CLUSTAL format seed alignment for MF_00444

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CLPP1_RHOBA      -----------------------------MSDPFGSPFPSLHDQNLNAQHAMASDHRLAN
CLPP1_CYAPA      -------------------------------------MTILIQQYTNDEN----------
CLPP_ECOLI       -------------------------MSYSGERDNFAPHMALVPMVIEQTS----------
CLPP_BAUCH       -------------------------MSYSCEYT--PLNMALVPMVVERTL----------
CLPP_BLOPB       -----------------------MQCSHNFKTPYCHRMV-VVPTVIEHTI----------
CLPP_BLOFL       -----------------------MSYLYDSYFQYIHYNVSMIPTVVKQTS----------
CLPP_WIGBR       --------------------------------------MNLIPTVVEKNA----------
CLPP_BUCAI       ------------------------MLYDQIKNNKTSSYATFIPMVVEQHS----------
CLPP_BUCAP       -----------------------------MKSN-----SVLIPMVVEQHS----------
CLPP_BUCBP       -----------------------MTLYDKEINKN----SLLIPMVIEKTS----------
CLPP2_METCA      -----------------------------------------MPIVIEQSA----------
CLPP_NITOC       ---------------------------------MIDSLNTLVPMVVEQTA----------
CLPP_HAHCH       -----------------------------MNKLEIANA--LVPMVVEQTA----------
CLPP_CHRSD       ----------------------------MGNEFDISNAGGLVPMVVEQNA----------
CLPP_PSEF5       ----------------------MFRNSYIQQNSDIQAAGGLVPMVVEQSA----------
CLPP_PSEMY       ----------------------MSRNPFMQNMPEIQAAGGLVPMVIEQSA----------
CLPP1_PSEAE      ----------------------MSRNSFIPHVPDIQAAGGLVPMVVEQSA----------
CLPP_PHOPR       ---------------------------------MSPITDALVPMVVEQTS----------
CLPP_SHEAM       -----------------------------MHNAPESVFNALVPMVVEQTA----------
CLPP_IDILO       -----------------------------MSSDIQDPMAQLVPMVVEQTS----------
CLPP_PSEA6       -----------------------------MMNTPFDPTNALVPMVVEQTA----------
CLPP_COLP3       --------------MFNSQITSQRSSQVSSQSSATGIESALVPMVVEQTA----------
CLPP_PSET1       -----------------------------MNIGITDPLNALVPMVVEQTP----------
CLPP_HYDCU       -------------------------------MHSTPIQDALVPMVIEQTS----------
CLPP_ALCBS       ----------------------------MSQLIKDPTNLGLVPVVIEQTA----------
CLPP_SACD2       -----------------------MSNIDLSASSNLNVENTLVPMVVEQTA----------
CLPP_ACIAD       -------------------------------MYVPTIENALVPVVVEQSS----------
CLPP_PSYA2       ----------MTDYDRITANPHFDMLMSAHNHVQSTTQSALVPMVVEQSA----------
CLPP_HISS2       --------------------------------------MSVIPMVVEQTS----------
CLPP_HAEDU       --------------------------------------MAVIPMVVEQTS----------
CLPP_RUTMC       ---------------------------------MDIENLNQIPIVVEQSA----------
CLPP_LEGPL       --------------------------MPGYSDNIIRNASGLIPMVIEQTS----------
CLPP_COXBN       -------------------------------------MSVLVPMVVEQTS----------
CLPP_XYLFT       -------------------------------MDDVTKALNLVPMVVEQTS----------
CLPP_MAGSA       -------------------------------------MNTLVPMVVEQTN----------
CLPP_AZOBR       ------------------------------MYDFEPKMNALVPMVIEQTN----------
CLPP_RHORT       ---------------------------MIDRDPIDVFNNTLVPMVVEQTN----------
CLPP1_GLUOX      -------------------------MTIRDRDPLEVFSNSLVPMVVEQTA----------
CLPP_NOVAD       -------------MLDLFGASSAPTFGNQGKFTTDPVTGALIPVVVEQSS----------
CLPP_SPHAL       --------------------------------MIDPLA-ALVPVVVEQTS----------
CLPP_ZYMMO       -----------------------------MSHDHADIVNALIPMVVEQSN----------
CLPP_BARBK       -----------------------------MSDLVKTALS-LVPMVVEQTN----------
CLPP_BRUSU       -----------------------------MRDPIETVMN-LVPMVVEQTN----------
CLPP1_CHESB      -----------------------------MKNPVETAMN-LVPMVVEQTN----------
CLPP2_AGRFC      -----------------------------MKNPVDTAMA-LVPMVVEQTN----------
CLPP_CAUVC       -----------------------------MYDPVSTAMN-LVPMVVEQTS----------
CLPP_MARMM       -----------------------------MHDPQDVMMN-LVPIVVEQTS----------
CLPP_RUEPO       -----------------------------MFDPVDTYMNTLVPMVVEQTS----------
CLPP_DINSH       -----------------------------MHDPVDTYMN-LVPMVVEQTS----------
CLPP_RHOS5       -----------------------------MKDPIDLYMNTLVPMVVEQTS----------
CLPP_JANSC       -----------------------------MHDPVEYFQNNLVPMVVEQTS----------
CLPP_AZOC5       -----------------------------MRDPVDTYMNYLVPMVVEQTN----------
CLPP1_RHIEC      -----------------------------MREAMQ-----LVPMVIEQSS----------
CLPP1_BRADU      -----------------------------MRDMLQ-----LVPMVVEQSA----------
CLPP2_CHESB      -----------------------------MRDTMN-----LIPMVVEQSA----------
CLPP1_RHILO      -----------------------------MSGLAS-----LVPMVIEQSS----------
CLPP_PELUB       -----------------------------MTTNLLDQMNTLVPMVVEQSN----------
CLPP_ANAPZ       --------------------------------------MNLVPMVVEQTG----------
CLPP_EHRRG       --------------------------------------MTLVPMVVEPTS----------
CLPP_WOLPM       --------------------------------------MTLIPIVVEQTS----------
CLPP_RICPR       --------------------------------------MSYVPVVIEQTS----------
CLPP_RICBR       ----------------MRATPPRDDTYPSNENFKEKYPMSYVPIVIEQTS----------
CLPP_NEOSM       --------------------------------------MNLVPMVVDQTP----------
CLPP_RHOFT       ------------------------------MGAMQTQALGMVPMVIEQSG----------
CLPP_METPP       ------------------------------MSALETQNLGMVPVVIEQSG----------
CLPP_ACISJ       ------------------------------MSALETQALGMIPMVIEQSG----------
CLPP_RALSO       ----------------MIRNELIDQLARTQASALETQGLGLVPMVVEQSG----------
CLPP2_PARXL      ---------------MTFRAQMLDTLTSQSSRDLEAQALGLVPIVVETSG----------
CLPP_AROAE       ----------------------MNSAAPHGSSNWDPVGLGLVPMVVEQSG----------
CLPP_DECAR       -------------------------MNIDNASNWDPQALGLVPMVVEQSG----------
