CLUSTAL format seed alignment for MF_00440

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NRDR_CHLTR       MLCPFCNHGELKVIDSRNAPESNAIKRRRECLRCSQRFTTFETVEL-TVQVLKRDGRYEN
NRDR_CHLTA       MLCPFCNHGELKVIDSRNAPESNAIKRRRECLRCSQRFTTFETVEL-TVQVLKRDGRYEN
NRDR_CHLMU       MLCPFCNHGELKVIDSRNSPEANAIKRRRECLRCSQRFTTFETVEL-TIQVLKRDGRYEN
NRDR_CHLAB       MQCPFCNHGELKVIDSRNAPEANAIKRRRECLNCGQRFTTFETVEL-TLQVLKRDGRYEN
NRDR_CHLCV       MQCPFCNHGELKVIDSRNAPEANAIKRRRECLNCGQRFTTFETVEL-TLQVLKRDGRYEN
NRDR_CHLFF       MQCPFCNHGELKVIDSRNAPEANAIKRRRECLNCGQRFTTFETVEL-TLQVLKRDGRYEN
NRDR_CHLPN       MQCPFCNHGELKVIDSRNAPEANAIKRRRECLKCSQRFTTFETVEL-TLQVLKRDGRYEN
NRDR_PARUW       MRCPFCQFEGLKVTDSRDAMEMNAIRRRRECLNCLKRFTTFETIEL-TVQVQKRDGTYED
NRDR_PSYA2       MHCPYCNASDTKVIDSRLAAEGAQVRRRRSCNSCQERFTTFEVVEVVMPRIIKSSGKIEP
NRDR_PSYCK       MHCPYCNASETKVIDSRLAAEGAQVRRRRSCNSCQERFTTFEVVEVVMPRIIKSSGKIEP
NRDR_ACIAD       MHCPFCNAADSKVIDSRLAAEGCQIRRRRECISCGERFTTFESYEVVMPRVIKSNGKNEP
NRDR_HYDCU       MHCPFCNAPDTKVIDSRLATEGAQVRRRRECMSCAERFTTYETAELTLPRVIKSDGNRER
NRDR_PSE14       MHCPFCGANDTKVIDSRLVAEGEQVRRRRECLACGERFTTFETAELVLPRLIKQDGSRQP
NRDR_PSEU2       MHCPFCGANDTKVIDSRLVAEGEQVRRRRECLACGERFTTFETAELVLPRLIKQDGSRQP
NRDR_PSESM       MHCPFCGANDTKVIDSRLVAEGEQVRRRRECLACGERFTTFETAELVLPRLIKQDGSRQP
NRDR_PSEPF       MHCPFCGANDTKVIDSRLVAEGEQVRRRRECLACGERFTTFETAELVLPRLIKTDGSRQP
NRDR_PSEF5       MHCPFCGANDTKVIDSRLVAEGEQVRRRRECLACGERFTTFETAELVMPRLIKTDGSRQP
NRDR_PSEPK       MHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFTTFETAELVLPRLIKQDGTRQP
NRDR_PSEAE       MHCPFCGAHDTKVIDSRLVAEGDQVRRRRECLACGERFTTFETAELVMPRLIKQDGSRQP
NRDR_CHRSD       MHCPFCGKYDTKVTDSRLVAEGDQVRRRRQCNDCGERFTTYETAELVMPRVIKGDGSRET
NRDR_HAHCH       MHCPFCSAADTKVIDSRLVADGSQVRRRRECVSCSERFTTYEAAELVMPRVVKQDGTREP
NRDR_ALCBS       MYCPFCSAQDTKVIDSRLVADGVQIRRRRECLSCTERFTTFETAELVMPRLVKTDGTRQP
NRDR_SACD2       MHCPFCSETDTKVIDSRLVADGAQVRRRRECLTCHDRFTTFETAELVMPRVIKQDGTREP
NRDR_COLP3       MYCPFCSANDTKVIDSRLVSDGHQVRRRRECLACHERYTTFESAELVMPRIIKRDGSREP
NRDR_PSEA6       MFCPFCSIQETKVIDSRLVADGHQVRRRRECTMCKERFTTFEMAELVMPRVVKRDGSREP
NRDR_PSET1       MHCPFCTAKDTKVIDSRLVGGGHQVRRRRECNDCHERFTTFEGAELVMPRVIKQDGSREP
NRDR_IDILO       MHCPFCGTQDTKVIDSRLVADGASVRRRRECNHCKERFTTFETAELVMPRVIKTDGSREP
NRDR_PECAS       MHCPFCSAVDTKVIDSRLVGEGSQVRRRRQCLVCHERFTTFEVAELVLPRVIKSNEVREP
NRDR_SODGM       MHCPFCSAVDTKVIDSRLVGEGTQVRRRRQCVICNERFTTFEVAELVLPRVIKSNDVREP
NRDR_ECOLI       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_SHISS       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_SHIBS       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_SHIDS       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_ECOUT       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_ECO57       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_ECOL6       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_ECOL5       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_SHIFL       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREP
NRDR_SALCH       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVIKSNDVREP
NRDR_SALPA       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVIKSNDVREP
NRDR_SALTI       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVIKSNDVREP
NRDR_SALTY       MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVIKSNDVREP
NRDR_YERPE       MHCPFCAAVDTKVIDSRLVSDGSQVRRRRQCLDCNERFTTFEVAELVLPRVIKSDEVREP
NRDR_YERPA       MHCPFCAAVDTKVIDSRLVSDGSQVRRRRQCLDCNERFTTFEVAELVLPRVIKSDEVREP
NRDR_YERPN       MHCPFCAAVDTKVIDSRLVSDGSQVRRRRQCLDCNERFTTFEVAELVLPRVIKSDEVREP
NRDR_YERPS       MHCPFCAAVDTKVIDSRLVSDGSQVRRRRQCLDCNERFTTFEVAELVLPRVIKSDEVREP
NRDR_PHOLL       MHCPFCAAVDTKVIDSRLVGDGSQVRRRRQCLECHERFTTFEMAELVMPRVIKSDDIREP
NRDR_VIBVU       MHCPFCSENDTKVIDSRLVADGHQVRRRRQCLACNERFTTFETAELLMPKVIKSNGNREP
NRDR_VIBVY       MHCPFCSENDTKVIDSRLVADGHQVRRRRQCLACNERFTTFETAELLMPKVIKSNGNREP
NRDR_VIBPA       MHCPFCSENDTKVIDSRLVADGHQVRRRRQCLACSERFTTFETAELVMPKVIKSNGNREP
NRDR_VIBCH       MHCPFCSENDTKVIDSRLVADGHQVRRRRQCLACNERFTTFETAELVMPRVIKSNGNREP
NRDR_ALIF1       MHCPFCSATDTKVIDSRLVSDGHQVRRRRQCLACSERFTTFESAELVMPKVIKSNGNREP
NRDR_PHOPR       MHCPFCGANDTKVIDSRLVADGHQVRRRRQCLACNERYTTFETAELVMPRVIKTDGNRDS
NRDR_SHEON       MHCPFCSATDTKVIDSRLVAEGHQVRRRRECTECHERFTTFEGAELVMPRVIKRDGTRQP
NRDR_SHESM       MHCPFCSATDTKVIDSRLVAEGHQVRRRRECTECHERFTTFEGAELVMPRVIKRDGTRQP
NRDR_SHESR       MHCPFCSATDTKVIDSRLVAEGHQVRRRRECTECHERFTTFEGAELVMPRVIKRDGTRQP
NRDR_SHEFN       MHCPFCSATDTKVIDSRLVADGHQVRRRRECTECHERFTTFEGAELVMPRVIKRDGTRQP
NRDR_SHEDO       MHCPFCSATDTKVIDSRLVADGHQVRRRRECTLCHERFTTFEGAELVMPRVIKRDDTRQP
NRDR_COXBU       MYCPFCNAEDTKVIDSRLVEEGTQVRRRRECLKCQERFTTFETAELNLPRIIKRDGRRSA
NRDR_ALKEH       MRCPYCQFEDTRVIDSRLASEGEQVRRRRECNRCGERFTTYETAELALPRIVKRDGTREP
NRDR_NITOC       MHCPFCGAGDTKVTDSRLANEGEAIRRRRECQGCGERFTTYEAADLVLPRLLKRNGTREP
NRDR_METCA       MRCPFCGAQDTRVVDSRLSHEGDQVRRRRECGECKERFTTYEAAELNMPRVVKSDGSRQP
NRDR_HAEIN       MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
NRDR_HAEI8       MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
NRDR_MANSM       MHCPFCSTEETKVIDSRLVSDGYQVRRRRECTKCHERFTTFETAELVVPKIIKNNGMREP
NRDR_PASMU       MHCPFCSTEETKVIDSRLVSEGYQVRRRRECGNCHERFTTFETAELIIPKVIKNDGTREP
NRDR_HAES1       MRCPFCAMEETKVIDSRLVSDGYQVRRRRECGYCHERFTTFESAEVIVPKIIKNDGSREP
NRDR_HAEDU       MRCPFCTAEETKVIDSRLAADGYQIRRRRECIGCKERFTTFESAELALPYIIKNNGNREP
NRDR_LEGPA       MYCPFCHAEETKVVDSRLVADGAQVRRRRECLECHERFTTFETAELIMPLIIKRDGRREP
NRDR_LEGPH       MYCPFCHAEETKVVDSRLVADGAQVRRRRECLECHERFTTFETAELIMPLIIKRDGRREP
NRDR_LEGPL       MYCPFCHAEETKVVDSRLVADGAQVRRRRECLECHERFTTFETAELIMPLIIKRDGRREP
NRDR_XANAC       MHCPFCQHNDTRVIDSRVSEDGTTIRRRRECEACGERFSTLETIELKLPTVVKSDGGREA
NRDR_XANC5       MHCPFCQHNDTRVIDSRVSEDGTTIRRRRECEACGERFSTLETIELKLPTVVKSDGGREA
NRDR_XANCP       MHCPFCQHNDTRVIDSRVSEDGTTIRRRRECEACGERFSTLETIELKLPTVVKSDGGREA
NRDR_XANC8       MHCPFCQHNDTRVIDSRVSEDGTTIRRRRECEACGERFSTLETIELKLPTVVKSDGGREA
NRDR_XANOR       MHCPFCQHSDTRVIDSRVSEDGTTIRRRRECEACGERFSTLETIELKLPTVVKSDGGREA
NRDR_XANOM       MHCPFCQHSDTRVIDSRVSEDGTTIRRRRECEACGERFSTLETIELKLPTVVKSDGGREA
NRDR_XYLFA       MYCLFCQHTYTRVIDSRVSEDGATIRRRRECEACGERFSTLETIELKLPVIIKKDGGREA
NRDR_XYLFT       MYCLFCQHTDTRVIDSRVSEDGATIRRRRECEACGERFSTLETIELKLPVIIKKDGGREA
NRDR_AROAE       MKCPFCGDPNTQVADTRENEGGEVVRRRRRCPKCDKRFTTYERIDLKMPHIVKRNGNRSE
NRDR_DECAR       MKCPFCGAEDTAVADTRLNDEADVVRRRRKCNACDKRFTTYERAEIQLPQVVKKNGLRTE
NRDR_POLSJ       MKCPFCGNLETQVVETRVSEDADFIRRRRQCGACEKRFTTYERPDVNFPAIVKKDGRRIE
NRDR_RHOFT       MKCPFCSHSETQVVETRISEDGDSIRRRRQCASCQKRFTTYERPDVAFPAIVKKDGRRIE
NRDR_CUPPJ       MKCPFCGHSNTQVLDTRMSEDGDAVRRRRRCEACDRRFTTYERIELFFPAIVKKNGSRVD
NRDR_CUPMC       MKCPFCGHSSTQVLDSRVSEDGDTVRRRRRCEACDRRFTTYERIELFFPAIVKKNGSRVD
NRDR_RALSO       MKCPFCGHAATQVIDTRMSEEGDTVRRRRRCESCDRRFTTYERIELFFPAVVKKNGSRVD
NRDR_BORBR       MRCPFCGNADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERVELAMPSVVKRDGSRTE
NRDR_BORPA       MRCPFCGNADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERVELAMPSVVKRDGSRTE
NRDR_BORPE       MRCPFCGNADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERVELAMPSVVKRDGSRTE
NRDR_BORA1       MRCPFCGHADTQVVDSRVSEEGDTIRRRRRCLSCDKRFTTYERVELAMPTVVKRDGSRSE
NRDR_BURCA       MRCPFCRHDDTQVVDSRVSEDGAAIRRRRRCSACDKRFTTYERVELNLPAVVKKDGSRTE
NRDR_BURL3       MRCPFCRHDDTQVVDSRVSEDGAAIRRRRRCSACDKRFTTYERVELSLPFVVKKDGSRTE
NRDR_BURMA       MRCPFCRHDDTQVVDSRVSEDGAAIRRRRRCSACDKRFTTYERVELALPAVVKKDGSRTE
NRDR_BURPS       MRCPFCRHDDTQVVDSRVSEDGAAIRRRRRCSACDKRFTTYERVELALPAVVKKDGSRTE
NRDR_BURP1       MRCPFCRHDDTQVVDSRVSEDGAAIRRRRRCSACDKRFTTYERVELALPAVVKKDGSRTE
NRDR_BURTA       MRCPFCRHDDTQVVDSRVSEDGAAIRRRRRCSACDKRFTTYERVELALPAVVKKDGSRTE
NRDR_PARXL       MHCPFCRHADTQVVDSRVSEDGATIRRRRRCPACDKRFTTYERVELALPSVVKKDGSRTE
NRDR_CHRVO       MKCAFCGNPDTQVIDSRVSEDGSSIRRRRRCPACDKRFTTFETADVRMPQVVKTAGHRSE
NRDR_NITMU       MKCPFCHTPDTSVIDSRVSEEGDRIRRRRRCPHCDKRFTTYETVELRLPQVVKQDGNRAE
NRDR_NITEU       MRCPFCGAEDTSVVDSRISEEGARIRRRRRCVECEKRFTTYETVELRFPQVIKQDGNRVE
NRDR_METFK       MKCPFCGADDTQVIDSRVNEEGDSIRRRRRCNACDKRFTTYETAELHLPQVVKQNGKREE
NRDR_THIDA       MKCPFCGSLDTQVIDSRANEAGDAIRRRRRCAACDKRFTTWETAELRPPQIVKTNGTRED
NRDR_ANADE       MRCPYCGHLEDRVVDSRETQDGQATRRRRACLSCERRFTTYERIEDVLPQVVKKDGRREA
NRDR_MYXXD       MRCPFCQDAENKVIDSRESHEGSVIRRRRECLTCKRRFTTYERVEELYPLIVKKDGRREA
NRDR_DESPS       MKCPYCGHLDNKVIDSRINKDATITRRRRSCLACDQRFTTYERLEVMFPMLVKKDGRREA
NRDR_GEOMG       MKCPFCAHPDSKVVDSRPDKGGAAIRRRRECESCAKRFTTHERIEETLPLVLKKDGRREP
NRDR_GEOSL       MKCPFCGQLDSKVVDSRPDKGGAAIRRRRECESCGKRFTTHERIEEVLPLVLKKDGRREP
NRDR_PELCD       MKCPFCGFADTRVIDSRLGKEGNNIRRRRECSQCERRFTTFERVEDMLPLIIKKDARRQP
NRDR_SYNAS       MKCPFCGGVENKVMDSRVSRDGNAIRRRRECLACGRRFTTYEYIEEMLPTVVKKDGRREP
NRDR_KORVE       MRCPFCAHPEDKVVDSRESKEGESIRRRRECLKCEKRFTTYERIDEIPYMVVKKDGRRER
NRDR_TREDE       MRCPHCGNCDDKVMESRTLAQGDCIRRRRECLACGYRFTSYEHIEEKPFMVIKKDGRREP
NRDR_CLOPE       MRCPYCSYEESKVVDSRSAEDYNAIRRRRECLRCSKRYTTYEKVEDIPILVIKKDLSRES
NRDR_CLOP1       MRCPYCSYEESKVVDSRSAEDYNAIRRRRECLRCSKRYTTYEKVEDIPILVIKKDLSRES
NRDR_CLOPS       MRCPYCSYEESKVVDSRSAEDYNAIRRRRECLRCSKRYTTYEKVEDIPILVIKKDLSRES
NRDR_CLOAB       MKCPFCGYSESKVVDSRSTEDNMAIRRRRECLECSKRYTTYEKVEDIPILVIKKDSSREF
NRDR_CLOTE       MKCPYCSYNESKVVDSRSTEDSISIRRRRECLECGKRYTTYEKIESVPILVIKKNLNREY
NRDR_CALS4       MKCPYCGYPDSRVIDSRPTDDNTAIRRRRECLKCGKRFTTYEKVEQLPILVIKKDNRREL
