLPTTRRE-KEAFTYYRDG--MSAQAEGEYAEALQ
YCF3_OSTTA      MPRSQ-KNDNFIDKTFTVVADILLKVLPTTRNE-KEAFVYYRDG--MSAQAEGEYAEALQ
YCF3_CYAPA      MPRSQ-RNDNFIDKTFTVIADLILKILPVSKKT-KEAFAYYRDG--MSAQSEGAYAEALE
YCF3_RHDSA      MPRFQ-KNDNFIDKTFTVLADIVLKVLPASKQE-KEAFSYYRDG--MSAQSEGEYAEALE
YCF3_GUITH      MPRFQ-KNDNFIDKTFTVLADLVLKILPATKQE-KEAFSYYRDG--MSAQSEGEYAEALE
YCF3_EMIHU      MS--Q-KNDNFIDKTFTVLADILLKVLPATKEE-KKAFSYYRYG--MSAQSSGDYAEALE
YCF3_PHATC      -------MGNFIDKTFTVIADILLKVLPASKQE-KEAFSYYRAG--MSAQSKGRYAEALQ
YCF3_TRICV      -------MSNFIDKTFTVIADILLKVLPASKQE-KQAFSYYRAG--MSAQSEGKYAEALE
YCF3_THAPS      ----M-GVRNFIDRVFTVISDLILKLLPASKQE-KQAFAYYKAG--MAAQAEGDYAEALE
YCF3_PORPU      MPRSQ-KNDNFIDKTFTVLADIVLKILPTSKEE-KEAFSYYRDG--MSAQSEGEYAEALE
YCF3_PYRYE      MPRSQ-KNDNFIDKTFTVLADIVLKILPTSKEE-KEAFSYYRDG--MSAQSEGEYAEALE
YCF3_GRATL      MPRLQ-KNDNFIDKTFTVLADIILKILPTTKEE-KQAFCYYRDG--MSAQSEGEYAEALE
YCF3_CYAM1      MSRSQ-KNDNFIDKTFTILADVLVKLLPTSQNA-KKAFSYYREG--MAAQAEGEYAQALE
YCF3_CYACA      MPRSQ-KNDNFIDKTFSIIADLIVKILPTNKES-KEAFYYYKDG--MAAQSEGEYAEALA
YCF3_GALSU      MSRSQ-KNDNFIDKTFTILADLILKFLPTNINA-KKAFSYYRDG--MSAQSEGEYAEALA
YCF3_SYNJB      MPRSM-KNDNFIDKTFTVMADLILKLLPGVSSEQKKAFAYYRDG--MAAQSEGEYAEALE
YCF3_SYNJA      MPRSM-KNDNFIDKTFTVMADLILKLMPGVSPEQKKAFAYYRDG--MAAQSEGEYAEALE
YCF3_TRIEI      MPRTQ-RNDNFIDKSFTVMADLILKLLPTNNQA-KEAFAYYRDG--MSAQADGEYAEALE
YCF3_THEEB      MPRSQ-RNDNFIDKTFTVMADLILKVLPTSSQS-KTAFAYYRDG--MSAQADGEYAEALE
YCF3_GLOVI      MPRNQ-RNDNFIDKSFTVMADMILQMMPVKRQA-KEAFAYYRDG--MAAQADGDYAEALE
YCF3_SYNP6      MPRTQ-RNDNFIDKSFTVMADLILKVLPTNKKS-KEAFAYYRDG--MSAQADGEYAEALE
YCF3_SYNE7      MPRTQ-RNDNFIDKSFTVMADLILKVLPTNKKS-KEAFAYYRDG--MSAQADGEYAEALE
YCF3_SYNR3      MPRSQ-RNDNFIDKSFTVMADLILKVLPTNQKA-KEAFAYYRDG--MSAQGDGEYAEALE
YCF3_PROM2      MPSNQ-NRDNFIDKAFTVIAESIVKIMPIAEKE-KKAYIYYRDG--LAAQNNGDYSEALE
YCF3_PROM0      MPSNQ-NRDNFIDKAFTVIAESIVKIMPIAEKE-KKAYIYYRDG--LAAQNNGDYSEALE
YCF3_PROMS      MPSNQ-NRDNFIDKAFTVIAESIVKIMPIAEKE-KKAYIYYRDG--LAAQNNGDYSEALE
YCF3_PROM9      MPSNQ-NRDNFIDKAFTVIAESIVKIMPIEEKE-KKAYIYYRDG--LAAQNNGDYSEALE
YCF3_PROM5      MPNNQ-NRDNFIDKAFTVIAESIVKIMPIADKE-KKAYIYYRDG--LAAQNNGDYSEALE
YCF3_PROMP      MPNNQ-NRDNFIDKAFTVIAESIVKIMPIADKE-KKAYIYYRDG--LAAQNNGDYSEALD
YCF3_PROMT      MPRSQ-NKDNFLDKAFTKMAEGIVKVMPIDSKE-KEAYLYYRKG--LAAQNDGDYSEALE
YCF3_PROM1      MPRSQ-NKDNFLDKAFTKMAEGIVKVMPIDSKE-KEAYLYYRKG--LAAQNDGDYSEALE
YCF3_PROMA      MPSSN-NKDNFLDKAFTVIAEGIVKMMPIAAKE-KQAYIYYREG--FAAQNNGDYSEALE
YCF3_SYNS9      MPRSN-RNDNFIDKSFTVMADLIVKLLPINARS-KEAYVYYRDG--LSAQNDGDYAEALE
YCF3_SYNPX      MPRSN-RNDNFIDKSFTVMADLIVKLLPINARS-KEAYVYYRDG--LSAQNDGDYAEALE
YCF3_SYNSC      MPRSN-RNDNFIDKSFTVMADLIVKLLPINARS-KEAYVYYRDG--LSAQNDGDYAEALE
YCF3_SYNS3      MPRSN-RNDNFIDKSFTVMADLIVKLLPINARA-KEAYVYYRDG--LSAQNDGDYAEALE
YCF3_SYNPW      MPRSN-RNDNFIDKSFTVMADLIVKLLPINARA-KEAYVYYRDG--LSAQNDGDYAEALE
YCF3_PROM3      MPRTQ-NKDNFIDKTFTVMADLIVKMMPINDKA-KRAYVYYRDG--LSAQNAGDYAEALE
YCF3_PROMM      MPRTQ-NKDNFIDKTFTVMADLIVKMMPINDKA-KRAYVYYRDG--LSAQNAGDYAEALE
                         *: *:  :  ::  ::.:*      : *: :*     : **  * *::*  

YCF3_TRIV2      YYEEALTLEEDTNDRGYILYNMGLIYASNGDHDKALELYHQAIELNPRLPQALNNIAVIY
YCF3_NOSS1      YYEEALTLEEDTNDRGYILYNMGLIYASNGDHDKALELYHQAIELNPRLPQALNNIAVIY
YCF3_SYNY3      NYEEALRLEENPNDRSYILYNMALIHASNGDHEKALGLYQEAIELNPKMPSALNNIAVIY
YCF3_LACSA      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_VITVI      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_JASNU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNSFLPQAFNNMAVIC
YCF3_PANGI      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_DAUCA      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_HELAN      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_PLALA      NYYEAMRLEMDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ACOAM      NYYEATRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ACOCL      NYYEATRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_AMBTC      NYYEATRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQASNNMAVIC
YCF3_ILLOL      NYYEATRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_LIRTU      NYYEATRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_CALFG      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRAIERNPFLPQAFNNMAVIC
YCF3_DIOEL      NYYEATRSEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFQAIERNPFLPQAFNNMAVIC
YCF3_PHAAO      NYYEATRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_LEMMI      NYYEATRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_CHLSC      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_RANMC      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_BUXMI      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYSRALERNPFLPQAFNNMAVIC
YCF3_CERDE      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_PLAOC      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_DRIGR      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_IPOPU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQACNNMAVIC
YCF3_NANDO      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ARATH      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_BRAJU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SINAL      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SOLLC      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SOLBU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SOLTU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_NICSY      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_TOBAC      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_NICTO      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ATRBE      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_POPTR      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_POPAL      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_OENEH      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_EUCGG      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_GOSBA      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_GOSHI      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_LOTJA      NYYEAMRLEVDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_PELHO      NYYEAMRLEMDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQALNNMAVIC
YCF3_LOLPR      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_AGRST      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_WHEAT      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_HORVU      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SACHY      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_MAIZE      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SACOF      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SORBI      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ORYNI      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ORYSA      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ORYSI      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_ORYSJ      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_NUPAD      NYYEAMRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQASNNMAVIC
YCF3_NYMAL      NYYEAMRPEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQASNNMAVIC
YCF3_PHAVU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SOYBN      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_CITSI      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_CUCSA      NYYEAMRLEIDPYDRSYILYNIGLIHTRNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_COFAR      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_PIPCE      NYYEATRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_CUSEX      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHMKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_CUSRE      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHMKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_MORIN      NYYEAMRLEIDPYDRSYILYNIGLIHTRNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_SPIOL      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHTKALEYYFRALERNPFLPQAFNNMAVIC
YCF3_CUSGR      NYYQAMHLEMDPYDRSYILYNIGIIHTSNGEHSKALEYYCRAIERNPFLPQAFNNMAVIC
YCF3_CUSOB      NYYQAMHLEMDPYDRSYILYNIGIIHTSNGEHSKALEYYCRAIERNPFLPQAFNNMAVIC
YCF3_PINKO      NYYEAMRLETDPYDRSYILYNIGLVHTSNGEHTKALEYYFQALERNPSLPQALNNTALIC
YCF3_PINTH      NYYEAMRLETDPYDRSYILYNIGLVHTSNGEHTKALEYYFQALERNPSLPQALNNTALIC
YCF3_GNEPA      NYYEAMRLEIDPYDRSYILYNIGLVHTSNGEHAKALEYYFQALERNPILPQALNNTALIC
YCF3_CYCTA      NYYEAMRPEIDPYDRSYILYNIGLIHMSNGEHTEALEYYFQALKRNPSLPQAFNNMAVIC
YCF3_ADICA      SYYKAMRLEIDSYDRSYILYNIGLIHTSNGNHAKALEYYFQALERNSFLPQAFNNMAVIC
YCF3_ANGEV      NYYKAMRLEIDPYDRSYILYNIGLIHTSNGEHAKALEYYSQALERNPSLPQAFNNMAVIC
YCF3_ZYGCR      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHAKAIEYYLQALERNPSLPQAFNNMAVIC
YCF3_PSINU      NYYKAMRLEIDPYDRSYILYNIGLIHTSNGEHAKALEYYFQALERNPSLPQAFNNMAVIC
YCF3_HUPLU      NYYEAMRLEIDPYDRSYILHNIGLIHTSNGEHARALEYYFQALERNPSLPQAFNNMAVIC
YCF3_ANTAG      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHAKALEYYFQALERNSSLPQALNNMAVIC
YCF3_PHYPA      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHAKALEYYFQALERNPSLPQAFNNMAVIC
YCF3_CHAVU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHAKALEYYFQALERNPSLPQAFNNVAVIC
YCF3_MARPO      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHAKALEYYFQALERNPSLPQAFNNMAVIC
YCF3_CHAGL      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGQHTKALEYYLQALERNPALPQAFNNMAVIC
YCF3_STAPU      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHVKALEYYFQALERNPSLPQALNNMAVIC
YCF3_CHLAT      NYYEAMRLEVDAYDRSYILYNIGLIHTSNGEHAKALEYYYQAIERNPSLPQALNNIAVIY
YCF3_MESVI      NYYEAMRLEIDPYDRSYILYNIGLIHTSNGEHGKALEYYYQAIERNPSLPQALNNIAVIY
YCF3_CHLRE      NYYEAMRLEVDAYDRSYILYNIGLIHTSNGEHGRALEYYYQALERNPSLSSALNNIAVIY
YCF3_TETOB      NYYEAMRLEVDAYDRSYILYNIGLIHTSNGEHGRALEYYYQALERNPSLPSALNNIAVIY
YCF3_STIHE      NYYEAMRLEVDAYDRSYILYNIGLIHTSNGEHARALEYYYQALERNPSLPSALNNIAVIY
YCF3_PLETE      NYYEAMRLEVDAYDRSYIFYNIGLIHTSNGEHARALEYYYQALERNPSLPQALNNIAVIY
YCF3_CHLVU      NYYEALRLETDAYDRSYILYNIGLIHTSNGDHARALDYYYQALERNPSLPQALNNIAVIY
YCF3_OLTVI      NYYQALRLEIDPYDRSYILYNIGLIYTCNGEHGRALEYYYQALERNPSLPQALNNIAVIY
YCF3_TUPAK      NYYQALKLEIDPYDRSYILYNIGLIHTSNGKHGRALEYYYQALKRNPSLPQALNNIAVIY
YCF3_BIGNA      NYYQALRYEIDAYDRSYMLYNIGLIHSSNGQQSKALEYYYQALDRNPRLSQALNNIATIY
YCF3_NEPOL      NYYEAMRLEVDAYDRSYILYNIGLIHTSNGEHAKALEYYYQALERNPYLPQALNNIAVIY
YCF3_OSTTA      NYAQAMRLEVDPYDRSFIFYNIGLIHTSNGEHTKALEYYYQALDRNPSLPQALNNIAVIY
YCF3_CYAPA      NYYEALRLEEDPYDKSYTFYNIALIHTSNGDQTKALEYYRQALDLNPKMPQALNNMAVIY
YCF3_RHDSA      NYYEALRLEEDPYDRSYILYNIGLIYASNGEYIKALEYYHQALDLNSRLPPALNNIAVIY
YCF3_GUITH      NYYEALRLEEDPYDRSYILYNIGLIYASNGEYVKALEYYHQALDLNSQLPAALNNIAVIY
YCF3_EMIHU      NYYEALKLEEDPFDRSYILYNIGLIYGNNGDYSKSLDYYHQALDLNSRLPQALNNIAVIY
YCF3_PHATC      NYYEALQVEEDPYDRSYTLYNIGLIYGNTGKYTQALEFYHQALSLNANLPQALNNIAVIY