CLPP_BORA1       ---------------------------------MTPTGLGYIPMVVEQSG----------
CLPP_METFK       ----------------------MIHYPATAQSQFEAQGLGYIPMVIEQSG----------
CLPP_NITEC       ----------------------MQPILDWEKNELNTTGLGLIPMVIESSG----------
CLPP_NITMU       -----------------------MQRFEWKQRNHEPQDLGLIPMVIETSG----------
CLPP_THIDA       ------------------------MLYDFERTAPEPQGLGLVPMVVEQSG----------
CLPP1_PARXL      ----------------------------MHSSYPTITGLGLVPTVIEQSG----------
CLPP_NEIG1       ----------------------------------MSFDNHLVPTVIEQSG----------
CLPP_CHRVO       -----------------------------MKSMMEPQGLGLVPMVVEQSG----------
CLPP_DICNV       ---------------------------------MDIMNNLPIPMVVEQTG----------
CLPP_FRAP2       -----------------------------------MITNNLVPTVIEKTA----------
CLPP1_TREDE      -------------------------------------MSTLVPYVIEQTG----------
CLPP1_TREPA      ---------------------------------MRERMHNLVPYVIEQSG----------
CLPP_BORBP       -------------------------------------MHNLIPTVIEHTG----------
CLPP_CAMJJ       ---------------------------------------MFIPYVIEKSS----------
CLPP_WOLSU       --------------------------------------MNYIPYVIEKTG----------
CLPP_NITSB       -------------------------------------MSYYIPYVIERTG----------
CLPP_HELHP       -------------------------------------MSSYIPYVIERTG----------
CLPP_HELAH       --------------------------------------MGYIPYVIENTD----------
CLPP_CAMHC       ---------------------------------------MFVPYVIERTS----------
CLPP_SULNB       --------------------------------------MSYIPYVVEQTG----------
CLPP_ARCB4       --------------------------------------MSYIPYVVEKTG----------
CLPP_SULDN       --------------------------------------MSYIPYVVEKTA----------
CLPP_DESPS       --------------------------------------MNLIPMVVEQTP----------
CLPP_CHLTE       -------------MANINFGFDHHAKKLYSGAIENSINSQLVPMVIETSG----------
CLPP_AQUAE       -------------------------------MNHKEILDQLVPIVIEQTP----------
CLPP_CARHZ       -------------------------------------MSYLVPIVIEQTS----------
CLPP_DESRM       -------------------------------------MSGLVPIVVEQTN----------
CLPP_KORVE       ---------------------------------------MLVPMVIEQTS----------
CLPP_DESVV       ---------------------------------------MPVPIVIESTG----------
CLPP_DESAG       ---------------------------------------MPIPMVIESTG----------
CLPP_LAWIP       ---------------------------------MDDIFNMTVPIVVENNG----------
CLPP_GEOSL       ---------------------------------------MLVPIVVEQTG----------
CLPP_GEOUR       ---------------------------------------MLVPIVVEQTG----------
CLPP_PELPD       ---------------------------------------MYIPMVVEQSG----------
CLPP_PELCD       --------------------------------------MSLIPMVVEQTG----------
CLPP_SYNAS       --------------------------------------MNLIPMVVQQDG----------
CLPP1_NOSS1      ---------------------------------------MTIPIVIEQSG----------
CLPP1_SYNY3      ----------------------------------------MIPTVIETSG----------
CLPP1_PROMA      ----------------------------------------MIPIVVEETG----------
CLPP1_PROMP      ----------------------------------------MIPLVLEESG----------
CLPP1_SYNP6      ----------------------------------------MIPIVVEESG----------
CLPP3_TRIV2      ------------------MSSHLN------------GIGNIVPMVVEQSG----------
CLPP2_SYNY3      ----MVNSR--SPYRSPLSTLGGN------------NIQSVVPMVVEQSG----------
CLPP1_THEEB      ----MLQSRYDHPLSAILRSPALNLP---------PTHANIVPMVVEQSG----------
CLPP3_PROMT      ----------------------------------------MLPTVIEQSG----------
CLPP1_PROMM      ----MIDSYCYHPIHNRWQGIRPVS------------SPGILPTVVEQSG----------
CLPP3_PROMP      -----MYSEKKHLIQSSINSRDIDK------------SRSAVPTVVEQSG----------
CLPP2_SYNE7      ----MFSSHASLPIHSRRLAAGLDSRWQQPQIQAIAGSQAIVPTVVEQSG----------
CLPP2_SYNJA      ----------------------------------------MIPTVIEQSA----------
CLPP_FUSNN       ---------------------------------------MYNPTVIDNNG----------
CLPP2_MYXXA      ------------------------------------MPFMPVPYVIEQTH----------
CLPP2_MYXXD      ---------------------------------------MNVPFVIETTH----------
CLPP_ANADE       ------------------------------------MPYIPMPYVVEQTH----------
CLPP_LEPIN       --------------------------------------MSVIPYVIEQTS----------
CLPP_SYNFM       --------------------------------------MSLIPIVVEQSS----------
CLPP_LACDB       ---------------------------------------MLVPTVIEQTA----------
CLPP_LACP3       ---------------------------------------MLVPTVVEQTS----------
CLPP_LACSS       ---------------------------------------MLVPTVIEQTS----------
CLPP_LACJO       ---------------------------------------MLVPTVIEQTA----------
CLPP_LACPL       --------------------------------------MYPVPTVIEQSS----------
CLPP_LACBA       --------------------------------------MNLVPTVIEQSS----------
CLPP_LACRD       --------------------------------------MNLVPTVIEQSS----------
CLPP_LACS1       --------------------------------------MNLVPTVIEQSS----------
CLPP_STRA3       ----------------------------------------MIPVVIEQTS----------
CLPP_LACLS       -------------------------------------MGYLVPTVIEQSS----------
CLPP1_DESHY      -------------------------------------MSQLVPMVIEQTS----------
CLPP1_SYMTH      -------------------------------------MSYLIPYVIEQTN----------
CLPP2_SYMTH      -------------------------------------MSSLIPIVIEQTS----------
CLPP_BDEBA       ---------------------------MTPQSQPQETAVALIPYVIEQTS----------
CLPP_SYNWW       -------------------------------------MSYLVPMVVEQTN----------
CLPP_MOOTA       -------------------------------------MSVLVPMVVEQTS----------
CLPP_ALKMQ       --------------------------------------MALVPVVVEQTS----------