NRDR_CLOD6       MQCPYCNYKESKVIDSRHT-DLKSIRRRRECESCKKRFTTYEKIETTPLMVIKKDNSREY
NRDR_THEMA       MKCPFCGSMDTRVLDSRPTLDGTAIRRRRECSSCGKRFTTYERYEEAPVLVVKKDGRREK
NRDR_BACAN       MRCPSCSHNGTRVLDSRPVDEGRSIRRRRECESCLSRFTTFERVEESPLIVVKKEGTREE
NRDR_BACHK       MRCPSCSHNGTRVLDSRPVDEGRSIRRRRECESCLSRFTTFERVEESPLIVVKKEGTREE
NRDR_BACC1       MRCPSCSHNGTRVLDSRPVDEGRSIRRRRECESCLSRFTTFERVEESPLIVVKKEGTREE
NRDR_BACCR       MRCPSCSHNGTRVLDSRPVDEGRSIRRRRECESCLSRFTTFERVEESPLIVVKKEGTREE
NRDR_BACCZ       MRCPSCSHNGTRVLDSRPVDEGRSIRRRRECESCLSRFTTFERVEESPLIVVKKEGTREE
NRDR_BACLD       MKCPACQHNGTRVLDSRPVDEGRSIRRRRECESCNYRFTTFEKVEEIPLIVVKKEGIREE
NRDR_BACSU       MKCPSCQHNGTRVLDSRPVDDGKSIRRRRECESCHYRFTTFEKVEETPLIVVKKEGVREE
NRDR_GEOKA       MRCPSCHHSGTRVLESRPVEEGRSIRRRRECEQCHYRFTTFERIEEPPLIVVKKEGTREE
NRDR_BACSK       MRCPKCQHNGTRVLDSRPSDESRSIKRRRECEKCLQRFTTYETVEERPLLIIKKDGMREE
NRDR_BACHD       MRCPACHHNGTRVLDSRPAHEGRSIRRRRECESCNHRFTTFEMIEEVPLIVVKKDGTRQE
NRDR_LISMO       MRCPTCQYNGTRVVDSRPADDGNSIRRRRECEKCGFRFTTFEKVEESPLIVVKKDGAREE
NRDR_LISMF       MRCPTCQYNGTRVVDSRPADDGNSIRRRRECEKCGFRFTTFEKVEESPLIVVKKDGAREE
NRDR_LISIN       MRCPTCKYNGTRVVDSRPADDGNSIRRRRECEKCGFRFTTFEKVEESPLIVVKKDGAREE
NRDR_OCEIH       MRCSNCQNKNTKVLDSRPIEEGRAIRRRRECERCGFRFTTFERIEEVPLIVVKKDGVRQE
NRDR_LACPL       MQCPHCHHNGSRVVDSRPTDDGRVIRRRRECENCGFRFTTFERVEATPLLVIKKNGAREE
NRDR_LACSS       MLCPHCHQNSSRVIDSRPTDEGRVIRRRRECENCQFRFTTFERVEQTPLLVIKKNGTREE
NRDR_ENTFA       MRCPRCHHNNSRVIDSRQADDGRAIRRRRECENCSYRFTTFERIEAAPLLVIKKNGDREE
NRDR_LACS1       MKCPNCHKNGSRVVDSRPADNGHAIRRRRECEQCGYRFTTFERVEVTPLLVIKKNGTREE
NRDR_LACAC       MECPNCHQNASRVIDSRPSDENRAIRRRRECENCGFRFTTFERIETAPLLVVKNDGTREP
NRDR_LACJO       MECPNCHKNASRVIDSRPSDENRAIRRRRECENCGFRFTTFERVERSPLLVVKNDGTREA
NRDR_LACDA       MLCPNCHQNASRVIDSRPTDEGRTIRRRRECENCGYRFTTFERVEQSPLLVIKNDGTREA
NRDR_STRA1       MRCPKCGYNKSSVVDSRQAEEGTTIRRRRECEKCGNRFTTFERLEELPLLVIKKDGTREQ
NRDR_STRA3       MRCPKCGYNKSSVVDSRQAEEGTTIRRRRECEKCGNRFTTFERLEELPLLVIKKDGTREQ
NRDR_STRA5       MRCPKCGYNKSSVVDSRQAEEGTTIRRRRECEKCGNRFTTFERLEELPLLVIKKDGTREQ
NRDR_STRP1       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRPB       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRPC       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRP8       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRPD       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRPM       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRP3       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRPF       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRP6       MRCPKCNYHKSSVVDSRQAEDGNTIRRRRECEQCHTRFTTFERVEELPLLVIKKDGTREQ
NRDR_STRMU       MRCPKCNYLKSSVVDSRQAEEGNTIRRRRECENCHTRFTTFERIEELPLLVVKKDGTREQ
NRDR_STRT2       MRCPKCQHNKSNVIDSRQAEDGNTIRRRRECDACHARFTTFERVEEVPLLVVKKDGTREQ
NRDR_STRT1       MRCPKCQHNKSNVIDSRQAEDGNTIRRRRECDACHARFTTFERVEEVPLLVVKKDGTREQ
NRDR_STRPN       MRCPKCGATKSSVIDSRQAEEGNTIRRRRECDECQHRFTTYERVEERTLVVVKKDGTREQ
NRDR_STRR6       MRCPKCGATKSSVIDSRQAEEGNTIRRRRECDECQHRFTTYERVEERTLVVVKKDGTREQ
NRDR_LACLA       MRCPKCSSEESKVVDSRQAED--AIRRRRVCESCGFRFTTFERIEEMPLLVIKKDDKREP
NRDR_STAAB       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAAC       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAA3       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAAR       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAAS       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAAM       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAAW       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAAN       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAA8       MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQ
NRDR_STAES       MKCPKCNSTHSRVVDSRHADEANAIRRRRECENCGTRFTTFEHIEVSPLIVVKKDGTREQ
NRDR_STAEQ       MKCPKCNSTHSRVVDSRHADEANAIRRRRECENCGTRFTTFEHIEVSPLIVVKKDGTREQ
NRDR_STAHJ       MKCPKCSSTHSRVVDSRHADDANAIRRRRECENCGTRFTTFEHIEVSPLIVVKKDGTREQ
NRDR_STAS1       MKCPKCNSTHSRVVDSRHADEVNAIRRRRECEECETRFTTFEHIEKRPLIVVKKDGTREQ
NRDR_DESHY       MHCPFCGNDETKVLESRQVEEGTAVRRRRECERCARRFTTFEKFEDTPLIVVKKDGRREE
NRDR_SYMTH       MKCPFCGG-ESRVLESRPASDEEAVRRRRECLACGRRFTTMERVEVPPLIVVKKDGRREP
NRDR_PROMA       MQCPSCQNTDSRVLESRSADAGKCVRRRRECLNCDFRFTTYERVETIPVTVIKRSNAKEI
NRDR_PROMT       MQCPSCQNTDSRVLESRSADSGRSVRRRRECLNCDFRFTTYERVETTPINVLKRSGAKEL
NRDR_PROM9       MQCPTCQNTDSRVLESRSADSGKSVRRRRECLNCSFRFTTYERVETMPVSVIKKDGNSEL
NRDR_PROMP       MQCPTCQNTDSRVLESRSADTGKSVRRRRECLNCSFRFTTYERVETMPISVIKKDGSREL
NRDR_SYNSC       MQCPSCQNTDSRVLESRAADGGRSVRRRRECLNCEFRFTTYERVETVPITVIKRNGNREI
NRDR_SYNPX       MQCPSYQNTDSRVLESRAADGGRSVRRRRECLNCEFRFTTYERVETVPITVIKRNGNREI
NRDR_SYNS9       MQCPSCQNTDSRVLESRAADGGRSVRRRRECLNCDFRFTTYERVETVPITVIKRDGCREL
NRDR_SYNS3       MQCPSCQNTDSRVLESRAAEGGRSVRRRRECLNCEFRFTTYERVEMVPITVIKRNGHREI
NRDR_PROMM       MQCPSCQNTDSRVLESRAADAGRSVRRRRECLHCDFRFTTYERVETVPITVLKRNGNRET
NRDR_SYNP6       MQCPACRHTDSRVLESRSSESGRSVRRRRECLSCGHRFTTYERVEFVPISVIKRNGDRES
NRDR_SYNE7       MQCPACRHTDSRVLESRSSESGRSVRRRRECLSCGHRFTTYERVEFVPISVIKRNGDRES
NRDR_THEEB       MQCPYCHHTDSRVLESRSAEGGQSIRRRRECLACGRRFTTYERIEFVPITVIKRNGDRES
NRDR_SYNY3       MQCPHCQHHNSRVLESRSSEGGQSIRRRRECLECKHRFTTYERLELLPVTVIKQDGERQA
NRDR_TRIEI       MLCPICQDTNSRVLESRSAESGKSIRRRRECMNCQHRFTTYERIEFLTITIIKRDGKKES
NRDR_GLOVI       MLCPFCSYSDNRVLESRLAEEGESVRRRRECKQCRRRFTTYERIEFVPTVVIKRNGRREA
NRDR_SYNJB       MKCPRCSKQEIRVLESRSAEGGQSVRRRRECMSCGYRFTTYERIEFMPIMVIKRDGSRES
NRDR_SYNJA       MKCPRCGKQEIRVLESRSAEGGQSVRRRRECMSCGYRFTTYERIEFMPIMVIKRDGSRES
NRDR_SYNWW       MRCPYCQEFESRVVDSRSGDDGSFIRRRRECNACKRRFTTYERLEERGLLVIKKGGNREA
NRDR_CARHZ       MRCPFCGNENTRVIDTRAAEDGFAIKRRRECENCSKRFTTYERLDDRPLIVVKKDGSKQL
NRDR_NATPD       MNCPDCGNGRTRVIDTGASSDGASVRRRRECQRCSFRFTTYERPEWKSLQVKKRDGTIES
NRDR_RUBXD       MQCPYCDHEDTKVIDSRLSEAKDAIRRRRECLACGKRFTTYERREPLRLMVLKRDGRREP
NRDR_DEHM1       MNCPYCSHPDTKVIDSRD--VDDGVRRRRECVVCGQRFTTYERFQPAGLFVVKKDQRREE
NRDR_DEHMC       MNCPYCSHPDSKVIDSRD--VDDGVRRRRECVVCGQRFTTYERFQPAGLFVVKKDQRREE
NRDR_FUSNN       MKCPFCSSEDTKVVDSRTT-IDGSTKRRRECNNCLKRFSTYERFEESPIYVVKKDNRRVK
NRDR_BDEBA       MKCPFCGHADDRVLDTRVQ-KDGSIRRRRECLECKARFSTVETIMLAFPFIIKKDGRREP
NRDR_DEIGD       MKCPYCSAPDSRVVNSRPSDDGASIRRRRECLRCNRRFTTYERAQLEPLMVLKRGGQREA
NRDR_DEIRA       MKCPYCSSPDSRVINSRPSDDGASIRRRRECLTCTRRFTTYERAQLEPLMVVKRSGVREA
NRDR_THET2       MKCPYCGHPDTRVVDSRPSDEGMAIRRRRECPSCGRRFTTYERTQLEPLMVVKRDGRKEP
NRDR_THET8       MKCPYCGHPDTRVVDSRPSDEGMAIRRRRECPSCGRRFTTYERTQLEPLMVVKRDGRKEP
NRDR_STRCL       MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETA---SLMVIKRSGVTEP
NRDR_STRCO       MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETC---SLMVVKRSGVTEP
NRDR_STRAW       MHCPFCRHPDSRVVDSRTTDDGTSIRRRRQCPDCSRRFTTVETC---SLMVVKRSGVTEP
NRDR_LEIXX       MFCPFCRHPDSRVIDSRTSDDGLSIRRRRQCPECGRRFSTTETA---SLSVIKRSGVVEP
NRDR_BIFLO       MHCPFCQNPDTKVIDTRISDDGHSIRRRRVCPKCSKRFTTVETS---MLLVTKRSGGVEP
NRDR_MYCBO       MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETA---VLAVVKRSGVTEP
NRDR_MYCTU       MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETA---VLAVVKRSGVTEP
NRDR_MYCLE       MHCPFCRHSDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETA---VVAVVKRSGVTEP
NRDR_MYCPA       MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETA---VLAVVKRSGVTEP
NRDR_MYCSS       MHCPFCRHPDSRVVDSRETDEGQAIRRRRSCPECGRRFTTVETA---VLAVVKRSGVTEP
NRDR_RHOJR       MHCPFCRHPDSRVVDSREADEGQAIRRRRSCPECGRRFTTVETA---VLSVVKRSGVTEP
NRDR_NOCFA       MHCPYCRHPDSRVVDSREAEEGAAIRRRRSCPNCGRRFTTVETA---ILSVVKRSGVTEP
NRDR_FRACC       MRCPFCRHPDSRVVDSREAEEGSAIRRRRSCLSCGRRFTTMEEA---SLQVRKRSGAAEP
NRDR_THEFY       MRCPFCHNQDTRVIDSRAAEEGTAIRRRRSCPACERRFTTQETV---LLMVTKRSGATEP
NRDR_CUTAK       MRCPFCQHDDSRVLDSRVCEDGTAIRRRRQCPMCERRFTTIERM---QMTVHKRNGIEEP
NRDR_COREF       MYCPFCQHGHSRVIDSRVIEAGSAIRRRRECSQCQGRFTTIEKA---VLLVLKRNGVTEP
NRDR_CORGL       MYCPFCQHDHSKVIDSRVIDAGSAIRRRRECSKCEGRFTTIEKA---VLLVVKRNGVTEP
NRDR_CORDI       MYCPFCHNDQSRVIDSRVIDSGSAIRRRRECTQCKNRFTTVEKA---QLLVVKRNGLTEP
NRDR_CORJK       MLCPSCNSESSRVVDSRSIEMGVSIRRRRECSECQTRFTTIERS---VLLVVKRNGVTEE
NRDR_TROW8       MRCLFCRSDDTKVIDSRTSEDGISIRRRRECQLCKRRFSTLETA---SLTVIKRNGTSEP
NRDR_TROWT       MRCLFCRSDDTKVIDSRTSEDGISIRRRRECQLCKRRFSTLETA---SLTVIKRNGTSEP
NRDR_RHOBA       MRCPFCHSDNDKVQDSRTAEAGYVVRRKRLCQTCQRRFTTLEQIDALNVRVVKSDETREP
NRDR_RHIEC       MRCPYCGSEDTQVKDSRPAEDNTSIRRRRICPDCGGRFTTFERVQLRELMVIKKTGRKVP
NRDR_RHIME       MRCPYCGSEDSQVKDSRPAEDGNAIRRRRICPDCGGRFTTFERVQLRELMIIKKTGRKVP
NRDR_AGRFC       MRCPFCGSEDTQVKDSRPAEDNTSIRRRRICPDCGGRFTTYERVQLRELMVIKKSGRKLP
NRDR_BARHE       MRCPYCQYEDTQVKDSRPSEEGTVIRRRRICSVCGGRFTTFERVQLRELLVLKKSGRYEP
NRDR_BARQU       MRCPYCQYEDTQVKDSRPVEEGAVIRRRRVCPVCGGRFTTFERVQLRELLVSKKSGRCEP
NRDR_BRUAB       MRCPYCQSEDTQVKDSRPAEDGAVIRRRRVCSVCGGRFTTFERVQLRDLMVVKKSGRRVP
NRDR_BRUA2       MRCPYCQSEDTQVKDSRPAEDGAVIRRRRVCSVCGGRFTTFERVQLRDLMVVKKSGRRVP
NRDR_BRUME       MRCPYCQSEDTQVKDSRPAEDGAVIRRRRVCSVCGGRFTTFERVQLRDLMVVKKSGRRVP
NRDR_BRUSU       MRCPYCQSEDTQVKDSRPAEDGAVIRRRRVCSVCGGRFTTFERVQLRDLMVVKKSGRRVP
NRDR_CHESB       MRCPYCQSEDTQVKDSRPAEDGAAIRRRRACPVCGGRFTTFERVQLRDLVVVKRTGRKVP
NRDR_RHILO       MRCPYCQSEDTQVKDSRPAEDGAAIRRRRVCPDCGGRFTTFERVQLRDLVVVKKSGRKVP
NRDR_CAUVC       MRCPFCGHAESQVKDSRPSEDGAAIRRRRMCPECGGRFTTFERVQLRELIIVKRSGRRSP