YCF3_TRICV      NYYEALQLEEDPYDRSYTLYNIGLIYGNNGNYSQALEYYHQALELNSNLPQALNNIAVIY
YCF3_THAPS      NYYESLYLDEDQYDRSYTLYNIGLIYAKNENYPRALEYYHQAVSLNSNLPQALNNIAAIY
YCF3_PORPU      NYYEALKLEEDPYDRSYILYNIGLIYASNGEYIKALEYYHQGLELNFKLPQALNNIAVIY
YCF3_PYRYE      NYYEALKLEEDPYDRSYILYNIGLIYASNGEYVKALEYYHQGLELNFKLPQALNNIAVIY
YCF3_GRATL      NYYEALRLEEDPYDRSYIIYNIGLIYASNGEHIKALEYYHQSLELNPRLPQAFNNIAIIY
YCF3_CYAM1      SYYHALEFEEDVIDRSYIIYNIGLIYASNGEDEQALEYYHQALELNPRLVQALNNIAVIY
YCF3_CYACA      CYYQALKIEKDPMDKSFILYNIGLIQASNGQHARALEYYHESLKFNPNLVQALNNIAVIY
YCF3_GALSU      NYYEALNLEEDPYDKSFILYNIGLIHASNGEYVKALDYYHKALEANNKLPQALNNIAVIY
YCF3_SYNJB      NYREALALEQGEEDRSYILYNMGLIYQSNGELDKALEYYHQALELNPRLCSALNNIAVLL
YCF3_SYNJA      NYREALALEQDDEDRSYILYNMGLIYQSNGELDKALEYYHQALELNPRLCSALNNIAVLL
YCF3_TRIEI      NYYEALNLEDDPNDRSYILYNIGLIHASNGEHDQALEYYHQALENNPRMPQALNNIAVIF
YCF3_THEEB      NYQAALELEEDPTDRSYILYNIGLIHASNGEHEKALEYYHQALELNPRMPQALNNIAVIY
YCF3_GLOVI      YYNEALKLEEDAYDRSFIHYNIGLIHAANGAHDVALDYYDKALEENPRLPQALNNIAVIH
YCF3_SYNP6      NYQEALTLEEDPIDRSFILYNIALVHTSNGDHQTALDHYLQALDLNPKMPQALNNIAVIH
YCF3_SYNE7      NYQEALTLEEDPIDRSFILYNIALVHTSNGDHQTALDHYLQALDLNPKMPQALNNIAVIH
YCF3_SYNR3      NYQEALRLEEDPNDRAFILYNMALVYASNGEHNRALEQYEQALALNAKMPQVLNNMAVIH
YCF3_PROM2      YYKESLLLEENKIDRGETLKNMAIIYMSNGEEDLSIETYEKALVENPKQPSCLKNIGLIY
YCF3_PROM0      YYKESLLLEENKIDRGETLKNMAIIYMSNGEEDLSIETYEKALVENPKQPSCLKNIGLIY
YCF3_PROMS      YYKESLLLEENKIDRGETLKNMAIIYMSNGEEDLSIETYEKALEENPKQPSCLKNIGLIY
YCF3_PROM9      YYKESLLLEENKIDRGETLKNMAIIFMSNGEEDLSIETYEKALVENPKQPSCLKNIGLIY
YCF3_PROM5      YYKESLLLEENKIDRGETLKNMAIIYMSNGEEDLSIETYQKALVENPKQPSCLKNIGLIY
YCF3_PROMP      YYNESLLLEENKIDRGETLKNMAIIYMSNGEEDRSIETYQKALEENPKQPSCLKNIGLIY
YCF3_PROMT      YYEESLKLEDNQVDRGETLKNMAIIYMSNGDEERAINTYKKALGQNPKQPSCLKNMGLIY
YCF3_PROM1      YYEESLKLEDNQVDRGETLKNMAIIYMSNGDEERALNTYKKALGQNPKQPSCLKNMGLIY
YCF3_PROMA      NYEESLKLEENAIDRGETLKNMAIIYMSNGDEDKALDTYQKALEQNPKQPSCLKNMGLIY
YCF3_SYNS9      NYDEALKLETDPTDRGETLKNMAIIYMSNGEEERAIETYQKALDENPKQPSCLKNMGLIF
YCF3_SYNPX      NYDEALKLEDNPTDRGETLKNMAIIYMSNGEEERAIETYRRALDENSNQPSCLKNMGLIF
YCF3_SYNSC      NYEEALKLEENSTDRSETLKNMAIIYMSNGEEERAIETYRKALEENPNQPSCLKNMGLIY
YCF3_SYNS3      NYEESLKLEENAIDRGETLKNIAIIYMSNGEEERALETYQKALDENPKQPSCLKNMGLIY
YCF3_SYNPW      NYEESLKLEENPIDRGETLKNMAIIYMSNGEEDRALATYQKALDENPKQPSCLKNMGLIF
YCF3_PROM3      NYEESLKLEESPFDRSETLKNMAIIYMSNGDEDLALDTYQRALDQNSNQPSCLKNMGLIY
YCF3_PROMM      NYEESLKLEESPFDRSETLKNMAIIYMSNGDEDLALDTYQRALDQNSNQPSCLKNMGLIY
                 *  :   : .  *:.    *:.::   .     ::  * ..:  *       :* . : 

YCF3_TRIV2      HYKGEKAKEDGD---------------HDGGEALFDQAADYWIRAIRMAPNNYIEAQNWL
YCF3_NOSS1      HYQGEKAKETGD---------------HDGGEALFDQAADYWIRAIRMAPNNYIEAQNWL
YCF3_SYNY3      HFQGEKAKEAGQ---------------EDDAENLFDKAAEYWKQAIRLAPNNYIEAQNWL
YCF3_LACSA      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_VITVI      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_JASNU      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_PANGI      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAMALTPGNYIEAHNWL
YCF3_DAUCA      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_HELAN      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_PLALA      HYRGEQAVREGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_ACOAM      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_ACOCL      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_AMBTC      HYRGEQAIRQGD---------------SEIAETWSDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_ILLOL      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_LIRTU      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_CALFG      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_DIOEL      HYQGERAILRGD---------------SEIAEAWFDQAAEYWKQAIGLTPGNYIEAHNWL