CLPP_CALS8       -------------------------------------MSALVPIVIEQTN----------
CLPP_HUNT2       --------------------------------------MSLVPIVVEQTN----------
CLPP_CALS4       --------------------------------------MSLVPIVVEQTN----------
CLPP_CLOTE       --------------------------------------MSLVPVVVEQTN----------
CLPP_CLOK5       --------------------------------------MSLVPVVVEQTN----------
CLPP_CLOB1       --------------------------------------MSLVPVVVEQTN----------
CLPP_CLOAB       --------------------------------------MSLVPYVIEQTS----------
CLPP_CLOPS       -------------------------------------MSNLVPMVVEQTS----------
CLPP2_DESHY      -------------------------------------MSYLVPMVIEQTN----------
CLPP1_BACHD      --------------------------------------MNLIPTVIEQTN----------
CLPP2_BACSK      --------------------------------------MNLIPTVIEQTN----------
CLPP_OCEIH       --------------------------------------MNLVPTVIEQTN----------
CLPP_GEOKA       --------------------------------------MYLIPTVIEQTN----------
CLPP2_BACC1      --------------------------------------MNLIPTVIEQTN----------
CLPP_LISIN       --------------------------------------MNLIPTVIEQTS----------
CLPP_ENTFA       --------------------------------------MNLIPTVIEQSS----------
CLPP_STAS1       --------------------------------------MNLIPTVIETTN----------
CLPP1_BACSK      -------------------------------------MNIPIPYVMEQTR----------
CLPP2_BACLD      -------------------------------------MN-TIPYVIEKTA----------
CLPP1_BACC1      -------------------------------------MN-AIPYVVEQTK----------
CLPP2_BACHD      -------------------------------------MNGYVPYVIEQSG----------
CLPP_THEMA       -----------------------------MTVKEKKIIDQYVPIVVESTG----------
CLPP_PSELT       ----------------------------------MKITDQLIPTVIESTG----------
CLPP2_CHLPN      --------------------------------------MTLVPYVVEDTG----------
CLPP2_PARUW      ----------------------------MSHSSHPRPEMSLTPYVIEDTG----------
CLPP2_RHOBA      --------------------------------------MPVIPYVVESNG----------
CLPP2_SALRD      --------------------MTSLPGGIYDGDLGDQPMSGLVPMVVEQTT----------
CLPP1_SALRD      --------------------MTSLPSSIFQGGLGDQPQSGLVPKVVEQTT----------
CLPP_THET2       ---------------------------------------MVIPYVIEQTA----------
CLPP_DEIGD       --------------------------------------MSVIPYVIEQTG----------
CLPP_DEHM1       ----------------------------------MISPENVVPMVIESSA----------
CLPP2_FRACC      -----------------------MRHEQARQAAAQPQGRYVLPNIIEKTS----------
CLPP3_FRACC      -----------------------------MLGGGAPRARHVLPNIVERTS----------
CLPP2_CORJK      --------------MSEMQ---------------MPEMRYILPSFVEHSS----------
CLPP1_RHOJR      --------------MTNLFD-P---RSLGGQAPAGPQSRYILPSFIEHSS----------
CLPP1_THEFY      --------------MSEFNF-DPYRRYGGGMAPMAPQSRYVLPSYIERTA----------
CLPP2_TROW8      ---------------------------------MYPNSRYILPSLDERTA----------
CLPP2_LEIXX      -----------------MLG-GSAHGGPVFGGVQAPGARYILPSFEERTA----------
CLPP4_STRAW      --------------MNDYPGSGLHARTQAEYTGARAESRYVIPRFVERTS----------
CLPP5_STRAW      --------------------------------MNRPSARYALPEFTERLS----------
CLPP1_BIFLO      MASEEAKFAARADRLAGRQGVAGFMPASARAAQPAPTNRYIMPQFVEKTP----------
CLPP1_CUTAK      MNAEQAEQAAPG----------GLAPAG-------PRNDYYIPQWEERTS----------
CLPP4_RHOJR      ------------------------------------MSQYTIPHVIERTP----------
CLPP_RUBXD       --------------------------------MSYYDPQGVIPYVIEQSP----------
CLPP_BACTN       -----------MDDFRKYATKHLGMNGMVLDDVIKSQAGYLNPYILEERQ----------
CLPP_PORGI       -----------MNEFKKYATRHIGLNAQALDDYTRIQSSYISPTIIEERQ----------
CLPP1_CORJK      ---------------------------------------------MSSET----------
CLPP2_COREF      -------------------------------------MSDNLNMTAPGAG----------
CLPP2_RHOJR      -------------------------------------------MTSATAG----------
CLPP2_MYCPA      ----------------------------------------MSDMRSPSQG----------
CLPP1_FRACC      ------------------------MSNIAAPRLPVPGP----DLRAPGQG----------
CLPP4_FRACC      -----------------------MIESFSRLTQAGPGSPRRATVQAAASG----------
CLPP2_CUTAK      -----------------------------MSHNTSIASQGMPAMAGPETG----------
CLPP3_STRCO      ----------------------------MSPFTAGPAPARTPRAEEGDTP----------
CLPP1_STRAW      ----------------------------MTPLTTGWHPALSPRAEEGDTP----------
CLPP3_RHOJR      -------------------------------------------MTTAALP----------
CLPP2_THEFY      ------------------------------------MPPTHNEFMRTDVP----------
CLPP1_TROW8      ----------------------------------MSET----------------------
CLPP1_LEIXX      ----------------------------------MADMGI--------------------
CLPP2_BIFLO      ----------------------------------MSNTFATLPVMAGDDV----------
CLPP3_STRAW      -----------------------MRRPGAVVRRAGGYVTNLMPTAAGDPI----------
CLPP3_NOSS1      ----------------------------------MPIGVPKVPYRMP-GG----------
CLPP2_THEEB      ----------------------------------MPIGVPKVPYRLP-GE----------
CLPP1_SYNJA      ----------------------------------MPIGVPRVPYRLP-GE----------
CLPP2_SYNP6      ----------------------------------MPIGVPSVPYRLP-GS----------
CLPP_RIPO1       ----------------------------------MPLGVPSVPYRLP-GS----------
CLPP2_PROMP      ----------------------------------MPIGTPSVPYRLP-GS----------
CLPP1_GLOVI      ----------------------------------MPIGIPKVPYRLP-GG----------
CLPP2_GLOVI      -----------------------------MSELANYGPGAIRAAYSGDYG----------
CLPP1_CHLMU      -----------------------------------MPEGE-----MMHKL----------
CLPP1_PARUW      -----------------------------MTRETSMPKHDKNKSAIPSKM----------