NRDR_RHOPS       MRCPNCNSLDTQVKDSRPTEDSSVIRRRRVCIACNFRFTTFERVQLRELTVIKRNGRRVP
NRDR_RHOP2       MRCPNCNSLDTQVKDSRPTEDSSVIRRRRVCIACNFRFTTFERVQLRELTVIKRNGRRVP
NRDR_RHOPA       MRCPNCNSLDTQVKDSRPTEDSSVIRRRRVCIACNFRFTTFERVQLRELIVIKRNGRRVP
NRDR_BRADU       MRCPNCNSLDTQVKDSRPTEDSSVIRRRRVCVACNFRFTTFERVQLRELTVIKRNGRRVP
NRDR_NITHX       MRCPSCNSLDTQVKDSRPTEDSAVIRRRRVCMACNFRFTTFERVQLRELTVIKRNGRRVP
NRDR_NITWN       MRCPSCNSLDTQVKDSRPTEDSAVIRRRRVCMACNFRFTTFERVQLRELTVIKRNGRRVP
NRDR_RHOPB       MRCPSCSSLDTQVKDSRPTEDSAVIRRRRVCMACNFRFTTFERVQLRELTVIKRNGRRVP
NRDR1_MAGSA      MRCPFCGHDDTQVKDSRPTDDNASIRRRRACPACASRFTTSERVQIRDLVVIKKDGSRST
NRDR2_MAGSA      MRCPFCGQDDTQVKDSRPTDDNAAIRRRRACPGCGSRFTTFERVQIRDLVVVKKDGSRST
NRDR3_MAGSA      MRCPFCGHDDTQVKDSRPTEDNSAIRRRRSCPECGSRFTTFERVQIRDLVVIKKDGGRSP
NRDR_RHORT       MRCPFCGNGDTQVKDSRPTEDSAAIRRRRFCPACNSRFTTFERVQLRDLVIVKKDGQRSA
NRDR_GLUOX       MRCPFCGHDDTQVKDSRSTEDGVAIRRRRVCSACTQRFTTVERVQLRELSVTKADGRRVP
NRDR_GRABC       MRCPFCGHEDTQVKDSRPTDDGTAIRRRRSCTACMQRFTTVERVQLRELIVVKTDQRRVV
NRDR_RUEPO       MRCPFCGNIDTQVKDSRPAEDHVSIRRRRFCPACGGRFTTYERVQLRDLVVIKTSGKRED
NRDR_RUEST       MRCPFCGNVDTQVKDSRPAEDHVSIRRRRFCPACGGRFTTYERVQLRDLVVIKTNGKRED
NRDR_ROSDO       MRCPFCGNIDTQVKDSRPAEDHVSIRRRRFCPACGGRFTTYERVQLRDLVVIKSTGKRED
NRDR_RHOS4       MRCPFCGNIDTQVKDSRPAEDHVSIRRRRFCPACGGRFTTYERVQLRDLVVIKSSGKRED
NRDR_JANSC       MRCPFCGNVDTQVKDSRPAEDHVAIRRRRFCPACAGRFTTYERVQLRDLVVIKSNGKRED
NRDR_MARMM       MRCPFCGHPDTQVKDSRPAEDGNAIRRRRQCPSCAARFTTFERVQLRELTVMKKSGRRVP
NRDR_HYPNA       MRCPFCGSDNTSVKDSRAAEDDTAVRRRRVCESCGARFTTFERVQLREIIVVKRDGKRSL
NRDR_PELUB       MICSICKKGETSVVDSRPTEDGTAIRRRRLC-VCGARFTTFERVQFREIMVVKKNGRKSS
NRDR_NOVAD       MRCPFCAHDNSQVKDSRPSEDNTSIRRRRQCEGCGARFTTFERVQLREVVVVKSGERREP
NRDR_SPHAL       MRCPYCGHEDSQVKDSRPTEDGAAIRRRRQCEDCGARFTTFERIQLREVVVIKAGGTREP
NRDR_ZYMMO       MRCPFCSCENSQVKDSRPTEDGTAIRRRRQCEECGARFTTFERIHMRDIVVIKKDDHRQP
NRDR_NEOSM       MKCPFCGNRDTNVRDSRSVNEGTFIKRRRFCGECGAKFTTFETIQLKEIKVIKKNGSCES
NRDR_ANAMM       MRCPFCNSVDTSVKNSRPSDCKMSVRRRRSCDSCNSRFTTVEELLLKPVKVLKKDGSVEA
NRDR_ANAPZ       MKCPFCNSADTRVKNSRHSDDNMSVRRRRLCEVCNSRFTTLEELLLKPIMVLKKDGRMEP
NRDR_EHRCJ       MKCPFCNNINTQVKDSRAIEDDILIRRRRICLVCNSRFTTIEKLLLRSFMVIKKNGETEP
NRDR_EHRCR       MKCPFCNSTDTQVKDSRSIENDMLIRRRRVCLVCHSRFTTTEKLLLRSFMVVKKNGETEL
NRDR_EHRRG       MKCPFCNNISTNVKDSRSIEDDMLIRRRRVCPVCNSRFTTTEKLLLRSLMVIKKNGGLEQ
NRDR_EHRRW       MKCPFCNNISTNVKDSRSIEDDMLIRRRRVCPVCNSRFTTTEKLLLRSLMVIKKNGGLEQ
NRDR_NEIMA       MKCPFCTHPDTRVADSRLMEERNAVRRRRHCPNCGKRFGTLETAELKMPAVIGPDKKRSP
NRDR_NEIMB       MKCPFCAHPDTRVADSRLMEERNAVRRRRHCPNCGKRFGTLETAELKMPAVIGPDKKRSP
                 * *         * ::         :*:* *  *  :: : *        :         

NRDR_CHLTR       FQESKLVNGLKAASSHTRIGQEQVQAIASNIKQDLLGKQ--NREISTKEIGELVMKYLKK
NRDR_CHLTA       FQESKLVNGLKAASSHTRIGQEQVQAIASNIKQDLLGKQ--NREISTKEIGELVMKYLKK
NRDR_CHLMU       FQEAKLINGLKAASSHTRIGQEQVQAIASNIKQDLLGKQ--NREISTKEIGELVMKYLKK
NRDR_CHLAB       FQESKLINGLNAASSHTRIGQDQVHAIASNVKSELLGKQ--NREISTKEIGELVMKYLKK
NRDR_CHLCV       FQESKLINGLNAASSHTRIGQDQVHAIASNVKSELLGKQ--NREISTKEIGELVMKYLKK
NRDR_CHLFF       FQESKLINGLNAASSHTRIGQDQVHAIASNVKSELLGKQ--NREISTKEIGELVMKYLKK
NRDR_CHLPN       FQESKLIHGLNAASSHTRIGQDQVHAIASNVKSELLGKQ--NREISTKEIGELVMKYLKK
NRDR_PARUW       FQQHKLINGLAAACRHTKISHDQVISLAAQMTNELMQSQ--IQQISTTQLGEMAMKHLQS
NRDR_PSYA2       YDNDKLRRSILLPLQKRPITIDEQEAMISRIEKRVRQMG--EREVSSKVLGEIIMSELKT
NRDR_PSYCK       YDNDKLRRSILLPLQKRPITIDEQEGMISRIEKRVRQMG--EREVSSKVLGEIIMSELKT
NRDR_ACIAD       FDEAKLRRSLMHALQKRPVTQEQIEAVLSDIQLKIRRLG--ERDVKSRMIGEIVMQALFA
NRDR_HYDCU       FDDDKIRRGLIKALEKRPVASEAIDQVVNRIHKQLTAEG--VREIPSSQIGELLMEALKE
NRDR_PSE14       FDEEKLRAGMQRALEKRPVSVERLEAALVHIKHKLRATG--EREVKSLVVGELVMAELQK
NRDR_PSEU2       FDEEKLRAGMQRALEKRPVSVERLEAALVHIKHKLRATG--EREVKSLVVGELVMTELQK
NRDR_PSESM       FDEEKLRAGMQRALEKRPVSVERLEAALAHIKHKLRATG--EREVKSLVVGELVMGELQK
NRDR_PSEPF       FDEEKLRAGMQRALEKRPVSVERLESSLVHIKHKLRATG--EREVKSLVVGELVMAELQK
NRDR_PSEF5       FDEEKLRAGMQRALEKRPVSVERLEAALVHIKHKLRATG--EREVKSLVVGELVMTELQK
NRDR_PSEPK       FDEEKLRAGMQRALEKRPVSVERLEAALAHIKSRLRATG--EREVKSLVVGEMVMAELRK
NRDR_PSEAE       FDEDKLRAGMQRALEKRPVSVERLEAAIGHIKHQLRATG--EREIKSRVLGELVMAELQK
NRDR_CHRSD       FDERKLRAGMLRALEKRPVSAESIEAAVERIRQRLRARG--EREIEAREIGEEVMRSLKR
NRDR_HAHCH       FDEDKLRAGFLKALEKRPVSMEEIEAAVDRIKFRLRATG--ERELNSRVIGEEVMSELRE
NRDR_ALCBS       FDEAKLRAGMLRALEKRPVSMEDLEAAISRICHRLRATG--ERELPARELGEFVMEELQQ
NRDR_SACD2       FDEEKLRAGLQRALEKRPVSVEAIESSVQNVKHYLQALG--EREVKSLMIGEKVMEELRS
NRDR_COLP3       FNEDKMLSGLTRALEKRPVSMEQIELAVNKLKSQMRATG--EREISSEMLGDLIMAQLKE
NRDR_PSEA6       FNEDKLRAGLQRALEKRPVSTEQVEQCISRLKSAMRATG--EREITSEYLGNLIMDALKE
NRDR_PSET1       FNEDKLLNGLNRALEKRPVSTEQVEEVVNIIKSQLRATG--EREVSSHLVGECIMEALKK
NRDR_IDILO       FNEDKLRNGLLRALEKRPVSLELMEQAINKIKSSIRATG--EREISSNFVGSLVMENLKQ
NRDR_PECAS       FNEDKLRSGMLKALEKRPVSSDDVEMAINHIKSHLRATG--EREVTTKMVGNLVMEALRK
NRDR_SODGM       FNEEKLRSGFLKALEKRPVKSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMDALKK
NRDR_ECOLI       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SHISS       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SHIBS       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SHIDS       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_ECOUT       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_ECO57       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_ECOL6       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_ECOL5       FNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SHIFL       FNEEKLRSGMLRALEKRPVSSDYVEMAINHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SALCH       FNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SALPA       FNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SALTI       FNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_SALTY       FNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATG--EREVPSKMIGNLVMEQLKK
NRDR_YERPE       FNEEKLRRGMLKALEKRPVSSDDVETAISHIKSQLRATG--EREVPTKMVGNLVMEALKR
NRDR_YERPA       FNEEKLRRGMLKALEKRPVSSDDVETAISHIKSQLRATG--EREVPTKMVGNLVMEALKR
NRDR_YERPN       FNEEKLRRGMLKALEKRPVSSDDVETAISHIKSQLRATG--EREVPTKMVGNLVMEALKR
NRDR_YERPS       FNEEKLRRGMLKALEKRPVSSDDVETAISHIKSQLRATG--EREVPTKMVGNLVMEALKR
NRDR_PHOLL       FDEEKLRRGMQKALEKRPVSSDDVEMAISYIKSQLRATG--EREVPSKMIGNLVMDELKK
NRDR_VIBVU       FNEDKMVGGIQRALEKRPVSADAIELAISMIKSKLRATG--EREVPSKMIGNLVMEQLKD
NRDR_VIBVY       FNEDKMVGGIQRALEKRPVSADAIELAISMIKSKLRATG--EREVPSKMIGNLVMEQLKH
NRDR_VIBPA       FDEDKMVGGIQRALEKRPVSADSIELAISMIKSQLRATG--EREVPSQMIGNLVMDQLKE
NRDR_VIBCH       FDEEKMIGGLQRALEKRPVSADAIELAISTIKSKLRATG--EREVPSKLIGNLVMEQLKV
NRDR_ALIF1       FDEDKLSGGLYRSLEKRPVSADLVELALNTIKSQLRATG--EREVPSDMIGNLVMDQLKE
NRDR_PHOPR       FNEDKLRGGIQRALEKRPVSADDIERAINTIKSRLRATG--EREVPSDMIGNLVMEALKE
NRDR_SHEON       FDEEKLQAGMLRAVEKRPVSMDEIEQALSKIKSTLRATG--EREVPSEMIGNLMMEQLMS
NRDR_SHESM       FDEEKLQAGMLRAVEKRPVSMDEIEQALSKIKSTLRATG--EREVPSEMIGNLMMEQLMS
NRDR_SHESR       FDEEKLQAGMLRAVEKRPVSMDEIEQALSKIKSTLRATG--EREVPSEMIGNLMMEQLMS
NRDR_SHEFN       FDEEKLRGGMLRAVEKRPVSIDEIEQALTKIKSTLRATG--EREVNSEMIGNLMMEQLMS
NRDR_SHEDO       FDEDKLRGGMLRAVEKRPVSMDQLEQALTKIKSTLRATG--EREINSEMIGNLMMEQLMH
NRDR_COXBU       FDEEKLRAGLLKALEKRPISTEQIETAVQRIIHKLRARG--ECEVSSQWLGELVMDELRA
NRDR_ALKEH       WDEGKLRQGMLRALEKRPVATEAVEAALFRIRQRLRATG--EREVSASQLGEWVMEELRE
NRDR_NITOC       FQEEKLRAGILRAVEKRPVSTEAVEAAIRRIVHRLRASG--EREFDSQVLGEWVMDELRH
NRDR_METCA       FREEKLRAGMLRALEKRPVSSDRVEAAITRIEKRLLATG--EREVQSRLVGEYVMNELSQ
NRDR_HAEIN       FNEDKLRSGIQHALEKRPVSADDVEKAINHIILQLRATG--EREVPSKLVGKLAMNELKK
NRDR_HAEI8       FNEDKLRSGIQHALEKRPVSADDVEKAINHIILQLRATG--EREVPSKLVGKLAMNELKK
NRDR_MANSM       FNEDKLRRGIQHALEKRPVSADDVEKAISHITHQLRATG--EREVPSKLVGSLVMEELKK
NRDR_PASMU       FNEEKLRRGIQHALEKRPVSENDVEKAISYIIHRLRSTG--EREVPSKLVGTLVMEELKK
NRDR_HAES1       FDEDKLRRGIQHALEKRPVSSDDVEKAISRIIYQLRATG--ERDVKSQDVGRLVMAELKE
NRDR_HAEDU       FDLNKLEVSLNRALEKRPVHADDVDNVISKIIFQLKALG--EREVPSKSVGHLAMDGLKQ
NRDR_LEGPA       FHIDNLRSGMLRALEKRPVSVDDLEKAIISITEEIRRRG--EREIDSQVVGELVMKELFR
NRDR_LEGPH       FHIDNLRSGMLRALEKRPVSVDDLEKAIISITEEIRRRG--EREIDSQVVGELVMKELFR
NRDR_LEGPL       FHIDNLRSGMLRALEKRPVSVDDLEKAIISITEEIRRRG--EREIDSQMVGELVMKELFR
NRDR_XANAC       FDARKLRTSFDRALQKRPVAEEQIEAAVRAVVHQLRMSG--EREVGSLRVGEYVMVELRK
NRDR_XANC5       FDARKLRTSFDRALQKRPVAEEQIEAAVRAVVHQLRMSG--EREVGSLRVGEYVMVELRK
NRDR_XANCP       FDARKLRTSFDRALQKRPVSEEQIEAAVRAVVHQLRMSG--EREVGSLRVGEYVMVELRK
NRDR_XANC8       FDARKLRTSFDRALQKRPVSEEQIEAAVRAVVHQLRMSG--EREVGSLRVGEYVMVELRK
NRDR_XANOR       FDARKLRTSFDRALQKRPVAEEQIEAAVRSVVHQLRMSG--EREVGSLRVGEYVMVELRK
NRDR_XANOM       FDARKLRTSFDRALQKRPVAEEQIEAAVRSVVHQLRMSG--EREVGSLRVGEYVMVELRK
NRDR_XYLFA       FDGRKLRTSFDRALQKRPVAEECIEMALRAVIHRLRMAG--EREVPSIVVGEYVMAELRK
NRDR_XYLFT       FDGRKLRTSFDRALQKRPVAEERIEMAMRAVIHRLRMAG--EREVPSIVVGECVMAELRK
NRDR_AROAE       FEHDKLAGSMKLALRKRPVTLEALDAAVDRIEAKLLALG--EQEVPSEKVGELVMRELKK
NRDR_DECAR       FSRAKLRASLELALRKRPVSIESVDAAVADIEERLLSAG--EREVTTQQLGELVMRELKK
NRDR_POLSJ       YKRGKILGSMNLALRKRPVSTEQIDSAIERIEEKLLSLG--VREVPSNRLGELVMRELKK
NRDR_RHOFT       YERAKLLASMTLALRKRPVSTEQVDGAVERIEEKLLMQG--VRELPSARLGELVMRELKK
NRDR_CUPPJ       YSRAKLKDSMRLALRKRPVSAEAIDEAITRIEEKLLALG--QKEIPSSQVGELVMRELRK
NRDR_CUPMC       YARAKLKDSMRLALRKRPVSAEAIDEAITRIEEKLLALG--EKEIPSSQVGELVMRELRK