YCF3_PHAAO      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_LEMMI      HYRGEQAILQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_CHLSC      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_RANMC      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_BUXMI      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_CERDE      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_PLAOC      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_DRIGR      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_IPOPU      HYRGEQAIQQGD---------------SELAETWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_NANDO      HYRGEQAIQQGD---------------SEIAESWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_ARATH      HYRGEQAIQQGD---------------SEMAEAWFAQAAEYWKQAITLTPGNYIEAQNWL
YCF3_BRAJU      HYRGEQAIQQGD---------------SEMAEAWFAQAAEYWKQAITLTPGNYIEAQNWL
YCF3_SINAL      HYRGEQAIQQGD---------------SEMAEAWFAQAAEYWKQAITLTPGNYIEAQNWL
YCF3_SOLLC      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEARNWL
YCF3_SOLBU      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_SOLTU      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_NICSY      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_TOBAC      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_NICTO      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_ATRBE      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAHNWL
YCF3_POPTR      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_POPAL      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_OENEH      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_EUCGG      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_GOSBA      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_GOSHI      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_LOTJA      HYRGEQAIRQGD---------------SEIAESWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_PELHO      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_LOLPR      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_AGRST      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_WHEAT      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_HORVU      HYRGEQAILEGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_SACHY      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_MAIZE      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_SACOF      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_SORBI      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_ORYNI      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_ORYSA      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_ORYSI      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_ORYSJ      HYRGEQAILQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_NUPAD      HYRGEEAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_NYMAL      HYRGEEAIRQGD---------------SEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWL
YCF3_PHAVU      HYRGEQAIRQGD---------------SEVAESWFNQAAEYWKQAIALTPGNYIAAQNWL
YCF3_SOYBN      HYRGEQAIRQGD---------------SEVAESWFNQAAEYWKQAIALTPGNYIEAQNWL
YCF3_CITSI      HYRGEQAVRQGD---------------SEIAEAWFNQAAEYWKQAIALTPGNYIQAQNWL
YCF3_CUCSA      HYRGEQAIRQGD---------------SEIAEAWFNQAAEYWKQAIALTPGNYIEAQNWL
YCF3_COFAR      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQAISLTPGNYIEAHNWL
YCF3_PIPCE      HYRGEQAIRQGD---------------SEIAEAWSDQAAEYWKQAISLTPGNYIEAHNWL