CLPP2_LEPIC      -----------------------------------MPETEKIAEVFEELT----------
CLPP3_RHIME      ---------MRN-------------------------DDDQEEKKTELPL----------
CLPP3_AGRFC      ---------MNYAG-------------------EPLMNEDEDDKSKELPI----------
CLPP2_GLUOX      ---------MHAGSGNDMDITRMTPTRLDDEPDAPEPETREDDNKTLNSP----------
CLPP2_PSEAE      ---------MKTD------------------------DKDREGGDSHGAI----------
CLPP_PARDE       ---------MTTSA----------------------ARKGLRTRGSACPR----------
CLPP2_TREPA      ----------MRC------------------------DATQEKRAHSESG----------
CLPP2_TREDE      ---------MNFI------------------------NETNEEKKNKTND----------
CLPP2_BORBU      --------------------------------------MTGKEDNDACVL----------
CLPP_OLTVI       -------------------------------------MPIGVPKVPFRLPG---------
CLPP_TUPAK       -------------------------------------MPIGVPKVPYRLAG---------
CLPP_OSTTA       -------------------------------------MPIGVPKVAYRLPG---------
CLPP_NEPOL       -------------------------------------MPVGVPKVPYRLPG---------
CLPP_CHLAT       -------------------------------------MPIGIPKVAYRIPG---------
CLPP_PLETE       -------------------------------------MPVGVPKVFYALPD---------
CLPP_ADICA       -------------------------------------MPIGVPKVPFRLPG---------
CLPP_HUPLU       -------------------------------------MPIGVPKVPFRLPG---------
CLPP_CYCTA       -------------------------------------MPIGVPKVPFRIPG---------
CLPP_ZYGCR       -------------------------------------MPIGVPKVPFRIPG---------
CLPP_CHAVU       -------------------------------------MPIGVPKVPFRLPG---------
CLPP_CHAGL       -------------------------------------MPVGVPKVPYRLPG---------
CLPP_PINKO       -------------------------------------MPVGVPKVPFRAPG---------
CLPP_ACOGR       -------------------------------------MPIGVPKVLFGSPG---------
CLPP_AMBTC       -------------------------------------MPVGVPKVPFRSPG---------
CLPP_CUCSA       -------------------------------------MPVGVPKVPFRLPG---------
CLPP_EPIVI       -------------------------------------MPIGVPKVPFQIPG---------
CLPP_PHAVU       -------------------------------------MPIGVPRVPFRTPG---------
CLPP1_ARATH      -------------------------------------MPIGVPKVPFRSPG---------
CLPP_POPTR       -------------------------------------MPIGVPKVPFRNPG---------
CLPP_VITVI       -------------------------------------MPIGVPKVPFRNPG---------
CLPP_CITSI       -------------------------------------MPIGVPKVPYRSPG---------
CLPP_SOLLC       -------------------------------------MPIGVPRVVFRNPG---------
CLPP_AGRST       -------------------------------------MPIGVPKVPYRIPG---------
CLPP_CUSRE       -------------------------------------MPIGVPRVRFQYRR---------
CLPP_CUSGR       -------------------------------------MPIGVPRVRFLYDE---------
CLPP_PELHO       -------------------------------------MPVGVPKVPFLNPNPDPEPDSVE
CLPP_OENEH       -------------------------------------MPIGMPKIPFLLDG---------
CLPP_BIGNA       -------------------------------------MPIGIPKVLFKEST---------
                                                                             

CLPP1_RHOBA      AASYQSYQRQRQMTLG-DLLLENRIVFMQ------GEIHYANANEIVMKLLYLQSENRRK
CLPP1_CYAPA      --------KKLELNNI-SKLLQNRIILFS------QTVDDEICNSIVGQLLYLENEDSTK
CLPP_ECOLI       -------RGERSFDIY-SRLLKERVIFLT------GQVEDHMANLIVAQMLFLEAENPEK
CLPP_BAUCH       -------RGERSYDIF-SRLLKERIIFMT------GKVEDYMANIIVAQMIFLEAENPEK
CLPP_BLOPB       -------RGDRVYDIF-SLLLKERIIFMT------GTIEDSVANLIVAQMMFLESENSEK
CLPP_BLOFL       -------RGDRAYDIF-SLLLKERIIFVI------GKIENFMANLIVAQIMFLESEDPVK
CLPP_WIGBR       -------RGERSYDIF-SRLLKERIIFVT------GKIEDYMANLIIAQMIFLESEDPEK
CLPP_BUCAI       -------RGERSYDIY-SRLLKERIIFIT------GAIEDNMANNIVAQILFLEAENPEK
CLPP_BUCAP       -------RGERSYDIY-SRLLKERIIFIT------GTIEDNMASSIVAQMLFLEAESLDK
CLPP_BUCBP       -------YGERSYDIY-SRLLKERIIFLT------GTIDDNTANLIVAQMLFLEAENAKQ
CLPP2_METCA      -------RGERAFDIY-SRLLKERVIFLV------GQVEDYMANLVIAQLLFLESENPDK
CLPP_NITOC       -------RGERAYDIY-SRLLKERVVFLV------GPVEDHMANLVVAQLLFLESENPDK
CLPP_HAHCH       -------RGERSYDIY-SRLLKERIIFLV------GQVEDHMANLVVAQLLFLESENPDK
CLPP_CHRSD       -------RGERAYDIY-SRLLKERVIFLI------GPVEDYMANLVVAQMLFLESENPDK
CLPP_PSEF5       -------RGERAYDIY-SRLLKERVIFLV------GPVEDYMANLICAQLLFLEAENPDK
CLPP_PSEMY       -------RGERAYDIY-SRLLKERVIFLV------GQVEDYMANLICAQLLFLEAENPDK
CLPP1_PSEAE      -------RGERAYDIY-SRLLKERIIFLV------GQVEDYMANLVVAQLLFLEAENPEK
CLPP_PHOPR       -------RGERSYDIY-SRLLKERVIFLT------GQVEDHMANLVVAQLLFLESENPDK
CLPP_SHEAM       -------KGERSYDIY-SRLLKERVIFLV------GQVEEHMANLIVAQLLFLESENPDK
CLPP_IDILO       -------KGERSYDIY-SRLLKERVIFCC------GQVEDHMANLIVAQLLFLESDNPDK
CLPP_PSEA6       -------KGERSYDIY-SRLLKENVIFMV------GQVEDHMANLIVAQMLFLEAENPEK
CLPP_COLP3       -------KGERSYDIY-SRLLKERVIFLC------GQVEDHMANLIIAQLLFLESESPDK
CLPP_PSET1       -------KGERSYDIY-SRLLKERIIFLT------GPVEDNMANLILAQMLFLESENPDK
CLPP_HYDCU       -------RGERSFDIY-SRLLKERVIFLV------GQVEDHMANLIVAQLLFLESENPDK
CLPP_ALCBS       -------RGERSFDIY-SRLLKERVIFMI------GQVEDHMANLIVAQMLFLESENPDK
CLPP_SACD2       -------RGERSYDIY-SRLLKERVIFLV------GQVEDHMANLVVAQMLFLEAENPDK
CLPP_ACIAD       -------RGERSFDIF-SRLLRERVIFLT------GEVEDNMANLIVAQMLFLEAENPDK
CLPP_PSYA2       -------RGERSFDIF-SRLLRERVIFLT------GQVEDHMANLIVAQLLFLEAENPDK
CLPP_HISS2       -------RGERSYDIY-SRLLKERVIFLT------GEVEDRMANLIVAQLLFLEAEDPAK
CLPP_HAEDU       -------KGERSYDIY-SRLLKERIIFLN------GEVEDHMANLIVAQLLFLEAEDPEK
CLPP_RUTMC       -------RGERAYDIY-SRLLKERIIFLV------GPIEDYMANVVVAQLLFLESENPDQ
CLPP_LEGPL       -------RGERSYDIY-SRLLKERIIFLL------GEVEDHMANLVVAQLLFLESENPEK
CLPP_COXBN       -------RGERAYDIY-SRLLKDRVIFLV------GQVEDHMANLAIAQMLFLESENPNK