NRDR_RALSO       YDRNKVKDSMRLALRKRPVSAEAIDEAIARIEEKLLSHG--EKEIGSDRIGELVMRELKR
NRDR_BORBR       YDAGKVRGSLSLALRKRPVSTDEVDSAVARIEETLLASG--MREVPSEQIGELVMGELKR
NRDR_BORPA       YDAGKVRGSLSLALRKRPVSTDEVDSAVARIEETLLASG--MREVPSEQIGELVMGELKR
NRDR_BORPE       YDAGKVRGSLSLALRKRPVSTDEVDSAVARIEETLLASG--MREVPSEQIGELVMGELKR
NRDR_BORA1       YDAAKLRGSLALALRKRPVSTEEVDGAVARIEDTLLASG--AREVASEHIGELVMNELKR
NRDR_BURCA       FDCRKIVASMQLALRKRPVAADAIDAAVARIEYQLLATG--EREVRSEKLGELVMNELRG
NRDR_BURL3       FDRRKIVASMQLALRKRPVAADAIDAAVARIEYQLLATG--EREVRSEKLGELVMNELRG
NRDR_BURMA       FDRRKIVASMQLALRKRPVAADAIDAAVARIEYQLLASG--EREVRSEKLGELVMNELRQ
NRDR_BURPS       FDRRKIVASMQLALRKRPVAADAIDAAVARIEYQLLASG--EREVRSEKLGELVMNELRQ
NRDR_BURP1       FDRRKIVASMQLALRKRPVAADAIDAAVARIEYQLLASG--EREVRSEKLGELVMNELRQ
NRDR_BURTA       FDRRKIVASMKLALRKRPVAADAIDAAVARIEYQLLASG--EREVRSEKLGELVMNELRQ
NRDR_PARXL       FDRRKIVASMQLALRKRPVAADAIEAAVARIEYQLLGSG--EREVRSERLGELVMNELRA
NRDR_CHRVO       FDIEKVRTSFLRALHKRPVSTTLVDEAIDRICHKLLQLG--EREVSSRQIGEMVMNELAR
NRDR_NITMU       FDREKLRTGFVRALHKRPVSAEDVEAAMNRVVQKLLSLG--EREIASHKIGEMVMGELYK
NRDR_NITEU       FNREKLYTSFARALHKRPVPTGQVDAAIERILQKLLGSG--VQEISSRTIGEWVMQELYS
NRDR_METFK       FNRDKLRLSFTRPLHKRPVPTEYVDRALEHIVQKILAKG--EREIMARDLGEIVMQELKA
NRDR_THIDA       FSETKLREGFRRALHKRPVSTELVDAAVDRIRQRLLTLG--EREVPAREVGELVMTELKK
NRDR_ANADE       FDRAKIVEGVATACQKRPVSAEQVEALVSAVERQVQELG--EREIRTAVIGEAVMQRLRT
NRDR_MYXXD       FDREKIVNGLKKACEKRPVSADQLEETVVAIERQLQGMG--EKEVPSSVIGEEIMRRLRQ
NRDR_DESPS       WDRHKLVVGIEKACEKRAVSRDKIDEFVDDIEHMLQDYG--AKEISSSIVGEWVMERLPA
NRDR_GEOMG       FDRMKIVGGILKACEKRQVSRETVDRLVDRLEGRLQEWS--EKEVPSTTIGEWVMTELHD
NRDR_GEOSL       FDRLKLIAGIQKACEKRQVSRETIERLVDRLEARLPELG--EKEVPSTTIGEWVMTELHD
NRDR_PELCD       FDRKKVIGGIQRACEKRPVSIATIEKIVDTLERQLQESG--EREIESKIIGQAVMDALHD
NRDR_SYNAS       FDRNKIRMGIRKACEKRPISTETIESLVTEVERFCQDYS--GEEIRSSMIGEKIMKLLKE
NRDR_KORVE       FDRQKVLNGLMRACEKRPVSIGKLEAIVNEAETFVIDSP--ERERRTSEIGQLIMEHLKK
NRDR_TREDE       FDRKKLEKGIERALEKRPVSLNSIENIVTEIEDQAVLNSGLNKEIETTVLGEMVLSHLYS
NRDR_CLOPE       FNKEKIISGLIKACQKRPVSRAQIEEIAADIERNISNKM--MVEIKSDYIGEMIMERLKD
NRDR_CLOP1       FNKEKIISGLIKACQKRPVSRAQIEEIAADIERNISNKM--MVEIKSDYIGEMIMERLKD
NRDR_CLOPS       FNKEKIISGLIKACQKRPVSRAQIEEIASDIERNISNKM--MVEIKSDYIGEMIMERLKD
NRDR_CLOAB       FDKSKVINGLIKSCEKRPVSRQQIEDIASDVEKSISNQM--VTEVKSDAIGEMVMEKLKE
NRDR_CLOTE       FDRDKIVNGMIKACQKRPVSRQQIEEIVDEIEKKINNSM--ITEVKSEYIGELIMEKLKD
NRDR_CALS4       YDKEKILRGMIKACEKRPVPIKVLEEITDEIDRKIVNSM--VREITSAEIGEMVMEKLKS
NRDR_CLOD6       FDREKIKYGLLKACEKRPVSIDEIESIVVHIENEINKCF--IEEIETKKIGEMVMDKLKE
NRDR_THEMA       FDREKIKNGMIKACEKRPVTYEQIEEAVNRICLKLREEG--SFEVETKRIGELVMEELKK
NRDR_BACAN       FNKEKILRGLIKACEKRPVSLRQLEEVTQSVERELRNLG--ISEVKSDMIGEIVMEELRD
NRDR_BACHK       FNKEKILRGLIKACEKRPVSLRQLEEVTQSVERELRNLG--ISEVKSDMIGEIVMEELRD
NRDR_BACC1       FNKEKILRGLIKACEKRPVSLRQLEEVTQSVERELRNLG--ISEVKSDMIGEIVMEELRD
NRDR_BACCR       FNKEKILRGLIKACEKRPVSLRQLEEVTQSVERELRNLG--ISEVKSDMIGEIVMEELRD
NRDR_BACCZ       FNKEKILRGLIKACEKRPVSLRQLEEVTQSVERELRNLG--ISEVKSDMIGEIVMEELRD
NRDR_BACLD       FSREKMLRGLIKACEKRPVALKQLEDICFEIEKELRNQG--VSEVKSDMIGEMVMDRLAK
NRDR_BACSU       FSREKMLRGLIKACEKRPVSLKTLEDMCFDIEKELRNQG--CSEVKSELVGEMVMDRLAK
NRDR_GEOKA       FSREKILRGLIKACEKRPVALEELEKVTQEIERELRNQG--VSEVKSETIGEMVMERLSH
NRDR_BACSK       FSSDKMLRGLVRACEKRPVPLETLEKMVLDVERTLRNEG--KQEVRSQDVGELVMERLAK
NRDR_BACHD       FSSDKILRGLIRACEKRPVPLETLEGIVNEVERELRGQG--KNEVDSKEIGELVMERLAN
NRDR_LISMO       FAREKVRRGLIRACEKRPVSAEQIEEIVNEVERELRNIG--DSEIASDLIGEKVMNKLAN
NRDR_LISMF       FAREKVRRGLIRACEKRPVSAEQIEEIVNEVERELRNIG--DSEIASDLIGEKVMNKLAN
NRDR_LISIN       FAREKVRRGLIRACEKRPVSAEQIEEIVNEVERELRNIG--DSEIASDLIGEKVMNKLAS
NRDR_OCEIH       FSREKLMRGLIRACEKRPVALETIESIALEVEKKLRNAG--NPEVSSNSIGEMVMELLSK
NRDR_LACPL       FNREKVLRGIIRSAEKRPVSMETMTGVVDDVENKVRSLG--ENEISSQVIGEYVMEQLAD
NRDR_LACSS       FNRDKLLRGLIRAAEKRPVTMEQMTEIVDEVENKIRALG--ENEVSSQAVGEYVMAVLPG
NRDR_ENTFA       FNRDKILRGLIRSAEKRPVAMEQMVQIVDNVENRVRSLG--ENEVSTTLIGEYVMEDLVN
NRDR_LACS1       FQREKLLRGIVRAAEKRPVGIDEITEIVDKVENKLRSVG--GTEVSSQLIGEYVMKILAD
NRDR_LACAC       FSRKKILHGVMAAGQKRPISSEQFEHLVDQVENKVRKQG--VSEISSKKIGQYVMDDLAD
NRDR_LACJO       FNRDKILHGVMMAAQKRPISSEQLDALVDHVENEIRKQG--LNEISSKDIGNLVMKELAN
NRDR_LACDA       FSREKILNGVAAACQKRPVTSEQLNKLVDNVENRIRAKG--VSEIYSKEIGELVMDQLAD
NRDR_STRA1       FSRDKILNGIIQSAQKRPVSSEDIENCILRIERKIRSEY--EDEVSSITIGNLVMDELAE
NRDR_STRA3       FSRDKILNGIIQSAQKRPVSSEDIENCILRIERKIRSEY--EDEVSSITIGNLVMDELAE
NRDR_STRA5       FSRDKILNGIIQSAQKRPVSSEDIENCILRIERKIRSEY--EDEVSSITIGNLVMDELAE
NRDR_STRP1       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRPB       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRPC       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRP8       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRPD       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRPM       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRP3       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRPF       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQEVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRP6       FSRDKILNGVVQSAQKRPVSSTDIENVISRIEQKVRTTY--ENEVSSTAIGNLVMDELAE
NRDR_STRMU       FSRDKIFNGIIRSAQKRPVSSSAIEKVVNDIEQKIRSDY--DSEVSSVVIGNLVMDELAE
NRDR_STRT2       FSRDKIFNGILMSAQKRPVSSEDIENAITRIEQNIRRNH--DGEVDSEVIGNLVMKELAD
NRDR_STRT1       FSRDKIFNGILMSAQKRPVSSEDIENAITRIEQNIRRNH--DGEVDSEVIGNLVMKELAD
NRDR_STRPN       FSRDKIFNGIIRSAQKRPVSSDEINMVVNRIEQKLRGRN--ENEIQSEDIGSLVMEELAE
NRDR_STRR6       FSRDKIFNGIIRSAQKRPVSSDEINMVVNRIEQKLRGRN--ENEIQSEDIGSLVMEELAE
NRDR_LACLA       FNREKIVRGLVRSAYKRPVSSEDIETTVANVERKIRQLD--SNEVESDVIGEFVMQELAE
NRDR_STAAB       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAAC       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAA3       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAAR       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAAS       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAAM       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAAW       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAAN       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAA8       FSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--HTEVSSRDIGEHVMNLLMH
NRDR_STAES       FLREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--QTEISSREIGEHVMNLLMH
NRDR_STAEQ       FLREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEG--QTEISSREIGEHVMNLLMH
NRDR_STAHJ       FLREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDSG--QTEISSRDIGEHVMNLLMH
NRDR_STAS1       FLREKILNGLVRSCEKRPVRYEQLEDITNNVEWKLRDEG--RAEISSREIGEHVMNLLMH
NRDR_DESHY       FSRGKLKAGILRACEKRPVSIEQIETLVYEIEKGLRNGS--EREVQSKAIGEAVMNALVH
NRDR_SYMTH       FNRDKLLTGVLKACEKRPVPMEVIEKLADDIERDLRSSL--DREVPSVVIGERVMEALRQ
NRDR_PROMA       FCRSKLLNGLTRACEKTSINNQKIEAIVDEIETHLQQSN--LKEISSVDLGEMILLHLKS
NRDR_PROMT       FNRSKIINGLNRACEKTLIHGSKIEFIVDEIELELHQGV--CKEIKSIEIGEMVLTHLKD
NRDR_PROM9       FDKQKLFTGISRACEKTTFTSEAIINFVDGIESQILQDS--NKDIKSSQIGELILKSLRK
NRDR_PROMP       FNKDKLVTGISRACEKTTFSRESIINFVDSIESQIVQDS--NKDIKSSQIGELILKGLRK
NRDR_SYNSC       FSRSKLLHGLNRACEKTGLDTSRLESLVEELELRLQQRT--GKEVSSTEIGEFVLRDLKQ
NRDR_SYNPX       FSRSKLLHGLNRACEKTGLDASRLETLVEELELKLQQRS--GREVSSAEIGELVLVELKQ
NRDR_SYNS9       FNRTKVLHGLSRACDKTGLDAARLETVVENLELQLQQRT--AKEVASSEIGELVLKELKQ
NRDR_SYNS3       FNRSKLLHGLSRACEKTGLTPSKLEEIVDNLELSLQQSS--SREITSSEIGELVLSHLKG
NRDR_PROMM       FNRSKILNGLTLACQKTGLEQDRLESMVNELELQLQQRS--GREVNSAEIGEMVLDQLSE
NRDR_SYNP6       FDRSKLLRGIVRACEKTGVSAQQMDLLVDEIEGTLQQRS--SRDVQSSEIGEMVLQQIGR
NRDR_SYNE7       FDRSKLLRGIVRACEKTGVSAQQMDLLVDEIEGTLQQRS--SRDVQSSEIGEMVLQQIGR
NRDR_THEEB       FDRSKLLRGIMTACGKTNIPQQKIEALVDDIEADLQLRS--RREVTSAELGEAALQRLRH
NRDR_SYNY3       FDRSKLLRGMVRACEKTDINFQRLEHIVEEIEANLQQQP--KREIHSEAIGQMVLQYLRQ
NRDR_TRIEI       FDKSKLLRGIIRSCEKTGIEVSQLEAFVNQIEVELQGKC--QREITSAEIGEIVLSKLSG
NRDR_GLOVI       FDRSKVLRGVMIACEKTDVPAELIEQLVDDLQAELQQRS--SREVTSAEIGEMVLALLKP
NRDR_SYNJB       FNRNKILQGVMRACQKTPVTVRQMEELVNEIEEKLQLED--AQEVTSLRIGEMVLERLQH
NRDR_SYNJA       FNRNKILQGVMRACQKTQVSVKQMEELVNEIEEKLQLED--VQEVTTLRIGEMVLERLQR
NRDR_SYNWW       FDRKKILDGIARACEKRPVSMEEMENMVASIERELRDLY--EHEVSSKAIGEMVMDRLQR
NRDR_CARHZ       FDKHKIYTGLLKACEKRPIAESKLLEIAEEIERELKNRL--EQEVTSLEIGEMVMSRLKK
NRDR_NATPD       FDQQKLRTGIERAVEKRGVAETTVTALVDDIESELQDRE--ARIVSSSLIGELVSENLRT
NRDR_RUBXD       FDREKLRAGLEKACAKQRVTGEQIDLIVDQIEAELRERR--RHEVTSRRIGDMVLARLRR
NRDR_DEHM1       FNKEKLLSGLRRACEKRPLPAGAVDKIAGDIEAELYNMG--KAEIPSTLLGDMVMEKLKA
NRDR_DEHMC       FNKEKLLSGLRRACEKRPLPAGAVDKVAGDIEAELYNMG--KAEIPSTLLGDMVMERLKM
NRDR_FUSNN       YDREKLLRGLTFATAKRNVSREELDKIITDIERSLQNSL--ISEISSKDLGEKVLEKLRE
NRDR_BDEBA       FSKEKILKGLQASCQKRPVSLAQIDAVVEKISAWVINRG--ESEISSRLIGKKVMAELKQ
NRDR_DEIGD       FNPDKLLRGLILATEKRPVDPEQLRAFAYGFEDEVQA-----SEITSEEIGRRAMTFLRP
NRDR_DEIRA       FNPDKLLRGLALASEKRPVEEAALRTFAYSFEDEVQG-----GEIPTEEIGRRAMTFLRP
NRDR_THET2       FNPDKLLRGLLLACEKRPVSEEVLRRFAYTFEDQVSG-----PEITSEEIGLKALAFLKE
NRDR_THET8       FNPDKLLRGLLLACEKRPVSEEVLRRFAYTFEDQVSG-----PEITSEEIGLKALAFLKE
NRDR_STRCL       FSRTKVISGVRKACQGRPVTEDALAQLGQRVEEAVRATG--SAELTTHDVGLAILGPLQE
NRDR_STRCO       FSRTKVINGVRKACQGRPVTEDALAQLGQRVEEAVRATG--SAELTTHDVGLAILGPLQE