YCF3_CUSEX      HYRGEKAIQQGD---------------SEIAEAWFDQAAEYWKQALALTPGNYIEAHNWL
YCF3_CUSRE      HYRGEQAIQQGD---------------SEIAGAWFDQAAEYWKQALALTPGNYIEAHNWL
YCF3_MORIN      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQALALTPGNYIEAQNWL
YCF3_SPIOL      HYRGEQAIRQGD---------------SEIAEAWFDQAAEYWKQALTLTPGNYIEAHNWL
YCF3_CUSGR      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQARTLTPGNYIEAQNWL
YCF3_CUSOB      HYRGEQAIQQGD---------------SEIAEAWFDQAAEYWKQARTLTPDNYIEAQNWL
YCF3_PINKO      HYRGEQAIRQGD---------------PETAEAWFDQAAEYWEQAIALAPGNYIEAQNWL
YCF3_PINTH      HYRGEQAIRQGD---------------PETAEAWFDQAAEYWEQAIALAPGNYIEAQNWL
YCF3_GNEPA      HYRGEQAIQQGD---------------PETAEVWFDQAAEYWKQAIMLAPGNYIEAQNWL
YCF3_CYCTA      HYRGEQAIRQGD---------------PETAEAWSDRAAEYWKQAIALAPGNYIEAQNWL
YCF3_ADICA      HYRGEQAIYQGD---------------LEISEAWFDQAAEYWRRAIALSPDNYAEAQNWL
YCF3_ANGEV      HYRGEQAIQQGD---------------PETSEAWFDQAAEYWKQAIALAPSNYIEAQNWL
YCF3_ZYGCR      HYRGEQAVEKED---------------LETSEAWFDQAADYWKQAIALAPNNYIEAQNWL
YCF3_PSINU      HYRGEQAIQQGD---------------PGTSEIWFDKAAEYWKQAIALAPNNYIEAQNWL
YCF3_HUPLU      HYRGEQAIQQGD---------------FETSEAWFGKAADHWKQAVLLAPGNYIEAQNWL
YCF3_ANTAG      HYRGEQAIEEGD---------------PETCEVWFDQAADYWKKAISLAPSNYIEAQNWL
YCF3_PHYPA      HYRGEQAIQQGD---------------SETSEAWFNQAADYWKQAIALAPSNYIEAQNWL
YCF3_CHAVU      HYRGEQAIQQQD---------------IESSKAWFNQAAEYWKQAIQLAPGNYIEAQNWL
YCF3_MARPO      HYRGEQAIQQGD---------------PEASETWFDQAAEYWKQAILLAPSNYIEAHNWL
YCF3_CHAGL      HYRGEQAIQQGD---------------PENAEAWFDQAADYWKQGIALAPSNYIEAQNWL
YCF3_STAPU      HYRGEQAIEQGD---------------SENSEIWFDQAASYWKQAIALAPNNYIEAENWL
YCF3_CHLAT      HYRGEQAIEEGN---------------SEAAEILFDQAASYWKQAIRLAPTSYIEAQNWL
YCF3_MESVI      HYRGEQAIEEGN---------------IATSEILFNQAASYWKQAIRLAPNSYIEAQNWL
YCF3_CHLRE      HYRGEQAIENGQ---------------SEISQILFEKAADYWKEAIRLAPTNYIEALNWL
YCF3_TETOB      HYRGEQAIENGQ---------------SEISQILFEKAADYWKEAIRLAPTNYIEAQNWL
YCF3_STIHE      HYRGEQAIEKGQ---------------AEISSLLFDKAADYWKEAIRLAPTNYIEAQNWL
YCF3_PLETE      HYRGEQAIENGQ---------------AEISKMLFDKAADYWKEAIRLAPTNYIEAQNWL
YCF3_CHLVU      HYRGEQALESSQ---------------TEISKLLFDKAADYWREAIRLAPTNYIEAQNWL
YCF3_OLTVI      HYRGEQAIERGQ---------------SEISKLLFDKAADYWKEAIRLAPTNYLEAQSWL
YCF3_TUPAK      HYRAEQATEKYQ---------------SEVAKILYNKAADYWNEAIRLTPTNYLEAQSWL
YCF3_BIGNA      HYRGEQALINNQ---------------DEISKIFFDKAADYWKEAIRLSPTSYTKAKNWL
YCF3_NEPOL      HYRGEQAIESGN---------------SRISNLLFDKAADYWKEAIRLAPTNYIEAQNWL
YCF3_OSTTA      HYRGEQALAAGN---------------IPDSETLFEKAAEYWKEAIRLAPLNYSEAQNWL
YCF3_CYAPA      HAQGEQAAEQGD---------------MEMAEALFDQAAFYWKQAIRLAPDNYIEAQNWL
YCF3_RHDSA      HYQGVKASEKKD---------------LETARTMFDKAAEYWKQAIRLAPNNYIEAQNWL
YCF3_GUITH      HYQGVKASEKKE---------------LDLARTLFDKAAEYWKQAIRLSPNNYIEAQNWL
YCF3_EMIHU      HYQGTKSSEKKE---------------FEVAQNNFDKAASYWKKAIRLAPNNYIEAQNWL
YCF3_PHATC      HSQALRAQSLEE------------DEYIELSKELFDKAAEYWIQALKLAPDNYPGARNWL
YCF3_TRICV      HSQGLNALQMQNQDKNLEIR---NDEYLELAKEFFDKAAEYWRQALKLAPDNYPGAQNWL
YCF3_THAPS      HRQGLLALEMASQDYDAEMEISEEYEYIELAKGLFDKAAEYWYQALKLAPDNYPRARNWL
YCF3_PORPU      HYQGVQAVEEKN---------------IELSKLMFDKAAQYWQQAIKLAPDNYIEAQNWL
YCF3_PYRYE      HYQGVQAIEDKD---------------TELSKLMFDKAAQYWQQAIKLAPDNYIEAQNWL
YCF3_GRATL      HYQGLKAADKQD---------------NNMSKSMFDKAAEYWKQAIYLAPNNYIEAQNWL
YCF3_CYAM1      HKQGMTYQDEQ----------------------LLQKAAAYWRKAIQLAPGQYLEAQNWL
YCF3_CYACA      HYYGNKLFEQSK---------------LQEAKLMFDKASNYWRKAIKLAPYNYIEAQNWL
YCF3_GALSU      HYQAVKASEIND---------------LETAQALFHEAAQYWKQAIKLAPSNYIEAQNWL