CLPP_XYLFT       -------RGERAYDIY-SRLLKERLIFLV------GPIDDYMANLIVAQLLFLEAENPEK
CLPP_MAGSA       -------RGERSYDIY-SRLLKERIIFLT------GQVYDEVASLICAQLLFLESENPSK
CLPP_AZOBR       -------RGERGYDIY-SRLLKERIIFLI------GGVNDAVASLICSQLLFLESENPSK
CLPP_RHORT       -------RGERSYDIY-SRLLKERIIFLT------GQVHDGVASLICAQLLFLESENPSK
CLPP1_GLUOX      -------RGERSFDIF-SRLLQERIIFLT------GPVYDQVSSLICAQLLYLESVNPTK
CLPP_NOVAD       -------RGERSFDIY-SRLLRERIIFVT------GEVEDHMASVIIAQLLFLESENPSK
CLPP_SPHAL       -------RGERSFDIF-SRLLRERIVFVT------GEVEDNMASLIVAQLLFLESENPKK
CLPP_ZYMMO       -------RGERSFDIY-SRLLRERIIFVT------GQVEDHMASVICAQLLFLEAENPKK
CLPP_BARBK       -------RGERAYDIF-SRLLKERIIFIN------GPVEDSMAMLVCAQLLFLEAENPKK
CLPP_BRUSU       -------RGERAYDIF-SRLLKERIIFVN------GPVEDGMSMLVCAQLLFLEAENPKK
CLPP1_CHESB      -------RGERAYDIF-SRLLKERIIFIT------GPVEDGMATLVCAQLLFLEAENPKK
CLPP2_AGRFC      -------RGERSYDIF-SRLLKERIIFLT------GPVEDQMASLVCAQLLFLEAENPKK
CLPP_CAUVC       -------RGERAFDIF-SRLLKERIIFLT------GPVEDGMASLICAQLLFLESENPKK
CLPP_MARMM       -------RGERSFDIY-SRLLKERIIFIT------GPIEDHMASLIIAQLLFLESENPKK
CLPP_RUEPO       -------RGERAYDIF-SRLLKERIIFIN------GPIHDGMSHLIVAQLLHLEAENPNK
CLPP_DINSH       -------RGERAYDIF-SRLLKERIVFVN------GPVHDGMSQLVVAQLLHLEAENPSK
CLPP_RHOS5       -------RGERAYDIF-SRMLKERIIFLS------GPVHDGMSSLICAQLLFLEAENPSK
CLPP_JANSC       -------RGERAYDIF-SRLLKERIVFVN------GPVHSGMSHLIVAQLLHLEAENPSK
CLPP_AZOC5       -------RGERAYDIY-SRLLKERIIFLT------GPVEDGMSTLAVAQLLFLEAENPKK
CLPP1_RHIEC      -------RGERSFDIY-SRLLRERIIFLN------GEVNDTVSALVCAQLLFLEAD-PEK
CLPP1_BRADU      -------RGERSFDIY-SRLLRERIIFLN------GEVNDAMSGLVCAQLLFLEAENPNR
CLPP2_CHESB      -------RGERSFDIF-SRLLRERIIFLN------GQVDDNSAALVCAQMLHLEAENPKK
CLPP1_RHILO      -------RGERAFDIF-SRLLRERIIFIN------GEINDDVSALVCAQLLSLESDNPDK
CLPP_PELUB       -------KGERAYDIY-SRLLKERIIFLV------GPINDNVASLVTAQLLFLESEDPKK
CLPP_ANAPZ       -------RGERAYDIY-SRLLKERIIFVT------GPIEDEMASLIVAQLVFLEAEDPEK
CLPP_EHRRG       -------RGERAYDIY-TRLLKERIIFIT------GPIEDQMASLVVAQLIFLEAENPEK
CLPP_WOLPM       -------RGERAYDIY-SRLVKERIIFVT------GPIEDNMASVIVAQLLFLESENPNK
CLPP_RICPR       -------RGERAYDIY-SRLLKERIIFVC------STVEDHMANLIVAQLLFLEAENPKK
CLPP_RICBR       -------RGERAYDIY-SRLLKERIIFVC------GPIEDHMANLITAQLLFLEAENPEK
CLPP_NEOSM       -------RGERAYDIF-SRLLKERVVFLT------GPIEDGMASLIVAQLLFLEAENPDK
CLPP_RHOFT       -------RGERSYDIY-SRLLKERVIFLV------GPVNDYVANLVVAQLLFLESDNPDK
CLPP_METPP       -------RGERAYDIY-SRLLRERVIFLV------GPVNDQTANLVVAQLLFLESENPDK
CLPP_ACISJ       -------RGERSYDIY-SRLLKERVIFLV------GEVNDQTANLVVAQLLFLESENPDK
CLPP_RALSO       -------RGERAYDIY-SRLLKERVIFMV------GEVNDQTANLVVAQLLFLESENPDK
CLPP2_PARXL      -------RGERSYDIY-SRLLKERIVFLV------GEVNDQTANLVVAQMLFLESENPDK
CLPP_AROAE       -------RGERAYDIY-SRLLKERVIFLV------GPVNDVTANLIVAQLLFLESENPDK
CLPP_DECAR       -------RGERAYDIY-SRLLKERVIFLV------GPVNDVTANLVVAQLLFLEAENPDK
CLPP_BORA1       -------RGERAYDIY-SRLLRERLIFLV------GPVNDATANLVVAQLLFLESENPDK
CLPP_METFK       -------RGERSYDIY-SRLLKERIIFLV------GPVNDATANLVVAQLLFLEAENPDK
CLPP_NITEC       -------RGERAYDIY-SRLLRERIIFLV------GPVTETSANLVIAQLLFLESENSEK
CLPP_NITMU       -------RGERAYDIY-SRLLRERVIFLV------GPVTEASANLIVAQLLFLESENADK
CLPP_THIDA       -------RGERAYDIY-SRLLKERVIFLV------GPVNDATANLIVAQMLFLESENPDK
CLPP1_PARXL      -------RGERAYDIY-SRLLRERIVFLV------GPVNEQSASVIVAQLLFLESENPDK
CLPP_NEIG1       -------RGERAFDIY-SRLLKERIVFLV------GPVTDESANLVVAQLLFLESENPDK
CLPP_CHRVO       -------RGERAYDIY-SRLLKERIVFLV------GPVTDESANLVVAQMLFLESENPDK
CLPP_DICNV       -------RGERAFDIY-SRLLKERVVFLV------GEVNDASANLVVAQLLFLEAENPDQ
CLPP_FRAP2       -------GGERAFDIY-SRLLKERIVFLN------GEVNDHSANLVIAQLLFLESEDPDK
CLPP1_TREDE      -------NGERSYDIF-SRLLKDRIIFVD------GEINDMSADLVVAQLLFLEAQNPDK
CLPP1_TREPA      -------GGERSYDIF-SRLLKDRIIFVD------GEITDAVADLVVAQLLFLESQNPDK
CLPP_BORBP       -------NYERVFDIY-SRLLRERIIFLS------GEINDLKADTVIAQLLFLESEDSNK
CLPP_CAMJJ       -------RGERSYDIY-SRLLKDRIIMLS------GEIHDELAASIVAQLLFLEAEDPTK
CLPP_WOLSU       -------RGERSYDIY-SRLLKDRIIMLS------GEINDGVASSIVSQMLFLEAEDPEK
CLPP_NITSB       -------RGERSYDIY-SRLLKDRIIMLS------GEINDAVASSIVAQLLFLEAEDPDK
CLPP_HELHP       -------RGERSYDIY-SRLLKDRIILLS------GEINDHIASSIVAQLLFLEAEDPEK
CLPP_HELAH       -------RGERSYDIY-SRLLKDRIVLLS------GEINDSVASSIVAQLLFLEAEDPEK
CLPP_CAMHC       -------RGERSYDIY-SRLLKDRIVMLS------GEINDEVASSVVAQLLFLEAEDPDK
CLPP_SULNB       -------RGERSYDIY-SRLLKDRIIMLS------GEVNDQVASSIVAQLLFLEAQDPDK
CLPP_ARCB4       -------RGERSYDIY-SRLLKDRIIMLS------GEINDAVASTVVAQLLFLEAEDPDK
CLPP_SULDN       -------RGERSYDIY-SRLLKDRIIMLS------GEVNDAVASSIVAQMLFLEAEDPEK
CLPP_DESPS       -------RGERSYDIY-SRLLKERIIFLG------SGVNDDVANVIVAQLLFLEAEDPEK
CLPP_CHLTE       -------RGERAFDIF-SRLLRERIIFLG------SPIDEHVAGLIIAQLIFLESEDPER
CLPP_AQUAE       -------RGERAYDIY-SRLLQDRIVLLG------SPIDDHVANLIVAQLLFLESQDPDK
CLPP_CARHZ       -------RGERSYDIW-SRLLKDRTIFIG------GPIDDHVANLVIAQMLFLEAEDPEK
CLPP_DESRM       -------RGERAYDIY-SRLLKDRIIFIG------GPIDDHIANLVIAQFLFLEAEDPEK
CLPP_KORVE       -------RGERAYDIY-SRLLRDNIIFLG------TPIDDNVANLIIAQMLFLEAEDPEK
CLPP_DESVV       -------RAERAYDIY-SRLLKDRIVLLG------TPIDDQVASLICAQLLFLESENPEK
CLPP_DESAG       -------RAERAYDIY-SRLLKDRIILLG------TPVDDNVASLICAQLLFLESENPEK
CLPP_LAWIP       -------RNERAYDIY-SRLLKDRIVLLG------TEVNDQVASLICAQLLFLESQDPEK
CLPP_GEOSL       -------RGERSYDIY-SRLLKDRIIFLG------GPVDDHVANLVIAQMLFLEAEDPDK
CLPP_GEOUR       -------RGERSYDIY-SRLLKDRIVFLG------GAIDDAISNLVIAQLLFLEAEDPDK
CLPP_PELPD       -------RGERAYDIY-SRLLKERIIFLG------GGIDDQVANLIIAQLLFLEAEDPDK