NRDR_STRAW       FSRTKVINGVRKACQGRPVTEDALAQLGQRVEEAVRATG--SAELTTHDVGLAILGPLRE
NRDR_LEIXX       FSREKIVLGVRKACQGRPVTDSDLAVLAQKVEETIRSTG--ASQIEANDIGLAILPELRE
NRDR_BIFLO       FSRDKVISGVRKACQGRPVREEDLKLLGQKVEEDLRSRG--LAEVTSDEVGKAILKPLRD
NRDR_MYCBO       FSREKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAG--SPEIPSHDVGLAILGPLRE
NRDR_MYCTU       FSREKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAG--SPEIPSHDVGLAILGPLRE
NRDR_MYCLE       FSRGKVIRGVRRACQGRQVDDDALNLLAQQVEDTVRAAG--LPEVPSHEVGLAILGPLRE
NRDR_MYCPA       FSREKVISGVRRACQGRQVDDDALNLLAQQVEDTVRAAG--SPEVPSHEVGLAILGPLRD
NRDR_MYCSS       FSREKVIKGVRRACQGRQVDDDALNLLAQQVEDAVRATG--SPEVPSHEVGLAILGPLRD
NRDR_RHOJR       FSREKVVRGVRRACQGRQVDNDALNLLAQQVEDAVRASG--SAEIPSNEVGLAILGPLRD
NRDR_NOCFA       FSREKVIRGVRRACQGREVDDDALNLLAQQVEDAVRAKG--SPEVPSHEVGLAILGPLRD
NRDR_FRACC       FSRAKVIAGVRKACQGRPVRDDDLALLAQRVEDAVRSSG--SAEVPAEAIGRAILGPLRE
NRDR_THEFY       FSRSKIIAGVRRACQGRPVTEDALALLGQRVEEEIRSRG--VAEVSSHEIGLTILGPLRD
NRDR_CUTAK       FSRDKVIRGVRNACKGRPVTDADLALLGQRVEDGLRARG--VAEIPSEEIGLAILGPLRE
NRDR_COREF       FSREKVVTGVRRACQGRDVSDDSLKRLAQQVEETVRSSG--SSQVRANDIGLAILDPLRE
NRDR_CORGL       FSREKVVTGVRRACQGRDVSDDALKRLAQQVEETVRSNG--SSQVRANDIGLAILDPLRE
NRDR_CORDI       FSREKVIVGVRRACQGRDVSDDALKRLAQQVEERVRLHG--SSQIHANEIGLAILEPLRE
NRDR_CORJK       FSREKVIKGVRRACQGRDVSDDALKRLAHEVEQAVRVAH--GSQVPANQIGLAILDPLRT
NRDR_TROW8       FRREKVVTGVHKACQGRPVTKADLAVLAQRVEESLRASG--NSQVDSNDIGLAILPELLR
NRDR_TROWT       FRREKVVTGVHKACQGRPVTKADLAVLAQRVEESLRASG--NSQVDSNDIGLAILPELLR
NRDR_RHOBA       FDREKIKRGIERACSKRAVTSDEIEKTVQKIEEAIYAEF--DMEIPTATIGEVVLRKLAT
NRDR_RHIEC       FDRDKLVRSFEVALRKRPVERDRIERAVSGIVRRLESSG--ETEISSEQIGLQVLEAMKS
NRDR_RHIME       FDRDKLLRSFEIALRKRPVDRDRIERAVSGIVRRLESSG--ETEIPSEEIGLQVLEALKS
NRDR_AGRFC       FDREKLVRSFEIALRKRPVDRDRIERAVSGIARRLESSG--ETEIPSEEIGLQVLEALKS
NRDR_BARHE       FDRDKLMRSVEIAVRKRGIDPDYIERVISGIVRQLESLG--EPEISSEKIGLLVMKALKS
NRDR_BARQU       FDRDKLMRSVEIAVRKRNIDPDYIERAISGIVRGLESLG--EPEIASEKIGHLVMEALKS
NRDR_BRUAB       FDRDKLTRSIEVALRKRDVDSERVERAISGIVRQLESAG--EAEVTSDEIGRLAMDALKG
NRDR_BRUA2       FDRDKLTRSIEVALRKRDVDSERVERAISGIVRQLESAG--EAEVTSDEIGRLAMDALKG
NRDR_BRUME       FDRDKLTRSIEVALRKRDVDSERVERAISGIVRQLESAG--EAEVTSDEIGRLAMDALKG
NRDR_BRUSU       FDRDKLTRSIEVALRKRDVDSERVERAISGIVRQLESAG--EAEVTSDEIGRLAMDALKG
NRDR_CHESB       FDRDKLHRSFEIALRKRNVDPDRVERAVTGIVRQLESFG--ENEISTDDIGLLVMEALKS
NRDR_RHILO       FDRDKLLRSVEIAVRKRNVDPERIDRAVTGIVRQLESSG--ETEVASGEVGRLVMEALKS
NRDR_CAUVC       FDRDKLVRSVGLATQKRPVDPERVERMVNGIVRQLESMG--ETELPSSTVGEMVMKALKS
NRDR_RHOPS       FDRDKLVRSVQISLRKRPVEPERVEQLVSAIVRELESSG--EADISSETIGEIVMDHLRK
NRDR_RHOP2       FDRDKLVRSLQISLRKRPVEPERVEQMVSAIVRELESGG--EADISSETIGEIVMDHLRK
NRDR_RHOPA       FDRDKLMRSVQISLRKRPVDPERVEQMVSAIVRELESGG--EAEISSETIGESVMDHLRK
NRDR_BRADU       FDRDKLMRSVQISLRKRQVEPERVEKMVSTIVRELETGG--EAEISSEVIGETVMEHLRT
NRDR_NITHX       FDRDKLVRSLQISLRKRPVEPERVETMVSAIVRELESGG--EAEISSEIIGEIVMEHLRS
NRDR_NITWN       FDRDKLVRSLQISLRKRPVEPERIETMVSAIVRELESGG--EAEISSETIGEIVMEHLRS
NRDR_RHOPB       FDRDKLVRSVQISLRKRPVEPEKVEKMVSAIVRELESAG--EAEISSEAIGEIVMEHLRK
NRDR1_MAGSA      FDRDKVVKSLQIALRKRPVDEEQIERIVNGIHRRLESLG--ENEVPSKLIGELVMDVLIG
NRDR2_MAGSA      FDREKVVKSLQIALRKRPVEDDQIERIANGIYRRLESLG--ENEVPSKLIGELVMDVLME
NRDR3_MAGSA      FDRDKVLKSLRIALRKRPVDDEQIERIVNGIHRRLESMG--ENEVPSKFIGELVMEVLMD
NRDR_RHORT       FDRDKLARSIRIACRKRPVDEDSIERIVNGIQRRLESSG--DTEINSKAVGELVMEGLRG
NRDR_GLUOX       FDRDKLARSIRVALRKRPVPEERQERLVNGLVRQLEASG--EHEISSHRIGQLAMDALRE
NRDR_GRABC       FDRDKLTRSVQIALRKRPIDPDRIEKMITGIVRQLESSG--ETEIPSKLIGELVMQTLKE
NRDR_RUEPO       FDRDKLERSIRISMQKRPIDPERIDQMISGIVRRLESMG--ETDIPSKKIGEIVMEALAR
NRDR_RUEST       FDRDKLERSIRISMQKRPVDPERIDQMISGIVRRLESMG--ETDIPSKKIGEIVMEALAR
NRDR_ROSDO       FDRDKLERSIRISMQKRPIDPERIDQMISGIVRRLESMG--ETDIGSKQIGEIVMEALAR
NRDR_RHOS4       FDRTKLERSIRIAMQKRPIEPERIDQMISGIVRRLESLG--DTDIPSKVIGEIVMESLAR
NRDR_JANSC       FDRTKLERSIRMALQKRPIEPERVDQMISGMVRRLESLG--ETDVQSKVIGEIVMERLAA
NRDR_MARMM       FDREKLNRSIQLAMQKRNIEPDRIDQMISGIVRRLESTG--ETDVTSDRVGELVMEGLKN
NRDR_HYPNA       FDREKLQRSILIALRKRPVDRDRIDQMVSGIVRKLESGG--ETEVPSSEVGELVMEALKR
NRDR_PELUB       FDRDKLSKSIYIALKKRPIDTETAEKFISRTSRALEELG--QSEISSNTIGTMVMEGLKD
NRDR_NOVAD       FDRSKIEQSVALACRKRPVNQERLDQLVSGIQRQIETMG--DAEVASKVIGEMVMEGLRQ
NRDR_SPHAL       FDREKLMRSVQIACRKRPIDGARIERLVSGIQRQLETSG--ENEVQASQIGAMVMEALKG
NRDR_ZYMMO       FDRSKLIRSVSIACRKRPVSPDQIELLVNSIQQKIEASG--ESEITAVRLGEMTMEGLRT
NRDR_NEOSM       FDREKAMRSVEVALRKRPVTRERVDELMNSVIYKIERIH--DAKITAKVIGELIMEELAT
NRDR_ANAMM       FDRQKLLTSIILATKKRPVTRDQIDMVVSNMFYKLEAIK--GSVVPSGVIGGMVMESLFA
NRDR_ANAPZ       FDKQKLLTSIMLATNKRPVTHAQINMVLSKILYKFESVK--EDVIPARVIGEIVKNNLLV
NRDR_EHRCJ       FNKQKLLSSILIATKKRPVSHEGINVMVNNIFYELEGKK--ENAVPTDVIGKMVMDNLFK
NRDR_EHRCR       FNKQKLLSSILIATKKRPVSHEGINMMVNNIFYELEGKK--ENAIPTNVIGKMVMDNLFK
NRDR_EHRRG       FDKKKLLSSILIATKKRPVSHDKINMMVNNIFYELEGKK--DNAIPTDVIGKMVMDNLFK
NRDR_EHRRW       FDKKKLLSSILIATKKRPVSHDKINMMVNNIFYELEGKK--DNAIPTDVIGKMVMDNLFK
NRDR_NEIMA       FNAQRLRNDLTAAARKSALTPEQIDETVRLTEHRLYTSG--QRDIPSAALADMVLKELLR
NRDR_NEIMB       FNAQRLRNDLTAAARKSALTPEQIDETVRLTEHRLYTSG--QRDIPSAALADMVLKELLR
                 :   .   ..  .     .                           :  :.      :  

NRDR_CHLTR       ADMIAYIRFACVYRRFKDVGELMEVLLSATP-DGEKQT----------------------
NRDR_CHLTA       ADMIAYIRFACVYRRFKDVGELMEVLLSATP-DGEKQT----------------------
NRDR_CHLMU       ADMIAYIRFACVYRRFRDVGELMEVLLSATP-DGEK------------------------
NRDR_CHLAB       ADMIAYIRFACVYRRFKDVGELMEVLLSATP-DMEK------------------------
NRDR_CHLCV       ADMIAYIRFACVYRRFKDVGELMEVLLSATP-DMEK------------------------
NRDR_CHLFF       ADMIAYIRFACVYRRFKDVGELMEVLLSATP-DMEK------------------------
NRDR_CHLPN       ADMIAYIRFACVYRRFKDVGELMEVLLSATP-DMEK------------------------
NRDR_PARUW       LDPIAYIRFACVYKRFKDLGELEEAIKTIQSKDEDKSCSILKDLL---------------
NRDR_PSYA2       LDDVAYVRFASVYRDFQDIDAFHQEIANIRPNDK--------------------------
NRDR_PSYCK       LDDVAYVRFASVYRDFQDIDAFHQEIANIRPNEK--------------------------
NRDR_ACIAD       LDHVAYVRFASVYQDFQDVEAFRRQIEQMQQREQECEKHDV-------------------
NRDR_HYDCU       LDQVAYVRFASVYRSFQDVNAFREEIEKLVKATKSQ------------------------
NRDR_PSE14       LDEVAYIRFASVYRRFQDLNEFREEIDRLAREPGKE------------------------
NRDR_PSEU2       LDEVAYIRFASVYRRFQDLNEFREEIDRLAREPGKE------------------------
NRDR_PSESM       LDEVAYIRFASVYRRFQDLNEFREEIDRLAREPGKE------------------------
NRDR_PSEPF       LDEVAYIRFASVYRRFQDLNEFREEIDRLAREPVKE------------------------
NRDR_PSEF5       LDEVAYIRFASVYRRFQDLNEFREEIDRLAREPAKQ------------------------
NRDR_PSEPK       LDEVAYIRFASVYRRFQDLDEFREEIDRLAREPAKE------------------------
NRDR_PSEAE       LDEVAYIRFASVYRRFQDLNEFREEIERLAREPAKE------------------------
NRDR_CHRSD       LDQVAYIRFASVYRRFQDLDEFRAEIDRLAQEPSFSPDDADKR-----------------
NRDR_HAHCH       LDQVAFVRFASVYRRFQDLDEFRAEIDKLSRDAAASPMMSEKASNKDDVPTK--------
NRDR_ALCBS       LDDVAYVRFASVYRSFQDISEFSAEVDRLKKAGGKPGDKLGEPKES--------------
NRDR_SACD2       LDQVAYVRFASVYRSFQDLSEFQQEIDRLQK-PKPSPIK---------------------
NRDR_COLP3       LDKVAYLRFASVYLSFEDISEFADEITRLGKEKNGKAKKAKPAKTAK-------------
NRDR_PSEA6       LDKVAYVRFASVYRSFEDIREFGEEIARLGD-----------------------------
NRDR_PSET1       LDKVAYVRFASVYRSFEDIREFGEEIARLGE-----------------------------
NRDR_IDILO       IDKVAYVRFASVYRSFEDIREFGEEIARLND-----------------------------
NRDR_PECAS       LDKVAYIRFASVYRSFEDIREFGEEIARLQD-----------------------------
NRDR_SODGM       LDKVAYIRFASVYRSFEDIREFGEEIARLQD-----------------------------
NRDR_ECOLI       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_SHISS       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_SHIBS       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_SHIDS       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_ECOUT       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_ECO57       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_ECOL6       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_ECOL5       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_SHIFL       LDKVAYIRFASVYRSFEDIKEFGEEIARLED-----------------------------
NRDR_SALCH       LDKVAYIRFASVYRSFEDIKDFGEEIARLQD-----------------------------
NRDR_SALPA       LDKVAYIRFASVYRSFEDIKDFGEEIARLQD-----------------------------
NRDR_SALTI       LDKVAYIRFASVYRSFEDIKDFGEEIARLQD-----------------------------
NRDR_SALTY       LDKVAYIRFASVYRSFEDIKDFGEEIARLQD-----------------------------
NRDR_YERPE       LDKVAYIRFASVYRSFEDVREFGEEIARLQD-----------------------------
NRDR_YERPA       LDKVAYIRFASVYRSFEDVREFGEEIARLQD-----------------------------
NRDR_YERPN       LDKVAYIRFASVYRSFEDVREFGEEIARLQD-----------------------------
NRDR_YERPS       LDKVAYIRFASVYRSFEDVREFGEEIARLQD-----------------------------
NRDR_PHOLL       LDKVAYIRFASVYRSFEDIREFGEEIARLQG-----------------------------
NRDR_VIBVU       LDKVAYIRFASVYRSFEDIREFGEEIARLED-----------------------------
NRDR_VIBVY       LDKVAYIRFASVYRSFEDIREFGEEIARLED-----------------------------
NRDR_VIBPA       LDKVAYIRFASVYRSFEDIREFGEEIARLED-----------------------------
NRDR_VIBCH       LDKVAYIRFASVYRSFEDVREFGEEIAKLQD-----------------------------
NRDR_ALIF1       LDKVAYIRFASVYRSFEDIKEFGEEIAKLEK-----------------------------