YCF3_SYNJB      HHKGELSLQAGD---------------EETAEALFNEAAQYWIRAIRIAPNNYIEAQNWL
YCF3_SYNJA      HHKGEQSLQAGD---------------EETAEALFDEAAQYWIRAIRIAPNNYIEAQNWL
YCF3_TRIEI      HYRGEKAKETGN---------------SRDANSYFDQAAEYWKQAISLAPNNYIEAQNWL
YCF3_THEEB      HYLGTQAEEQQR---------------LEEAEQFFDRAADYWKRAIQLAPNNYIEAQNWL
YCF3_GLOVI      HFRGAKVEEEGQ---------------PEQAEEHYAKAAAAWIRAVRLAPDNYIEAQNWL
YCF3_SYNP6      HFLGQRSEEAGN---------------DDEAERHYDQAAEYWTQAIRLAPNNYIEAQNWL
YCF3_SYNE7      HFLGQRSEEAGN---------------DDEAERHYDQAAEYWTQAIRLAPNNYIEAQNWL
YCF3_SYNR3      HHLGSIAQEKGE---------------SDEADRRFDLAADFWSKAIRLAPNNYIEAQNWL
YCF3_PROM2      EKRGRYAEQNGD---------------LDQRDIWYDKAAEVWSKAVRLYPGGYLDIENWL
YCF3_PROM0      EKRGRNAEQNGD---------------LDQRDIWFDKAAEVWSKAVRLYPGGYLDIENWL
YCF3_PROMS      EKRGRYAEQNGD---------------LDQRDIWFDKAAEVWSKAVRLYPGGYLDIENWL
YCF3_PROM9      EKRGRNAEQNGD---------------LDQRDIWFDKAAEVWTKAVKLYPGGYLDIENWL
YCF3_PROM5      EKRGRYAEQNGD---------------LDQRDMWFDKAAQVWSKAVRLYPGGYLDIENWL
YCF3_PROMP      EKRGRFAEQNGD---------------LDQRDMWFDKAAQVWSKAVRLYPGGYLDIENWL
YCF3_PROMT      EKRGRMAQRNGN---------------QDECDIWFDQAAEVWSKAVRLYPGGYLDIENWL
YCF3_PROM1      EKRGRMAQRNGN---------------QDECDIWFDQAAEVWSKAVRLYPGGYLDIENWL
YCF3_PROMA      EKRGRALQQNGK---------------QDESDIWFDKAAEVWTKAVRLYPGGYLDIENWL
YCF3_SYNS9      EKWGRIAEESGQ---------------QDDADRWFDQAADVWTQAVRLNPGGYLDIENWL
YCF3_SYNPX      EKWGRIAEEDGR---------------QDDADRWFDQAAEAWTQAVRLNPGGYLDIENWL
YCF3_SYNSC      EKWGRIAEEGGE---------------QDSADRWFDQAADVWTQAVRLNPGGYLDIENWL
YCF3_SYNS3      EKRGRTAEEEGR---------------RDDADGWFDQAANVWTQAVRLNPGGYLDIENWL
YCF3_SYNPW      EKRGRTAEEEGR---------------RDDADGWFDQAAEVWTQAVRLNPGGYLDIENWL
YCF3_PROM3      EKRGRTAQEAGL---------------QDEADQLFDRAADVWTQAVRLYPGGYLDIENWL
YCF3_PROMM      EKRGRTAQEAGL---------------QDEADRLFDRAADVWTQAVRLYPGGYLDIENWL
                .  .                                 *:  * ..  : *  *    .**

YCF3_TRIV2      KTTGRMQIDVFF----------
YCF3_NOSS1      KTTGRMQIDVFF----------
YCF3_SYNY3      KITGRSEMDVFF----------
YCF3_LACSA      KITRRFE---------------
YCF3_VITVI      KITRRFE---------------
YCF3_JASNU      KITRRFE---------------
YCF3_PANGI      KITRRFE---------------
YCF3_DAUCA      KITRRFE---------------
YCF3_HELAN      KITRRFE---------------
YCF3_PLALA      KITRRFE---------------
YCF3_ACOAM      KITRRFE---------------
YCF3_ACOCL      KITRRFE---------------
YCF3_AMBTC      KITRRFE---------------
YCF3_ILLOL      KITRRFE---------------
YCF3_LIRTU      KITRRFE---------------
YCF3_CALFG      KIARRFE---------------
YCF3_DIOEL      KITRRLEFE-------------
YCF3_PHAAO      KITRRFE---------------
YCF3_LEMMI      KITRRFE---------------
YCF3_CHLSC      KITRRFE---------------
YCF3_RANMC      KITRRFE---------------
YCF3_BUXMI      KITGRFE---------------
YCF3_CERDE      KITRRFE---------------
YCF3_PLAOC      KITRRFE---------------
YCF3_DRIGR      KITRRFE---------------
YCF3_IPOPU      KITGRFE---------------
YCF3_NANDO      KITRRFE---------------
YCF3_ARATH      TITRRFE---------------
YCF3_BRAJU      TITRRFE---------------
YCF3_SINAL      TITRRFE---------------
YCF3_SOLLC      KITRRFE---------------
YCF3_SOLBU      KITRRFE---------------
YCF3_SOLTU      KITRRFE---------------
YCF3_NICSY      KITRRFE---------------
YCF3_TOBAC      KITRRFE---------------
YCF3_NICTO      KITRRFE---------------
YCF3_ATRBE      KITRRFE---------------
YCF3_POPTR      KITRRFE---------------
YCF3_POPAL      KITRRFE---------------
YCF3_OENEH      KITRRFE---------------
YCF3_EUCGG      KITRRFE---------------
YCF3_GOSBA      KITRRFE---------------
YCF3_GOSHI      KITRRFE---------------