CLPP_PELCD       -------RGERAYDIF-SRLLKDRIIFLG------GAVDDQVANLIIAQMLFLESEDPEK
CLPP_SYNAS       -------RGERAYDIY-SRLLKDRIIFLG------TPIDDEVANLIIAQLLFLESEDPDK
CLPP1_NOSS1      -------RGERAFDIY-SRLLRERIVFLG------QQVDSNLANLIVAQLLFLDAEDPEK
CLPP1_SYNY3      -------RGDRAFDIY-SRLLRERIVFLG------QEVRDENANLVVAQLLFLEAEDPEK
CLPP1_PROMA      -------RGERAFDIY-SRLLRERIVFLG------EQVTNDSANRIVAQLLFLEAEDPEK
CLPP1_PROMP      -------GSERVFDIY-SRLLRERIIFLG------EQVTSDTANRIVAQLLFLEAEDPEK
CLPP1_SYNP6      -------RGERAFDIY-SRLLRERIIFLG------EPVTSDVANRIVAQLLFLEAEDPEK
CLPP3_TRIV2      -------MGERAFDIY-SRLLRERIIFLG------TPIDDAVANTIVAQLLFLDAEDSEK
CLPP2_SYNY3      -------MGERAFDIY-SRLLRERIIFLG------TPVDDQVADSIVAQLLFLDAEDPEK
CLPP1_THEEB      -------RGERAFDIY-SRLLRERIIFLGGGAGDRRGIDDAVADSIVAQLLFLDAEDPEK
CLPP3_PROMT      -------QGDRAFDIY-SRLLRERIIFLG------TDVNDQVADALVAQMLFLEADDPEK
CLPP1_PROMM      -------RGERAFDIY-SRLLRERIIFLG------TGVDDQVADALVAQMLFLEAEDPEK
CLPP3_PROMP      -------RGERAFDIY-SRLLRERIIFLG------TGINDQVSDSLVAQLLFLEAEDPHK
CLPP2_SYNE7      -------RGERAFDIY-SRLLRERIVFLG------TGVDDAVADSIVAQLLFLEAEDPEK
CLPP2_SYNJA      -------RGERAFDIY-SRLLRDRIIFLG------TQVDDDIANLIVAQMLYLESEDPEK
CLPP_FUSNN       -------KSERAYDIY-SRLLKDRIIFVG------TAIDETVANSIIAQLLYLEAEDPEK
CLPP2_MYXXA      -------RGERSYDII-SRLLKDRIVMLG------TEIDDDVANVIVAQLLFLESEDPDK
CLPP2_MYXXD      -------RGERAYDLY-SRLLKDRIIMLG------TPVNDDVANIIVAQLLFLESEDPDK
CLPP_ANADE       -------RGERSYDIY-SRLLKDRIIFLG------TPVDDDVANVIIAQLLFLESEDPDK
CLPP_LEPIN       -------RGERSYDIF-SRLLKDRIIFLG------NAINDDYANVITAQLLFLEAENPER
CLPP_SYNFM       -------RGERAFDIY-SRLLRDRIIFLG------TAITDEVANVIIAQLLFLESEDPDK
CLPP_LACDB       -------RGERAYDIY-SRLLKDRIIMLS------GDVNDQMANSIIAQLLFLDAQDNTK
CLPP_LACP3       -------RGERAYDIY-SRLLKDRIIMLS------GEVNDQMANSVIAQLLFLDAQDSEK
CLPP_LACSS       -------RGERAYDIY-SRLLKDRIIMLS------GEVNDQMANTIIAQLLFLDAQDSDK
CLPP_LACJO       -------RGERAYDIY-SRLLKDRIIMLS------GEINDQMANSIIAQLLFLDAQDNTK
CLPP_LACPL       -------RGERAYDIY-SRLLKDRIIMLS------GPIEDNMANAIIAQLLFLDAQDSGK
CLPP_LACBA       -------RGERAYDIY-SRLLKDRIIMLS------GPIEDDMANAIIAQLLFLDAQDSTK
CLPP_LACRD       -------RGERAYDIY-SRLLKDRIIMLS------GPIEDEMANSIVAQLLFLDAQDSTK
CLPP_LACS1       -------QGERAYDIY-SRLLKDRIIMVS------GEVNDDMANAIIAQLLFLDAQDSEK
CLPP_STRA3       -------RGERSYDIY-SRLLKDRIIMLT------GQVEDNMANSIIAQLLFLDAQDNTK
CLPP_LACLS       -------RGERAYDIY-SRLLKDRIIMLT------GPVEDGMANSIIAQLLFLDAQDNTK
CLPP1_DESHY      -------RGERSCDIF-SRLLNDRVVMLN------GMVTNESASLIIAQMLFLESADCDK
CLPP1_SYMTH      -------RGERSYDIY-SRLLKDRIVFLG------TPIDDQVANVVIAQLLFLESEDPDK
CLPP2_SYMTH      -------RGERSYDIY-SRLLKDRIIFLG------TSIDDQVANAVTAQLLFLESDDPDK
CLPP_BDEBA       -------KGERSYDIY-SRLLKDRIIILG------TAVTDEVANSIIAQMLFLEVDNPEK
CLPP_SYNWW       -------RGERSYDIY-SRLLKDRIIFLG------SGIDDTVANLVIAQLLFLEAEDPDK
CLPP_MOOTA       -------RGERAYDIY-SRLLKDRIIFLG------SAIDDHVANLVIAQMLFLEAEDPDK
CLPP_ALKMQ       -------RGERSYDIF-SRLLKERIIFLG------DEINDVTASLLVAQLLFLEAEDPDK
CLPP_CALS8       -------RGERAYDIY-SRLLKDRIVILS------GEITDDIASLIVAQLLFLEAEDPDK
CLPP_HUNT2       -------RGERSYDIY-SRLLKDRIIVLS------DEINDVTASLVVAQMLFLEAEDPDK
CLPP_CALS4       -------RGERAYDIF-SRLLKDRIVFLG------DEINDTTASLVIAQMLFLEAEDPDK
CLPP_CLOTE       -------RGERSYDIY-SRLLKDRIIMLS------DQVNDVTASLIVAQLLFLEAEDPDK
CLPP_CLOK5       -------RGERSYDIY-SRLLKDRIVMLS------EEVNDVTASLIVAQLLFLEAENPDK
CLPP_CLOB1       -------RGERSYDIY-SRLLKDRIIMLS------EEVNDTTASLIVAQLLFLEAEDPDK
CLPP_CLOAB       -------RGERSYDIY-SRLLKDRVIFLG------EEVNDTTASLVVAQLLFLESEDPDK
CLPP_CLOPS       -------KGERSYDIF-SRLLKDRIIMLS------GEVNDVTANLVVAQLLFLESEDPDK
CLPP2_DESHY      -------RGERSYDIY-SRLLKDRIIFLG------GPVTDDVANLVVAQMLFLEAEDPEK
CLPP1_BACHD      -------RGERAYDIY-SRLLKDRIIMLG------TAIDDNVANSIVAQLLFLQAEDPDK
CLPP2_BACSK      -------RGERAYDIY-SRLLKDRIIMLG------SGVDDNVANSIVAQMLFLQAEDPEK
CLPP_OCEIH       -------RGERAYDIY-SRLLKDRIILLG------SGIDDNVSNSIVAQLLFLEAEDPDK
CLPP_GEOKA       -------RGERAYDIY-SRLLKDRIVFLG------SPIDDQVANSIVSQLLFLAAEDPDK
CLPP2_BACC1      -------RGERAYDIY-SRLLKDRIIMLG------SAIDDNVANSIVSQLLFLESQDPDK
CLPP_LISIN       -------RGERAYDIY-SRLLKDRIIMLG------SAIDDNVANSIVSQLLFLDAQDPEK
CLPP_ENTFA       -------RGERAYDIY-SRLLKDRIIMLS------GPIDDNVANSVIAQLLFLDAQDSEK
CLPP_STAS1       -------RGERAYDIY-SRLLKDRIIMLG------SQIDDNVANSIVSQLLFLQAQDAEK
CLPP1_BACSK      -------YGERSYDIY-SRLLKDRIIFIG------DEITDTLANSVTAQLLFLASTDPEK
CLPP2_BACLD      -------AGERSYDIF-SRLLKDRIIMIG------SEFNDDLANRVTAQLLFLSAEDNEK
CLPP1_BACC1      -------LGERSYDIY-SRLLKDRIIIIG------SEINDQVASSVVAQLLFLEAEDAEK
CLPP2_BACHD      -------LSERSYDIY-SRLLKDRIVFLG------AAIDDQIANSIVAQLLFLEAENPKK
CLPP_THEMA       -------RYERAYDIF-SRLLKDRIVFLG------SPIDDYVANLVIAQLLFLEAEDPDK
CLPP_PSELT       -------RYERAYDIY-SRLLKDRIVFLG------YAIDDHVANLVVAQLLFLEAEDPDK
CLPP2_CHLPN      -------RGERAMDIY-SRLLKDRIVMIG------QEITEPLANTVIAQLLFLMSEDPKK
CLPP2_PARUW      -------RGERSMDIY-SRLLKDRIIFIG------TEITDQVANVVVAQLLFLKMEDPKK
CLPP2_RHOBA      -------REERTYDIY-SRLLKDRIIFLG------QQVDDQISNALVAQMLFLQADDPKK
CLPP2_SALRD      -------RGERAYDIF-SRLLKERIVFIG------TPINDQIANLTVAQLLYLASESSEK
CLPP1_SALRD      -------RGERAYDIF-SRLLKERIVFIG------TPINDQIANLTVAQLLYLESEGSSQ
CLPP_THET2       -------RGERVYDIY-SRLLKDRIIFLG------TPIDAQVANVVVAQLLFLDAQNPNQ
CLPP_DEIGD       -------RGERMYDIY-SRLLKDRIIFVG------TPIESQMANTIVAQLLLLDSQNPDQ
CLPP_DEHM1       -------RGERAFDIY-SLLLKERIIFLG------SQINDQVANLVIAQLLFLDREDPDK
CLPP2_FRACC      -------RGEYGMDPY-SKLLKERIVFLG------VQIDDVSANDVMAQLLFLESEDPDR
CLPP3_FRACC      -------RGEYSMDPY-SKLLKERIVFLG------VQIDDVSANDVMAQLLFLESEDPDR
CLPP2_CORJK      -------YGAKESNPY-NKLFEERIIFLG------TQVDDASANDIMAQLLVLEGLDPDR