NRDR_PHOPR       LDKVAYIRFASVYRSFEDIREFGEEIAKLEK-----------------------------
NRDR_SHEON       LDKVAYIRFASVYRAFEDVSEFGEAIAKLQK-----------------------------
NRDR_SHESM       LDKVAYIRFASVYRAFEDVSEFGEAIAKLQK-----------------------------
NRDR_SHESR       LDKVAYIRFASVYRAFEDVSEFGEAIAKLQK-----------------------------
NRDR_SHEFN       LDKVAYIRFASVYRAFEDVSQFGEAIAKLQK-----------------------------
NRDR_SHEDO       LDKVAYIRFASVYRAFEDVSQFGEAIAKLEK-----------------------------
NRDR_COXBU       LDEVAYVRFASVYRSFQDINAFRDEIRRLQKQQKKSHDK---------------------
NRDR_ALKEH       LDQVAYVRFASVYRSFEDVSAFREVIEGLEKR----------------------------
NRDR_NITOC       LDEVAYVRFASVYRRFQDVQAFREEIERLERALSLEERAAQLSLLLDGGSLVNKSN----
NRDR_METCA       LDDVAYVRFASVYRRFEDVNQFREVIDRLESEPDSETAGRQADAFDA-------------
NRDR_HAEIN       LDKVAYIRFASVYLSFDDIDQFTIEIEKLKD-----------------------------
NRDR_HAEI8       LDKVAYIRFASVYLSFDDIDQFTIEIEKLKD-----------------------------
NRDR_MANSM       LDKVAYIRFASVYLSFENINEFSNEIEKLKD-----------------------------
NRDR_PASMU       LDKVAYIRFASVYLSFDDINQFSKEIEKLRD-----------------------------
NRDR_HAES1       LDKVAYIRFASVYLSFDDINQFTNEIEKLKD-----------------------------
NRDR_HAEDU       LDKVAYIRFASVYLSFDDIEEFTKEIEKLRE-----------------------------
NRDR_LEGPA       LDHVAYVRFASVYKRFKDVSDFRQTIDQMKNEDKEKS-----------------------
NRDR_LEGPH       LDHVAYVRFASVYKRFKDVSDFRQTIDQMKNEDKEKS-----------------------
NRDR_LEGPL       LDHVAYVRFASVYKRFKDVSDFRQTIDQMKNEDKEKS-----------------------
NRDR_XANAC       LDHVGYVRFASVYRSFQDVADFREEIEKLERELPVGSEQLPLLEAALERAGKPGKR----
NRDR_XANC5       LDHVGYVRFASVYRSFQDVADFREEIEKLERELPVGSEQLPLLEAALERAGKPGKR----
NRDR_XANCP       LDHVGYVRFASVYRSFQDVADFREEIEKLERELPVGSEQLPLLEAALERAGKPGKR----
NRDR_XANC8       LDHVGYVRFASVYRSFQDVADFREEIEKLERELPVGSEQLPLLEAALERAGKPGKR----
NRDR_XANOR       LDHVGYVRFASVYRSFQDVADFREEIEKLERELPVGSEQLPLLEVALERAGKPGKR----
NRDR_XANOM       LDHVGYVRFASVYRSFQDVADFREEIEKLERELPVGSEQLPLLEVALERAGKPGKR----
NRDR_XYLFA       LDHVGYVRFASVYRSFQDVADFREEIEKLESELLVSREQLPLLEAAMESMGHPSVDQGGK
NRDR_XYLFT       LDHVGYVRFASVYRSFQDVADFREEIEKLESELLVSREQLPLLEAVMESIGHPSIDQGG-
NRDR_AROAE       LDKVAYIRFASVYRNFADVDEFAEVIREVKARPKRNRPAEPPEPTSENDLFRS-------
NRDR_DECAR       LDKVAYIRFASVYRNFEDVDAFSRAIREVSPAAKKK------------------------
NRDR_POLSJ       LDKVAYVRFASVYRSFEDIDEFKTLVDEVRR-----------------------------
NRDR_RHOFT       LDKVAYVRFASVYRSFEDIDEFKTLVDEVRR-----------------------------
NRDR_CUPPJ       LDKIAYIRFASVYRSFEDVAEFSDVLAEVTSGNSKR------------------------
NRDR_CUPMC       LDKIAYIRFASVYRSFEDVSEFREMLDEFSSSTPRKG-----------------------
NRDR_RALSO       LDKIGYIRFASVYRSFEDVSEFRDMLDEFRQ-----------------------------
NRDR_BORBR       LDKVAYVRYASVYKSFEDIGEFVEAIREMQGPLLPGKKLRKD------------------
NRDR_BORPA       LDKVAYVRYASVYKSFEDIGEFVEAIREMQGPLLPGKKLRKD------------------
NRDR_BORPE       LDKVAYVRYASVYKSFEDIGEFVEAIREMQGPLLPGKKLRKD------------------
NRDR_BORA1       LDKVAYVRFASVYKSFEDIGEFVEAIREMQGPRLGAGKLRKE------------------
NRDR_BURCA       LDTIAYVRFASVYRRFEDVSEFADVIEEFRRAS-PAKTPRKR------------------
NRDR_BURL3       LDTIAYVRFASVYRRFEDVSEFADVIEEFRRAS-PAKTPRKR------------------
NRDR_BURMA       LDTIAYVRFASVYRRFEDVSEFEDVIEEFRRAA-PAKTPRKR------------------
NRDR_BURPS       LDTIAYVRFASVYRRFEDVSEFEDVIEEFRRAA-PAKTPRKR------------------
NRDR_BURP1       LDTIAYVRFASVYRRFEDVSEFEDVIEEFRRAA-PAKTPRKR------------------
NRDR_BURTA       LDTIAYVRFASVYRRFEDVSEFADVIEEFRRAA-PAKPPRKR------------------
NRDR_PARXL       LDTIAYVRFASVYRRFEDVSEFEDVIEEFRRASSPPKPSRKR------------------
NRDR_CHRVO       LDKVAYVRFASVYRSFQDISEFTDAIKEIQKSSH--------------------------
NRDR_NITMU       LDKVAYIRFASVYRSFQGAADFDDAIRELQGSDSRKEPDKP-------------------
NRDR_NITEU       LDKVAYIRFASVYRSFEDVGDFQEVIREVQSSPQNGDGPSS-------------------
NRDR_METFK       IDKVAYIRFASVYRSFQDVDDFNDVIRDLD------------------------------
NRDR_THIDA       LDKIAYIRFASVYKSFKDPDDFRDVLEDLAQGPQAGDDPA--------------------
NRDR_ANADE       LDEVAYVRFASVYRAFRDVGEFMTELAGLARKDGGEER----------------------
NRDR_MYXXD       LDEVAYVRFASVYRSFRDIAEFMDELKALREAEAREQRQAPPSAPVDKGG----------
NRDR_DESPS       LDEVAYVRFASVYRQFKDVDEFMSELKNLLDARGGGDD----------------------
NRDR_GEOMG       IDEVAYVRFASVYRSFKDVNEFMAELQDLLKK----------------------------
NRDR_GEOSL       IDEVAYVRFASVYRSFKDVNEFMSELQDLLKK----------------------------
NRDR_PELCD       LDQVAYVRFASVYRQFKDINEFMAELKDILAEGGNVRDN---------------------
NRDR_SYNAS       LDGVAYVRFASVYRQFRDVNDFLEELKEFKQLHDLKKEKEP-------------------
NRDR_KORVE       YDKVAYVRFASVYLDFKDVREFLSELQDLLNHKDPAAVATVKPIK---------------
NRDR_TREDE       IDKVAYIRFASVYKQFSNLDEFVNEVKKVRK-----------------------------
NRDR_CLOPE       IDEVSYVRFASVYRQFKDINTFMEEIKSLMK-----------------------------
NRDR_CLOP1       IDEVSYVRFASVYRQFKDINTFMEEIKSLMK-----------------------------
NRDR_CLOPS       IDEVSYVRFASVYRQFKDINTFMEEIKNLMK-----------------------------
NRDR_CLOAB       IDEIAYVRFASVYRQFKDINTFMEEILNLVNKK---------------------------
NRDR_CLOTE       IDEVSYVRFASVYRQFKDINTFMEEIKKLKDREL--------------------------
NRDR_CALS4       VDEVAYVRFASVYRQFKDINTFMDELKKLLKENEEKKQKE--------------------
NRDR_CLOD6       LDEVAYVRFASVYRQFKDINTFVNELKSILIEKGDK------------------------
NRDR_THEMA       LDQVAYVRLASVYRDFREVDQFLEIVKELKREKEGEEQ----------------------
NRDR_BACAN       IDDVAYVRFASVYRQFKDLNVFIEELKDILQK-ERE------------------------
NRDR_BACHK       IDDVAYVRFASVYRQFKDLNVFIEELKDILQK-ERE------------------------
NRDR_BACC1       IDDVAYVRFASVYRQFKDLNVFIEELKDILQK-ERE------------------------
NRDR_BACCR       IDDVAYVRFASVYRQFKDLNVFIEELKDILQK-ERE------------------------
NRDR_BACCZ       IDDVAYVRFASVYRQFKDLNVFIEELKDILQK-ERE------------------------
NRDR_BACLD       IDEVAYVRFASVYRQFKDINVFIDELKDLIKK-ER-------------------------
NRDR_BACSU       IDEVAYVRFASVYRQFKDINVFIDELKDLIKK-ER-------------------------
NRDR_GEOKA       IDEVAYVRFASVYRQFKDINVFIEELKELIKKGQR-------------------------
NRDR_BACSK       IDDVAYVRFASVYRQFKDINVFIKELTELMNKN---------------------------
NRDR_BACHD       VDDVAYVRFASVYRQFKDINVFIQELKELMERDDR-------------------------
NRDR_LISMO       LDEVAYVRFASVYRQFKDISVFVEELKDLMEKNKDR------------------------
NRDR_LISMF       LDEVAYVRFASVYRQFKDISVFVEELKDLMEKNKDR------------------------
NRDR_LISIN       LDEVAYVRFASVYRQFKDISVFVEELKDLMEKNKDR------------------------
NRDR_OCEIH       VDEVSYVRFASVYRQFKDITVFLDELKDIINTDKSMKDK---------------------
NRDR_LACPL       IDEISYIRFASVYRQFKDMHVFLNELQDMMERDKVKLAKPSAKTTHAPKRKKD-------
NRDR_LACSS       VDEIAYIRFASVYRQFKDMNVFMAELQEMMKKEK--------------ARDQD-------
NRDR_ENTFA       LDEIAYIRFASVYRQFKDMSVFLKELQDIVDKAK------------SSSPDSEN------
NRDR_LACS1       VDEVAYIRYASVYREFKDMHAFADELRELMDREE--------------NNSKD-------
NRDR_LACAC       LDDVAYIRFASIYREFKDMSSFMKTMEDMMAKKE---------------KGN--------
NRDR_LACJO       LDDVAYIRFASIYRQFKDVSGFMEAMEDMMAKHD---------------KE---------
NRDR_LACDA       IDDVAYIRFASIYRQFTDMSSFMKTMEDMMDRHS---------------KAK--------
NRDR_STRA1       LDEITYVRFASVYKSFKDVDEIEELLQQITKRVR--------------SKKSGSV-----
NRDR_STRA3       LDEITYVRFASVYKSFKDVDEIEELLQQITKRVR--------------SKKSGSV-----
NRDR_STRA5       LDEITYVRFASVYKSFKDVDEIEELLQQITKRVR--------------SKKSGSV-----
NRDR_STRP1       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRPB       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRPC       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRP8       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRPD       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRPM       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRP3       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRPF       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRP6       LDEITYVRFASVYKSFKDVDEIEELLQQITNRVR--------------GKKKRLNNDETN
NRDR_STRMU       LDEITYVRFASVYRSFKDVDEIEALLQQITNRVR--------------SKKKR-KADETN
NRDR_STRT2       LDEITYVRFASVYRSFKDVDEIEELLQEITKTVR--------------AKKESKK-----
NRDR_STRT1       LDEITYVRFASVYRSFKDVDEIEELLQEITKTVR--------------AKKESKK-----
NRDR_STRPN       LDEITYVRFASVYRSFKDVSELESLLQQITQSSK--------------KKKER-------
NRDR_STRR6       LDEITYVRFASVYRSFKDVSELESLLQQITQSSK--------------KKKER-------
NRDR_LACLA       LDDITYIRFASVYRSFKDVSELEELLKNITKK----------------------------
NRDR_STAAB       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAAC       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAA3       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAAR       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAAS       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAAM       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAAW       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAAN       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAA8       VDQVSYVRFASVYKEFKDVDQLLASMQGILSENK--------------RSDA--------
NRDR_STAES       VDQVSYVRFASVYKEFKDVDQLLESMQGILSDNK--------------RSDK--------
NRDR_STAEQ       VDQVSYVRFASVYKEFKDVDQLLESMQGILSDNK--------------RSDK--------
NRDR_STAHJ       VDQVSYVRFASVYKEFKDVDQLLASMQGILNDNK--------------RSDL--------
NRDR_STAS1       VDQVSYVRFASVYKEFKDVDQLLQSMQGILAENK--------------RSDS--------
NRDR_DESHY       LDEVAYIRFASVYREFKDVQRFLEELHELVEKKSSR------------------------
NRDR_SYMTH       VDGVAYVRFASVYREFKDLNEFREQLEQLLKSR---------------------------