YCF3_LOTJA      KITRRFE---------------
YCF3_PELHO      KITRRFE---------------
YCF3_LOLPR      KITKRFEFE-------------
YCF3_AGRST      KITKRFEFE-------------
YCF3_WHEAT      KITKRFEFE-------------
YCF3_HORVU      KITKRFEFE-------------
YCF3_SACHY      KITKRFEFE-------------
YCF3_MAIZE      KITKRFEFE-------------
YCF3_SACOF      KITKRFEFE-------------
YCF3_SORBI      KITKRFEFE-------------
YCF3_ORYNI      KITKRFEFE-------------
YCF3_ORYSA      KITKRFEFE-------------
YCF3_ORYSI      KITKRFEFE-------------
YCF3_ORYSJ      KITKRFEFE-------------
YCF3_NUPAD      KITGRFE---------------
YCF3_NYMAL      KITGRFE---------------
YCF3_PHAVU      KITGRFE---------------
YCF3_SOYBN      KITGRFE---------------
YCF3_CITSI      KITGRFE---------------
YCF3_CUCSA      KITRRFK---------------
YCF3_COFAR      KITGRFG---------------
YCF3_PIPCE      KITGRFE---------------
YCF3_CUSEX      KITGRFD---------------
YCF3_CUSRE      KITGRFD---------------
YCF3_MORIN      KITGRFE---------------
YCF3_SPIOL      KITGRFE---------------
YCF3_CUSGR      TITWRSK---------------
YCF3_CUSOB      TITWRSK---------------
YCF3_PINKO      KITGRFGE--------------
YCF3_PINTH      KITGRFGE--------------
YCF3_GNEPA      KITGRFG---------------
YCF3_CYCTA      KITGRLGE--------------
YCF3_ADICA      KITGRFSPSHRWESWNNSTRVA
YCF3_ANGEV      KITGRLKEWV------------
YCF3_ZYGCR      KNTRRL----------------
YCF3_PSINU      RITGRSEDWE------------
YCF3_HUPLU      KITGRLKD--------------
YCF3_ANTAG      RITGRSKIK-------------
YCF3_PHYPA      KITDRLK---------------
YCF3_CHAVU      KITGRI----------------
YCF3_MARPO      KMTGRF----------------
YCF3_CHAGL      KITGRLKA--------------
YCF3_STAPU      KITGRLKE--------------
YCF3_CHLAT      KLTGRI----------------
YCF3_MESVI      KITGRIEDNINL----------
YCF3_CHLRE      KMTGRLTGLAT-----------
YCF3_TETOB      KMTGRNTGL-------------
YCF3_STIHE      KMTGRA----------------
YCF3_PLETE      KMTARE----------------
YCF3_CHLVU      KMTGRF----------------
YCF3_OLTVI      NQYTN-----------------
YCF3_TUPAK      KQRENI----------------
YCF3_BIGNA      SVRNK-----------------
YCF3_NEPOL      KITNRLEEAI------------
YCF3_OSTTA      QTTGR-----------------
YCF3_CYAPA      KTTGRSKLDILI----------
YCF3_RHDSA      KTTGRMASESLY----------
YCF3_GUITH      KTTGRSDTLTI-----------
YCF3_EMIHU      KITGKLSETEIF----------
YCF3_PHATC      KVTGRLSDNN------------
YCF3_TRICV      KVTGRQISEEYF----------
YCF3_THAPS      RITGRAKSLDSF----------
YCF3_PORPU      KTTGRMKNIQGY----------
YCF3_PYRYE      KTTGRMRNIQGY----------
YCF3_GRATL      KTTGRLNNK-------------
YCF3_CYAM1      KNMV------------------
YCF3_CYACA      KITGRITEDIML----------
YCF3_GALSU      LSTGRL----------------
YCF3_SYNJB      KTTGRANLEVY-----------
YCF3_SYNJA      KTTGRANLELY-----------
YCF3_TRIEI      KTTGRSNKEVFF----------
YCF3_THEEB      KTTGRSNIDVYF----------
YCF3_GLOVI      KTTGRFELLY------------
YCF3_SYNP6      KTTGRSKVDVYF----------
YCF3_SYNE7      KTTGRSKVDVYF----------
YCF3_SYNR3      KTTGRGSADVYL----------
YCF3_PROM2      KNSGRSSIDMYL----------
YCF3_PROM0      KNSGRSSIDMYL----------
YCF3_PROMS      KNSGRSSIDIYL----------
YCF3_PROM9      KNSGRSSIDMYL----------
YCF3_PROM5      KTSGRSSIDIYL----------
YCF3_PROMP      KTSGRSSIDIYL----------
YCF3_PROMT      KTTGRGNVDVYL----------
YCF3_PROM1      KTTGRGNVDVYL----------
YCF3_PROMA      KTTGRSKVDIYL----------
YCF3_SYNS9      KSTGRSNVDVYF----------
YCF3_SYNPX      KSTGRSNVDVYF----------
YCF3_SYNSC      KSTGRSNVDVYF----------
YCF3_SYNS3      KSTGRSNVDVYF----------
YCF3_SYNPW      KSTGRSNVDVYF----------
YCF3_PROM3      KTTGRSNIDVYF----------
YCF3_PROMM      KTTGRSNIDVYF----------