CLPP1_RHOJR      -------YGVKESNPY-NKLFEERIIFLG------VQVDDASANDVMAQLLVLESLDPDR
CLPP1_THEFY      -------YGVKEMNPY-NKLFEERIIFVG------VQIDDTSANDIIAQMMTLEHIDSDR
CLPP2_TROW8      -------YGYKQVDPY-TKLFEDRIVFLG------VQIDDASADDVMAQLLVLEGQDAER
CLPP2_LEIXX      -------YGYKRQDPY-AKLFEDRIIFLG------VQVDDASADDIMAQLLVLESQDPDR
CLPP4_STRAW      -------QGVREYDPY-AKLFEERVIFLG------VQIDDASANDVMAQLLCLESMDPDR
CLPP5_STRAW      -------TGLRTLDPY-SKLLDERIVFLG------TPIDDTSANDVMAQFMHLEHLAPDR
CLPP1_BIFLO      -------YGMKTQDAY-SRLFEDRIIFLG------VQVDDASADDVMAQLLVLESQDPNR
CLPP1_CUTAK      -------YGVRRVDPY-TKLFEDRIIFLG------TPVTDDIANAVMAQLLCLQSMDADR
CLPP4_RHOJR      -------AGERSFDIF-SRLLNERIVFLG------TEIDDGVANVVMAQLLHLQADSSDQ
CLPP_RUBXD       -------RGERAMDIY-SRLLKDRIIFLG------TPVDDQVANAIMAQLLHLESEDPEQ
CLPP_BACTN       -------LNVTQLDVF-SRLMMDRIIFLG------TQVDDYTANTLQAQLLYLDSVDPGK
CLPP_PORGI       -------LNVAQMDVF-SRLMMDRIIFLG------TQIDDYTANVIQAQLLYLDSADPGK
CLPP1_CORJK      --------PNHRDSVY-ERLLRERIIFLG------SQVDDEIANELCAQILLLSAEDPTR
CLPP2_COREF      --------TGYSGDIF-DRLLRERIIFLG------SQVDDEIANKLCAQILLLSAEDPTR
CLPP2_RHOJR      --------LNLSDSVY-ERLLRERIIFLG------TQVDDDIANKLCAQILLLSAEDPSR
CLPP2_MYCPA      --------LNLTDSVY-ERLLSERIIFLG------SEVNDDVANRLCAQILLLAAEDPTK
CLPP1_FRACC      -------GPAFDDQVF-NRLLANRIVFLG------SVVEDSIANAICAQLLLLNAEDPTR
CLPP4_FRACC      -------LGSADDQVF-SRLLENRIVFLG------SVVEDAVANAISAKLLLLAAEDPAA
CLPP2_CUTAK      -------GAGMTDNVY-QSLLRNRIVFLG------SEVKDENANALCAQMLLLNAEDPEA
CLPP3_STRCO      -------ATRFDDRLA-EQLLDQRIVLLG------TQVDEVSANRVCAQLLILSAQDPRT
CLPP1_STRAW      -------PSRFDDHLA-AQLLAQRIVLLG------TQVDEVSANRVCAQLLLLSAEDSRT
CLPP3_RHOJR      -------DLNYRDLLA-DRLFRQRTILLT------GEVDDAMAERACSELVLLAAADPKR
CLPP2_THEFY      -------MQPMYEQTA-QRLLRQRIVFLG------QQVDDEIANRIVGELLLLSAEDRER
CLPP1_TROW8      -----------KQTVF-DRLLQERIVWLG------EAIDDKLANEICAKILLLNADDPKE
CLPP1_LEIXX      -----------QPSVF-DRLLKDRIIWLG------SEVRDENANEIAAKLLLLAAEDSKR
CLPP2_BIFLO      -------PAGPVDPIF-NRLLKDRIIWMG------EEVKDDMANRICAQLLMLAAEDPKK
CLPP3_STRAW      -------GGGLGDQVY-NRLLGERIIFLG------QAVDDDIANKITAQLLLLAS-DPDK
CLPP3_NOSS1      -------QFTDWISIY-DRLYRERIIFLG------RDVDDEIANQIIAVMLYLDSEDPGK
CLPP2_THEEB      -------PYTQWIDIY-NRLYRERIIFLG------KEVDDEIANQIVAVMLYLDSEDPGK
CLPP1_SYNJA      -------PYSQWISLD-DRLYQERILFIG------EPIDDNLANTIVGVMLYLNSQDPQK
CLPP2_SYNP6      -------SFERWIDIY-NRLAMERIIFLG------QEVTDGLANSIVAQLLYLDSEDSSK
CLPP_RIPO1       -------QYERWIDIY-TRLSQERIIFLG------QEVTDGLANRIVAFLLYLDSEDPGK
CLPP2_PROMP      -------QYERWVDIY-TRLGVERILFLG------QEVNDGIANSLVAQMLYLDSDDNTK
CLPP1_GLOVI      -------Q-SQWIDIF-NRLALDRIIFLG------REVDDEIANAIIASMLYLDSEDPEK
CLPP2_GLOVI      -------FRTPPPDLP-SLLLNERIVYLG------TPINDVVAELLIAQLLYLESEDNAK
CLPP1_CHLMU      -----------QDIID-RKLLDSRRIFFS------EPVTEKSAAEAIKKLWYLELTSPGQ
CLPP1_PARUW      -----------ADRIE-HAILDSRRIFIS------DAVDSGSASEIIRKLWYLELTDPGK
CLPP2_LEPIC      -----------GSKIS-KNFLDHRKIFLW------GPVTDESSKDLVGKLLYLEMKDPGK
CLPP3_RHIME      -----------GKETE-ANLFKSRSIFIY------GTITQELAQKVCSQLVALAAAS-DD
CLPP3_AGRFC      -----------GKETE-ANLFKSRSIFIY------GGITQELAQKVCTQLVALAAAS-DD
CLPP2_GLUOX      -----------ISELE-GRLFDQRKVLIF------GGINDKIARDVTGRLLALAGTS-DK
CLPP2_PSEAE      -----------GAKLM-EYALKVRKVFVT------GGVDEKMAKDVVQQLHILASIS-DD
CLPP_PARDE       -----------ATRSA-SSISSRAQVIVA------GPITDKLAQRTVAHLLALAEDS-DE
CLPP2_TREPA      -----------ESVFF-QKFLETRQILLS------GEISKDLAEGIVRQLFVLESLSVSK
CLPP2_TREDE      -----------DDALM-QKFLNTRQIILA------GEINKELSEKIVRQLLLMESLSATK
CLPP2_BORBU      -----------HDKSL-KLVLKSRSIVIA------GEITKDVSRLFQEKILLLEALDFKK
CLPP_OLTVI       ------EPSAQWVDLY-NRLYRERVLFLC------QDLDDELANQLIGIMLYLNAEEKSK
CLPP_TUPAK       ------NEVAEWVDLY-NRLYRERVLFLC------QDLDDELANQLIGIMLYLNAEDKSK
CLPP_OSTTA       ------ESTPQWVDLY-NRLYRERVLFLG------SGLDDELANQLNGIMLYLSAEDASR
CLPP_NEPOL       ------ESAPQWVDLY-NRLYRQRLLFMG------QELGDELSNQLCGIMIYLFAEDPSI
CLPP_CHLAT       ------ESVSTYVDVY-NRLYRERILFLG------EDLDDEVANQLIGVMVFLNSEDDTK
CLPP_PLETE       ------EEEADWIDLY-HCLYQERLIVIC------GDLNDEAVNQIVSVLIYLSTRDDSK
CLPP_ADICA       ------EEDAVWVDVY-NRLYRERLLFLG------QQVDDEIANQLIGIMMYLNSEDQAK
CLPP_HUPLU       ------DEDAVWIDVY-NRLFRERLLFLG------QQVDDELANQLICIMIYPNGEDDSR
CLPP_CYCTA       ------EED--------NRLYRERLLFPG------QQVDDEIANQLIGIMMYLNGEDENK
CLPP_ZYGCR       ------EEDASWIDVY-NRLYRDRLLFLG------QDVDDEIANQLIGIMIYLNGENQSK
CLPP_CHAVU       ------EEDAVWVDIY-NRLYRERLLFLG------QRVDDEIANQLIGIMMYLNGEDDSK
CLPP_CHAGL       ------DVQVQWIDLY-NRLYRERILFLG------QTVNYEIANQIIGLMLYLNGDDKSK
CLPP_PINKO       ------DEDATWVDLY-NRLYRERLLFLA------QDINHEIANQLMGLMVYLSAEDANK
CLPP_ACOGR       ------EEDAAWVDIY-NRLHRERLLFLG------QELDSEISNQLVGLMVYLSIEDKTR
CLPP_AMBTC       ------EEDATWVDIY-NRLHRERLLFLG------QEVEGEISNQIVGLMVYLSIEDDTR
CLPP_CUCSA       ------EEDASWVDLY-NRLYRQRLLFLG------QDVNNEISNQIMGLMVYLSIEDGTK
CLPP_EPIVI       ------EEDASWVDVY-NRLYRERLLFLG------QEVDSDISNQLIGLMVYLSIEDDTK
CLPP_PHAVU       ------DRDASWVDILINRLYRERLLFLG------QDVDSEISNQLISLMIYLSIEKENK
CLPP1_ARATH      ------EGDTSWVDIY-NRLYRERLFFLG------QEVDTEISNQLISLMIYLSIEKDTK
CLPP_POPTR       ------EDSSNWIDVY-NRLYRERLLFLG------QDIDSEISNQLIGLMVYLSTESEIK
CLPP_VITVI       ------EDDISWIDVY-NRLYRERLLFLG------QEVESEISNQLIGLMIYLSIEDENK
CLPP_CITSI       ------DKHPSWVDIY-NRLYRERLLFLG------QMVESDISNQLIGIMVYLSIENETK
CLPP_SOLLC       ------DPISSWVDIY-NRLYRERLLFLG------QGIGTELSNQLIGLMLYLSMEDENK
CLPP_AGRST       ------DEEATWVDLY-NVMYRERTLFLG------QEIRCEITNHITGLMVYLSIEDGIS
CLPP_CUSRE       ------DRSRVWIDIY-NRLYRERCLFLA------HVVESQIANQLVGLFIYLGVQDETK