NRDR_PROMA       VNEVAYIRFASVYRQFNGIEDFIDTLESFK-------PSNK----------FAAIS----
NRDR_PROMT       INEVAYIRFASVYRQFNGINDFMKTLEALK-------PIKKE--------QLASVI----
NRDR_PROM9       ENEVAYIRYASVYRKFNGVKDFISTLESLK-------GASKN--------QLASIL----
NRDR_PROMP       ENEVAYIRYASVYRKFNGVKDFVSTLESLK-------GSSKN--------ELASIL----
NRDR_SYNSC       ISEVAYIRFASVYRQFRGIDDFVSTLETLN-------ADQEQN-------HLATVR----
NRDR_SYNPX       MSEVAYIRFASVYRQFQGIDDFVSTLETMN-------RKAGPG-------HLAAVG----
NRDR_SYNS9       ISEVAYIRFASVYRQFRGIDDFVSTLETMN-------TEQE---------HLAAVR----
NRDR_SYNS3       LSEVAYVRFASVYRHFRSVSDFVSTLEGMN-------ADKA---------ELAALV----
NRDR_PROMM       MSEVAYVRFASVYRDFRGVNDFVAALEGIH-------ANKE---------QLAAVR----
NRDR_SYNP6       LSEVAYIRFASVYRQFRGVRDFVETLDRLQ-------DLSRDE--VGDVPAAVTSLTSA-
NRDR_SYNE7       LSEVAYIRFASVYRQFRGVRDFVETLDRLQ-------DLSRDE--VGDVPAAVTSLTSA-
NRDR_THEEB       LSEVAYVRFASVYRQFQGISDFVAELAHLQ-------ETPAS-------PELLTISQS--
NRDR_SYNY3       ESEVAYIRFASVYGRFQGIADFVDTLEQLQ-------REQ--------YPERQYLTMT--
NRDR_TRIEI       ISEVAYIRFASVYRKFQGIRDFVDTLNHLQ-------NQKENLEFTATVPQNSEISLQQD
NRDR_GLOVI       LNEVAYVRFASVYRKFKGVADFVSELQTFE-------ANAELDSLKARLERLAAAHDQSA
NRDR_SYNJB       LSEVAYVRFASVYRQFQGIKDFVNELEQLE---PPLRRDLERLLQDSSASDSESSGSPDL
NRDR_SYNJA       LSEVAYVRFASVYRKFQGIKDFVTELEQLERLETHLRRDLERPLRNSPPSESESTASPDW
NRDR_SYNWW       RDEVAYVRFASVYRQFTDLNSFIKTIDQLK--------QR--------------------
NRDR_CARHZ       LDEVAYVRFASVYRQFKDVNSFLEELKKLLNG------GENS------------------
NRDR_NATPD       LDKVAYIRFVSVYKAFSEPQEFLKELDAVLGAELDDFEASNSSQ----------------
NRDR_RUBXD       LDMVAYLRFASVYRQYTDVDQFRSELLRLAGSGMSKGG----------------------
NRDR_DEHM1       LDNIAYVRFASVYREFTDITQLKKVVDNLVSGQDEGIHKGQLSLLPEDRVSPKTRYQRR-
NRDR_DEHMC       LDNIAYVRFASVYREFTDITQLKKVVDNLVNGQDEGIYKGQLSLLPEDKAVPKTRYQRR-
NRDR_FUSNN       LDQVAYVRFASVYKEFDDIKSFIEIVEEIKKD----------------------------
NRDR_BDEBA       LDDVAYIRFASVYRTFKDVQEFVETLEDAELLDFVDASNPQLSLTAMTFVESEKSTNHET
NRDR_DEIGD       LDDVAYIRFASVYRDFDSLERFIEEIQGLKGRGED-------------------------
NRDR_DEIRA       LDDVAYIRFASVYRDFDSLERFIEEIRGLKGHEDEAPKSDPA------------------
NRDR_THET2       LDHVAYIRFASVYREFDSVERFIEEIRSLASLDKKEGD----------------------
NRDR_THET8       LDHVAYIRFASVYREFDSVERFIEEIRSLASLDKKEGD----------------------
NRDR_STRCL       LDLVAYLRFASVYRAFDSLEDFEAAIAELREHR--LPAER------SGGG-------TCG
NRDR_STRCO       LDLVAYLRFASVYRAFDSLEDFEAAIAELRETTG-HPGEED----DTGAGSQENDRGPTG
NRDR_STRAW       LDLVAYLRFASVYRAFDSLEDFEAAIAELREEQRERPAVDDEDHEDAGAERQGTDRGSGG
NRDR_LEIXX       LDEVAYLRFASVYQAFDSLEDFESAIQQLRVEHR------------------------GE
NRDR_BIFLO       LDVVAYLRFASVYQNFAGLEDFQSAIDGLRE-----------------------------
NRDR_MYCBO       LDEVAYLRFASVYRSFSSADDFAREIEALRAHRNLSAHS---------------------
NRDR_MYCTU       LDEVAYLRFASVYRSFSSADDFAREIEALRAHRNLSAHS---------------------
NRDR_MYCLE       LDEVAYLRFASVYRSFSSADDFEREIEALRAHRRVSTSR---------------------
NRDR_MYCPA       LDEVAYLRFASVYRSFESADDFEREIQALREHRGVATPG---------------------
NRDR_MYCSS       LDEVAYLRFASVYRSFESAADFEREIEALRAHQDVTRSG---------------------
NRDR_RHOJR       LDEVAYLRFASVYRSFSSAEDFAREIKELREHRESRDDA---------------------
NRDR_NOCFA       LDEVAYLRFASVYRSFTSAEDFEREISEMRAARARAGATAD-------------------
NRDR_FRACC       LDEVAYLRFASVYLAFESLTDFESAIAALRSEAAGPPTTRDGPARPVPRGAVDVSPVIGT
NRDR_THEFY       LDEVAYLRFASVYRSFESLEDFEREIAELRAERTATQG----------------------
NRDR_CUTAK       LDSIAYLRFASVYLNYNTIEDFATEIDRLRDESSDKTKSSS--------------RKRLS
NRDR_COREF       LDEVAYLRFASVYKSFESADDFEKEIRLMRRQSREKQVQQG-------------------
NRDR_CORGL       LDEVAYLRFASVYKSFDSADDFEKEIRLMRRRGRD-------------------------
NRDR_CORDI       LDEVAYLRFASVYKSFESADDFESEIRLMRRRDRSN------------------------
NRDR_CORJK       LDEVAYLRFASVYKSFNCAEDFEQEIESLRAHRQALAAPPVGDNSEDN------------
NRDR_TROW8       LDQVAYIRFASVYQDFDSLEDFSRAVERLKNQ----------------------------
NRDR_TROWT       LDQVAYIRFASVYQDFDSLEDFSRAVERLKNQ----------------------------
NRDR_RHOBA       LDEVAYIRFASVYRDFDDAKDFLQIVSNLQRDAETEGR----------------------
NRDR_RHIEC       LDDVGFVRYASVYRDFSLAEDFEKVISEINAKIARDPLDR--------------------
NRDR_RHIME       LDDVAFVRYASVYRDFSHAEDFEKVIAEISAKIARDPGE---------------------
NRDR_AGRFC       LDDVAFVRYASVYRDFSHAEDFENVIAEINAKIARDTDAGA-------------------
NRDR_BARHE       IDDIAYIRFASVYRDFRNASDFHDVIEELSKGITDTESCFDE------------------
NRDR_BARQU       IDDIAYIRFASVYRDFRNASDFHDVIDELSKGIANTESCFDE------------------
NRDR_BRUAB       IDDIAYIRFASVYRNFSKAVDFHNVIDELT--VSETGDNLET------------------
NRDR_BRUA2       IDDIAYIRFASVYRNFSKAVDFHNVIDELT--VSETGDNLET------------------
NRDR_BRUME       IDDIAYIRFASVYRNFSKAVDFHNVIDELT--VSETGDNLET------------------
NRDR_BRUSU       IDDIAYIRFASVYRNFSKAVDFHNVIDELT--VSETGDNLET------------------
NRDR_CHESB       LDDVAYVRYASVYRNFREAKDFQDVLGELR---GEPELE---------------------
NRDR_RHILO       LDDVAYVRFASVYRNFREAKDFHELLGELK---GDEDKSEEDAG----------------
NRDR_CAUVC       LDDVAYVRYASVYRDFKETSDFAKFLTEEGLSDGGEEEL---------------------
NRDR_RHOPS       LDDVAYVRFASVYRNFREAKDFEAVLGELSGEEEARPTLVRK------------------
NRDR_RHOP2       LDDVAYVRFASVYRNFREAKDFEAVLGELSGEEEARPALVRK------------------
NRDR_RHOPA       LDDVAYVRFASVYRNFREAKDFEAVLGELSHEDEARAALVRK------------------
NRDR_BRADU       LDDVAYVRFASVYRNFREAKDFADVLGELSGEEEARLAAIRK------------------
NRDR_NITHX       LDDVAYVRFASVYRNFREAKDFEAVLGELSSEDDARPVPLRK------------------
NRDR_NITWN       LDDVAYVRFASVYRNFREAKDFEAVLGELSSEDDPRRVPLRK------------------
NRDR_RHOPB       LDDVAYVRFASVYRNFREAKDFEAVLGELSGDEMARLAALRLK-----------------
NRDR1_MAGSA      MDQVAYLRYASVYRNFREAKDFGDFLGKMGRQGDD-------------------------
NRDR2_MAGSA      MDQVAYLRYASVYRNFREAKDFGDFLGKMGTSSGD-------------------------
NRDR3_MAGSA      LDKVAYVRYASVYRNFREAKDFEDFLGKMVVPRLD-------------------------
NRDR_RHORT       LDPVAYVRFASVYRNFREAKDFEDFVETLGGSAD--------------------------
NRDR_GLUOX       VDGVAYVRFTSVYRDFREVEAFSKILADMKPIPGETDTPSPDDSQETP------------
NRDR_GRABC       VDDVAYVRFASVYRNFSDAGDFQTFLG------GQAASKESDESS---------------
NRDR_RUEPO       IDTVAYVRFASVYKNFQAADDFEDFVHELRPPS---PPTEE-------------------
NRDR_RUEST       IDTVAYVRFASVYKNFQAADDFEDFVHELRPPA---PPES--------------------
NRDR_ROSDO       IDTVAYVRFASVYKNFQAADDFDKFVSELRPDV---PGDE--------------------
NRDR_RHOS4       IDTVAYVRFASVYKNFQAADDFDKFVSELRPSA---PAEE--------------------
NRDR_JANSC       IDTVAYVRFASVYKNFQATGDFEDFLSELRPPA---PTTDT-------------------
NRDR_MARMM       LDAVAYVRYASVYKDFHKVEDFREFITDEALTAHFGPREDDDG-----------------
NRDR_HYPNA       VDPVGYVRYASVYRDFKDPSDFAQFIEKAALED---EDDDADGK----------------
NRDR_PELUB       LDPVAYVRFASVYRNFREEKDFVQFVDKLDVYKKR-------------------------
NRDR_NOVAD       LDSVAYIRFASVYRDFTEARDFEEFASSVQEMSVHEVSGGE-------------------
NRDR_SPHAL       FDNVAYIRFASVYRDFTEARDFEEFASTITEAARPIK-----------------------
NRDR_ZYMMO       LDSVAYIRFASVYKDFTEARDFEDFARSVRSVIEAVKE----------------------
NRDR_NEOSM       LDKVAFIRFASVYMNFENEKDFVQLIGSLTS-----------------------------
NRDR_ANAMM       LDKVSYIRFASVYMNFSDVNDFSGIVERVQEVV---------------------------
NRDR_ANAPZ       LDKVAYIRFVSVYMDFSDADDFCSLVEKIKEGSDK-------------------------
NRDR_EHRCJ       LDKVAYVRFASVYMNFKNINDFSNIIAKIINEQIL-------------------------
NRDR_EHRCR       LDKVAYVRFASVYMNFRNINDFSNIIAKIISEKTP-------------------------
NRDR_EHRRG       LDKVAYVRFASVYMNFKNINDFSNIIAKIINENNL-------------------------
NRDR_EHRRW       LDKVAYVRFASVYMNFKNINDFSNIIAKIINENNL-------------------------
NRDR_NEIMA       QDTEAAVRFAALHKRFDNPADFASWLAQAVKTGGKA------------------------
NRDR_NEIMB       QDTEAAVRFAALHKRFDNPADFASWLAQAVKTGGKA------------------------
                  .    :* ..::  :     :                                      

NRDR_CHLTR       ----------------------
NRDR_CHLTA       ----------------------
NRDR_CHLMU       ----------------------
NRDR_CHLAB       ----------------------
NRDR_CHLCV       ----------------------
NRDR_CHLFF       ----------------------
NRDR_CHLPN       ----------------------
NRDR_PARUW       ----------------------
NRDR_PSYA2       ----------------------
NRDR_PSYCK       ----------------------
NRDR_ACIAD       ----------------------
NRDR_HYDCU       ----------------------
NRDR_PSE14       ----------------------
NRDR_PSEU2       ----------------------
NRDR_PSESM       ----------------------
NRDR_PSEPF       ----------------------
NRDR_PSEF5       ----------------------
NRDR_PSEPK       ----------------------
NRDR_PSEAE       ----------------------
NRDR_CHRSD       ----------------------
NRDR_HAHCH       ----------------------
NRDR_ALCBS       ----------------------
NRDR_SACD2       ----------------------
NRDR_COLP3       ----------------------
NRDR_PSEA6       ----------------------
NRDR_PSET1       ----------------------
NRDR_IDILO       ----------------------
NRDR_PECAS       ----------------------
NRDR_SODGM       ----------------------
NRDR_ECOLI       ----------------------
NRDR_SHISS       ----------------------
NRDR_SHIBS       ----------------------
NRDR_SHIDS       ----------------------
NRDR_ECOUT       ----------------------
NRDR_ECO57       ----------------------
NRDR_ECOL6       ----------------------
NRDR_ECOL5       ----------------------
NRDR_SHIFL       ----------------------
NRDR_SALCH       ----------------------
NRDR_SALPA       ----------------------
