CLUSTAL format seed alignment for MF_00441

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q7NGT1_GLOVI      ---MTALTL------------LAAPGIPAGWEWANPLIDLLPIIPLLFFALAFVWQAAIG
PSBK_PROMS        --MLILFNT--------------FAELPEAYKAFAPTVDVLPLIPLFFFLLVFVWQAAVG
PSBK_BIGNA        -------------------MITIIARLPEIYSIFYPLINVLPAIPVFFFLLAFVWQASVG
PSBK_CYAM1        -------------------MNMLIAQLPETYSIFAPVIDILPVIPILFFLLAFVWQASVG
PSBK_CYACA        ---------------------MIINQLPETYNIFAPIIDIMPVIPILFLLLAFVWQAAVG
PSBK_PSINU        MLVISNVYP----SNLFTLINPFFAKLPEAYAIFDPIVDVMPIIPVFFFLLAFVWQAAVS
PSBK_PINKO        MPVIFNICL---DDAFIHSNNPFFGKLPEAYAIFDPIVDVMPIIPVLSFLLAFVWQAAVS
PSBK_HUPLU        ---MLKFYL------ENVFHLIFFAKLPEAYAVSDPIVNVMPIIPLFFFLLAFVWQASVS
PSBK_WELMI        ---MLNFLL---QNTFVLWSNFILCKLPEAYAVFDPIVDVMPVIPVFFFLLAFVWQAAVS
PSBK_ANTAG        ---MFYIHL----ENTFDLSSTILVKLPEAYAIFDPIVDVMPIIPLFFFLLAFVWQASVS
PSBK_EUGGR        ---MSFITL-----NNFFNTNTFFGLLPEQYAPFDPLIDVLPIIPVLFFLLAFVWQASVK
PSBK_AGRST        MPNILSLTCICFNSVLYPTTSFFFAKLPEAYAIFNPIVDVMPVIPLFFFLLAFVWQAAVS
PSBK_EUGMY        ---MLNLNF---------TNITVMGILPEAYAPFDPIVDILPIIPILFFLLAFVWQAAVK
PSBK_PROMA        -MAPLTLDL--------------LAQLPEAYQLYAPTVDVLPLIPLLFFLLVFVWQAAVG
PSBK_GRATL        ---MITAII--------------IAKLPEAYTVFRPLVDILPVIPIFFLLLAFVWQAAIG
PSBK_SYNS3        -MAVYTLDL--------------LAQLPEAYQAFGPLIDILPIIPLFFLLLAFVWQASVG
PSBK_CYAPA        ---MLMSLF--------------LAKLPAAYALFDPIVDILPIIPLFFLLLAFVWQAAIG
PSBK_ARATH        MLNIFNLIC-IFFNSTLFSSTFLVAKLPEAYAFLNPIVDVMPVIPLFFLLLAFVWQAAVS
PSBK_EUGDE        -MSFENFAI-------ITLKENVFALLPEAYAPFDPIVDDLPIIPVLFLLLAFVWQSAVK
PSBK_EMIHU        ---MDVNFL--------------LSALPEPYAAFRPIVDVMPAIPVFFLLLAFVWQASVG
PSBK_EUGST        ---MFQISL-----DMISNKINLLGLLPEAYAPFDHIVDVLPIIPILFFLLAFVWQASVK
PSBK_EUGMU        -MLLEHVTI-------TLLNNTSFALLPEAYAPFDPLIDVLPIIPLLFLLLAFVWQASVK
PSBK_STAPU        ---MFNAYL-DTVLDLSANGTVILAKLPEAYAIFDPIVDVMPIIPVFFLLLAFVWQAAVS
PSBK_CHAGL        MLNMISTFF----DSSSNFSEAFLAKLPEAYAIFDPIVDVMPIIPVFFLLLAFVWQAAVS
PSBK_NEPOL        ---MSTLPI-------------LLATLPEAYLPFRPLVDVLPSIPVLFLLLAFVWQAAVS
PSBK_ACAM1        ---MEAVLL--------------LAKLPEAFSVFSPIVDVMPVIPLFFLALAFVWQAAVG
PSBK_SYNY3        ---METIYL--------------LAKLPEAYQIFDPLVDVLPVIPLFFLALAFVWQAAVG
PSBK_THEEB        --MIDALVL--------------VAKLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVG
PSBK_PHAAC        --MISSIHL-----------RKLLGLLPEAYLPFDPIIDVLPIIPVLFLLLAFVWQAAVK
PSBK_CHAVU        --MILYSHL-STLIDIDLSNNIFLAKLPEAYAIFDPLVDVMPVIPVFFLLLAFVWQASVS
PSBK_ADICA        MTVSYSIYL----ENSLHFGDALLAKLPEAYAIFDPIVDVMPVIPVFFLLLAFVWQAAVS
PSBK_CHLVU        --------------------MLLLAKLPEAYAPFDPIVDVLPVIPVLFLLLALVWQASVS
PSBK_MESVI        --MNIGFDM-------------ILAKLPEAYAMFDPLVDVLPVIPLLFLLLAFVWQASVS
                                            :*  :      :: :* **:: : *.:***::: 

Q7NGT1_GLOVI      FK
PSBK_PROMS        FK
PSBK_BIGNA        FR
PSBK_CYAM1        FR
PSBK_CYACA        FR
PSBK_PSINU        FR
PSBK_PINKO        FR
PSBK_HUPLU        FR
PSBK_WELMI        FR
PSBK_ANTAG        FR
PSBK_EUGGR        FR
PSBK_AGRST        FR
PSBK_EUGMY        FR
PSBK_PROMA        FR
PSBK_GRATL        FR
PSBK_SYNS3        FR
PSBK_CYAPA        FK
PSBK_ARATH        FR
PSBK_EUGDE        FR
PSBK_EMIHU        FR
PSBK_EUGST        FR
PSBK_EUGMU        FR
PSBK_STAPU        FR
PSBK_CHAGL        FR
PSBK_NEPOL        FR
PSBK_ACAM1        FK
PSBK_SYNY3        FK
PSBK_THEEB        FR
PSBK_PHAAC        FR
PSBK_CHAVU        FR
PSBK_ADICA        FR
PSBK_CHLVU        FR
PSBK_MESVI        FR
                  *.