NRDR_SALTI       ----------------------
NRDR_SALTY       ----------------------
NRDR_YERPE       ----------------------
NRDR_YERPA       ----------------------
NRDR_YERPN       ----------------------
NRDR_YERPS       ----------------------
NRDR_PHOLL       ----------------------
NRDR_VIBVU       ----------------------
NRDR_VIBVY       ----------------------
NRDR_VIBPA       ----------------------
NRDR_VIBCH       ----------------------
NRDR_ALIF1       ----------------------
NRDR_PHOPR       ----------------------
NRDR_SHEON       ----------------------
NRDR_SHESM       ----------------------
NRDR_SHESR       ----------------------
NRDR_SHEFN       ----------------------
NRDR_SHEDO       ----------------------
NRDR_COXBU       ----------------------
NRDR_ALKEH       ----------------------
NRDR_NITOC       ----------------------
NRDR_METCA       ----------------------
NRDR_HAEIN       ----------------------
NRDR_HAEI8       ----------------------
NRDR_MANSM       ----------------------
NRDR_PASMU       ----------------------
NRDR_HAES1       ----------------------
NRDR_HAEDU       ----------------------
NRDR_LEGPA       ----------------------
NRDR_LEGPH       ----------------------
NRDR_LEGPL       ----------------------
NRDR_XANAC       ----------------------
NRDR_XANC5       ----------------------
NRDR_XANCP       ----------------------
NRDR_XANC8       ----------------------
NRDR_XANOR       ----------------------
NRDR_XANOM       ----------------------
NRDR_XYLFA       HGV-------------------
NRDR_XYLFT       ----------------------
NRDR_AROAE       ----------------------
NRDR_DECAR       ----------------------
NRDR_POLSJ       ----------------------
NRDR_RHOFT       ----------------------
NRDR_CUPPJ       ----------------------
NRDR_CUPMC       ----------------------
NRDR_RALSO       ----------------------
NRDR_BORBR       ----------------------
NRDR_BORPA       ----------------------
NRDR_BORPE       ----------------------
NRDR_BORA1       ----------------------
NRDR_BURCA       ----------------------
NRDR_BURL3       ----------------------
NRDR_BURMA       ----------------------
NRDR_BURPS       ----------------------
NRDR_BURP1       ----------------------
NRDR_BURTA       ----------------------
NRDR_PARXL       ----------------------
NRDR_CHRVO       ----------------------
NRDR_NITMU       ----------------------
NRDR_NITEU       ----------------------
NRDR_METFK       ----------------------
NRDR_THIDA       ----------------------
NRDR_ANADE       ----------------------
NRDR_MYXXD       ----------------------
NRDR_DESPS       ----------------------
NRDR_GEOMG       ----------------------
NRDR_GEOSL       ----------------------
NRDR_PELCD       ----------------------
NRDR_SYNAS       ----------------------
NRDR_KORVE       ----------------------
NRDR_TREDE       ----------------------
NRDR_CLOPE       ----------------------
NRDR_CLOP1       ----------------------
NRDR_CLOPS       ----------------------
NRDR_CLOAB       ----------------------
NRDR_CLOTE       ----------------------
NRDR_CALS4       ----------------------
NRDR_CLOD6       ----------------------
NRDR_THEMA       ----------------------
NRDR_BACAN       ----------------------
NRDR_BACHK       ----------------------
NRDR_BACC1       ----------------------
NRDR_BACCR       ----------------------
NRDR_BACCZ       ----------------------
NRDR_BACLD       ----------------------
NRDR_BACSU       ----------------------
NRDR_GEOKA       ----------------------
NRDR_BACSK       ----------------------
NRDR_BACHD       ----------------------
NRDR_LISMO       ----------------------
NRDR_LISMF       ----------------------
NRDR_LISIN       ----------------------
NRDR_OCEIH       ----------------------
NRDR_LACPL       ----------------------
NRDR_LACSS       ----------------------
NRDR_ENTFA       ----------------------
NRDR_LACS1       ----------------------
NRDR_LACAC       ----------------------
NRDR_LACJO       ----------------------
NRDR_LACDA       ----------------------
NRDR_STRA1       ----------------------
NRDR_STRA3       ----------------------
NRDR_STRA5       ----------------------
NRDR_STRP1       ----------------------
NRDR_STRPB       ----------------------
NRDR_STRPC       ----------------------
NRDR_STRP8       ----------------------
NRDR_STRPD       ----------------------
NRDR_STRPM       ----------------------
NRDR_STRP3       ----------------------
NRDR_STRPF       ----------------------
NRDR_STRP6       ----------------------
NRDR_STRMU       ----------------------
NRDR_STRT2       ----------------------
NRDR_STRT1       ----------------------
NRDR_STRPN       ----------------------
NRDR_STRR6       ----------------------
NRDR_LACLA       ----------------------
NRDR_STAAB       ----------------------
NRDR_STAAC       ----------------------
NRDR_STAA3       ----------------------
NRDR_STAAR       ----------------------
NRDR_STAAS       ----------------------
NRDR_STAAM       ----------------------
NRDR_STAAW       ----------------------
NRDR_STAAN       ----------------------
NRDR_STAA8       ----------------------
NRDR_STAES       ----------------------
NRDR_STAEQ       ----------------------
NRDR_STAHJ       ----------------------
NRDR_STAS1       ----------------------
NRDR_DESHY       ----------------------
NRDR_SYMTH       ----------------------
NRDR_PROMA       ----------------------
NRDR_PROMT       ----------------------
NRDR_PROM9       ----------------------
NRDR_PROMP       ----------------------
NRDR_SYNSC       ----------------------
NRDR_SYNPX       ----------------------
NRDR_SYNS9       ----------------------
NRDR_SYNS3       ----------------------
NRDR_PROMM       ----------------------
NRDR_SYNP6       ----------------------
NRDR_SYNE7       ----------------------
NRDR_THEEB       ----------------------
NRDR_SYNY3       ----------------------
NRDR_TRIEI       VINV------------------
NRDR_GLOVI       D---------------------
NRDR_SYNJB       VGEYS-----------------
NRDR_SYNJA       VGGIPQLLDQNDTSSNLSEIPK
NRDR_SYNWW       ----------------------
NRDR_CARHZ       ----------------------
NRDR_NATPD       ----------------------
NRDR_RUBXD       ----------------------
NRDR_DEHM1       ----------------------
NRDR_DEHMC       ----------------------
NRDR_FUSNN       ----------------------
NRDR_BDEBA       DSKTPSPRTRPPGPLSN-----
NRDR_DEIGD       ----------------------
NRDR_DEIRA       ----------------------
NRDR_THET2       ----------------------
NRDR_THET8       ----------------------
NRDR_STRCL       TGTVPVPAGTAD----------
NRDR_STRCO       AGQVPEPAGAAD----------
NRDR_STRAW       TVEVPVPATVAD----------
NRDR_LEIXX       PADVQV----------------
NRDR_BIFLO       ----------------------
NRDR_MYCBO       ----------------------
NRDR_MYCTU       ----------------------
NRDR_MYCLE       ----------------------
NRDR_MYCPA       ----------------------
NRDR_MYCSS       ----------------------
NRDR_RHOJR       ----------------------
NRDR_NOCFA       ----------------------
NRDR_FRACC       QQVHSR----------------
NRDR_THEFY       ----------------------
NRDR_CUTAK       KQDEPLF---------------
NRDR_COREF       ----------------------
NRDR_CORGL       ----------------------
NRDR_CORDI       ----------------------
NRDR_CORJK       ----------------------
NRDR_TROW8       ----------------------
NRDR_TROWT       ----------------------
NRDR_RHOBA       ----------------------
NRDR_RHIEC       ----------------------
NRDR_RHIME       ----------------------
NRDR_AGRFC       ----------------------
NRDR_BARHE       ----------------------
NRDR_BARQU       ----------------------
NRDR_BRUAB       ----------------------
NRDR_BRUA2       ----------------------
NRDR_BRUME       ----------------------
NRDR_BRUSU       ----------------------
NRDR_CHESB       ----------------------
NRDR_RHILO       ----------------------
NRDR_CAUVC       ----------------------
NRDR_RHOPS       ----------------------
NRDR_RHOP2       ----------------------
NRDR_RHOPA       ----------------------
NRDR_BRADU       ----------------------
NRDR_NITHX       ----------------------
NRDR_NITWN       ----------------------
NRDR_RHOPB       ----------------------
NRDR1_MAGSA      ----------------------
NRDR2_MAGSA      ----------------------
NRDR3_MAGSA      ----------------------
NRDR_RHORT       ----------------------
NRDR_GLUOX       ----------------------
NRDR_GRABC       ----------------------
NRDR_RUEPO       ----------------------
NRDR_RUEST       ----------------------
NRDR_ROSDO       ----------------------
NRDR_RHOS4       ----------------------
NRDR_JANSC       ----------------------
NRDR_MARMM       ----------------------
NRDR_HYPNA       ----------------------
NRDR_PELUB       ----------------------
NRDR_NOVAD       ----------------------
NRDR_SPHAL       ----------------------
NRDR_ZYMMO       ----------------------
NRDR_NEOSM       ----------------------
NRDR_ANAMM       ----------------------
NRDR_ANAPZ       ----------------------
NRDR_EHRCJ       ----------------------
NRDR_EHRCR       ----------------------
NRDR_EHRRG       ----------------------
NRDR_EHRRW       ----------------------
NRDR_NEIMA       ----------------------
NRDR_NEIMB       ----------------------