CLPP_CUSGR       ------DTGQVWIDIY-NRLYRERCLFLT------HTINTKIGNQLAGLFIYLGIQDDPK
CLPP_PELHO       EELDSMEEKATWVDLY-NRLYRQRWLFLG------KDLEEEVANNIVGLMIHLNIEDPFW
CLPP_OENEH       DEEDEEEDDATWVDLY-NVLYRTRSIFLG------DAIHFEVANHIAGLMIFLTIQDATQ
CLPP_BIGNA       ------DTTPQWVDIY-TRLYKDRIIFLF------QLLDDDFSNQIISMLLHLDSESKEE
                                          .           .           :          

CLPP1_RHOBA      DIHLYINSPG--GSVTATLAIYDTMQMLSC--PVATYCVGEACSGAAVLLIGGAKGKRFC
CLPP1_CYAPA      DIRLFINSPG--GSVTAGLSVYDTIQNLSV--DVSTICFGLAASMGAVLLAAGVENKRFA
CLPP_ECOLI       DIYLYINSPG--GVITAGMSIYDTMQFIKP--DVSTICMGQAASMGAFLLTAGAKGKRFC
CLPP_BAUCH       DIYLYINSPG--GNITSGMSIYDTMQFIKP--NVSTFCMGQAASMGAFLLAAGTKGKRFC
CLPP_BLOPB       DIHLYINSPG--GVITAGMSIYDTIQFVRP--DVSTFCMGQAASMSAFLLASGTKGKRFC
CLPP_BLOFL       DIHLYINSPG--GEVTAGMSIYDIMQFVKP--NISTYCIGQAASMGAFLLAAGTTGKRFC
CLPP_WIGBR       DIFLYINSPG--GVVTSGMSIYDTMQFIKC--EVSTLCIGQSSSMAALILASGEKGKRFS
CLPP_BUCAI       DIFLYINSPG--GIITSGMSIYDTMQFVKP--EISTICLGQACSMAALLLTSGAKGKRFC
CLPP_BUCAP       DIFLYINSPG--GIITSGMSIYDTMQFIKP--DVNTICIGQACSMAAFLLSSGTKGKRSC
CLPP_BUCBP       DIYIYINSPG--GVITAGMSIYDTMKFIKP--NVNTICIGQACSMAALILTAGKKGYRYC
CLPP2_METCA      DIHLYINSPG--GLVTAGLAIYDTMQFIKP--DVSTLCVGQAASMGALLLAGGAAGKRYC
CLPP_NITOC       DIHLYINSPG--GSVTAGLSIYDTMQFIKP--DVSTLCVGQAASMGAVLLAGGAGGKRHC
CLPP_HAHCH       DIHLYINSPG--GSVTAGLSIYDTMQFIKP--DVSTMCIGQAASMGALLLSGGAAGKRYC
CLPP_CHRSD       DIHLYINSPG--GSVTAGMSIYDTMQFIKP--DVSTVCVGQAASMGALLLAGGAAGKRYC
CLPP_PSEF5       DIHLYINSPG--GSVTAGMSIYDTMQFIKP--NVSTTCIGQACSMGAFLLTAGAPGKRFC
CLPP_PSEMY       DIHLYINSPG--GSVTAGMAIYDTMQFIKA--DVSTTCIGQACSMGAFLLAGGAKGKRFC
CLPP1_PSEAE      DIHLYINSPG--GSVTAGMSIYDTMQFIKP--NVSTTCIGQACSMGALLLAGGAAGKRYC
CLPP_PHOPR       DIFLYINSPG--GSVTAGMSIYDTMQFIKP--NVSTVCMGQACSMGAFLLAGGAKGKRYC
CLPP_SHEAM       EIYLYINSPG--GSVTAGMAIYDTMQFIKP--KVSTVCIGQACSMGAFLLAGGEKGMRHC
CLPP_IDILO       DIYLYINSPG--GVVTAGMAIYDTMRFIKP--DVSTVCMGQAASMGAFLLAGGAQGKRYC
CLPP_PSEA6       DIFLYINSPG--GSVTAGMAIYDTMNFIKP--DVSTVCIGQAASMGAFLLSGGAKGKRYC
CLPP_COLP3       DIYLYINSPG--GSVTAGMAIYDTMKFIKP--NISTVCIGQAASMGAFLLSGGEKGKRYC
CLPP_PSET1       DIFLYINSPG--GSVTAGMAIYDTMNFIKP--DVSTICVGQAASMGAFLLTAGAKGKRFC
CLPP_HYDCU       DIHLYINSPG--GSVTAGMAIYDTMRFIKP--DVSTMCIGQAASMGSFLLSAGAEGKRYA
CLPP_ALCBS       DIHLYINSPG--GSVTAGMSIYDTMQFIKP--DVSTMCIGQAASMGAFLLTAGAAGKRFA
CLPP_SACD2       DIHLYINSPG--GSVTAGLSIYDTMQFIKP--DVSTMCIGQACSMGAFLLTAGAKGKRFC
CLPP_ACIAD       DIHLYINSPG--GSVTAGMAIYDTMQFIKP--DVVTYCMGQAASMGAFLLNAGAKGKRYC
CLPP_PSYA2       DIHLYINSPG--GSVSAGLAIFDTMNFIKP--EVSTICMGGAYSMGSFLLAAGQKGKRYA
CLPP_HISS2       DINIYINSPG--GSVTAGMAIYDTMQFIKP--NVRTLCIGQACSMGAFLLAGGTAGKRAA
CLPP_HAEDU       DIYLYINSPG--GVVTAGLAIYDTMNFIKP--DVATLCTGQACSMGAFLLSGGKKGKRFA
CLPP_RUTMC       DIHLYINSPG--GLVSAGLAIYDTMQFIKP--DVSTLCIGQAASMGALLLTAGAKDKRFA
CLPP_LEGPL       DISLYINSPG--GVVTAGLAIYDTMQFIKP--DVSTLCIGQAASAAALLLCAGADGKRFC
CLPP_COXBN       DINLYINSPG--GAVTSAMAIYDTMQFVKP--DVRTLCIGQAASAGALLLAGGAKGKRHC
CLPP_XYLFT       DINIYINSPG--GVVTAGMAIYDTMQYIKP--AVSTICVGQAASMGALLLASGASGKRYA
CLPP_MAGSA       DIAFYINSPG--GVVTSGLAIYDTMQYIRP--KVSTVCIGQAASMGSLLMTAGEKGKRFS
CLPP_AZOBR       DIALYINSPG--GYVSAGLAIYDTMQYIRP--QVSTVCMGQAASMGSLLLAAGAPGKRFS
CLPP_RHORT       DISFYINSPG--GVVTSGMAIYDTMQYIRS--PVSTVCIGQAASMGSLLLCAGEAGKRYA
CLPP1_GLUOX      EISFYINSPG--GVVSAGLAIYDTMQYIRC--PVSTVCIGQAASMGSLLLAGGEKGHRYA
CLPP_NOVAD       DISMYINSPG--GVVTAGLAIYDTMQYIRP--RVSTVCIGQAASMGSFLLAAGEPGMRIA
CLPP_SPHAL       DIYMYINSPG--GVVTAGMAIHDTMQYIRP--RVGTVCIGQAASMGSFLLAAGEPGMRVA
CLPP_ZYMMO       DIFLYINSPG--GVVTAGLAIHDTMQYIRP--KVGTLCIGQAASMGSFLLAAGEPGMRVA
CLPP_BARBK       EISLYINSPG--GVVTSGMAIYDTMQFIRP--PISTLCMGQAASMGSLLLTAGAKGHRFS
CLPP_BRUSU       EINMYINSPG--GVVTSGMAIYDTMQFIRP--PVSTLCMGQAASMGSLLLTAGATGHRYA
CLPP1_CHESB      EIALYINSPG--GVVTSGMAIYDTMQFIQP--PVSTLCIGQAASMGSLLLCAGHKDMRFA
CLPP2_AGRFC      EIALYINSPG--GVVTAGMAIYDTMQFIRP--AVSTLCVGQAASMGSLLLAAGEKGMRFA
CLPP_CAUVC       EIAMYINSPG--GVVTAGLAIYDTMQYIKS--PVSTVCMGMAASMGSLLLAAGAAGQRIS
CLPP_MARMM       EISMYINSPG--GVVSAGLGIYDTMQYIRS--PVSTMCLGMAASMGSLLLTAGEKDMRFA
CLPP_RUEPO       EISIYINSPG--GVVTSGLSIYDTMQYIKP--KCSTLVIGQAASMGSVLLAGGEKGMRFS
CLPP_DINSH       EISMYINSPG--GVVTSGLSIYDTMQYIKP--KVSTLVVGQAASMGSLLLTAGEKGMRFS
CLPP_RHOS5       EIAMYINSPG--GVVTSGLSIYDTMQYIRP--KVSTLVIGQAASMGSLLLTAGEKGMRFS
CLPP_JANSC       EISMYINSPG--GEVTAGMSIYDTMQYIKP--KVSTLVCGMAASMGSVIAVGGEKGMRLA
CLPP_AZOC5       EISMYINSPG--GVVTSGLAIYDTMQFIRP--AVSTLCIGQAASMGSLLLTAGEKGLRFA
CLPP1_RHIEC      PINLYINSPG--GAVTSGLAMYDTMRFIRA--PVHTLCMGTARSMGSFLLMAGEPGERAA
CLPP1_BRADU      PINLYINSYG--GVVTSGLAMYDTMQFIKA--PVHTLCMGTARSMGSFLLMAGERGHRAA
CLPP2_CHESB      EIAFYINSPG--GVVSSGFAIYDTMQFIKC--PVATLCLGTAASMGSFLLMAGERGMRVA
CLPP1_RHILO      EISLYINSPG--GVVTSGFAIYDTMQYVSC--PVSTVCMGFAASMGSFLLMAGTPGRRIA
CLPP_PELUB       EINLYINSPG--GLVTAGLGIYDTMQYIKP--DVSTLCIGQAASMGSFLLAAGKKGKRFS
CLPP_ANAPZ       DISMYINSPG--GVVTAGLSIYDTMQYIKP--NVATLCLGQAASMGSLLLCAGAPGMRCA
CLPP_EHRRG       DISMYINSPG--GVVTAGLSIYDTMQYVKP--RIATLCLGQAASMGSLLLAAGEKGMRCA
CLPP_WOLPM       DICMYINSPG--GVVTAGLSIYDTMQYINP--DVSTLCIGQAASMGSLLLAAGTKGKRYS
CLPP_RICPR       DIYMYINSPG--GVVTAGLAIYDTMQFIKP--KVATLCIGQACSMGSLLLCGGEHGMRYS
CLPP_RICBR       DIYMYINSPG--GVVTAGLAIYDTMQYIKP--KVATLCIGQACSMGSFLLCGGEKGMRYS
CLPP_NEOSM       DIFMYINSPG--GVVTAGLSIYDTMQYIKP--SVSTVCVGQAASAASLILASGAEGKRFA
CLPP_RHOFT       DISFYINSPG--GSVSAGMAIFDTMNFVKP--DVSTLCTGMAASMGAFLLAAGAKGKRFS
CLPP_METPP       DISLYINSPG--GSVSAGLSIFDTMQFIKP--DVSTLCMGIAASMGAFLLAAGAKGKRFA
CLPP_ACISJ       DISFYINSPG--GSVTAGMAIYDTMQFIKP--DVSTLCCGFAASMGAFLLAAGAKGKRYS
CLPP_RALSO       DISLYINSPG--GSVSAGLAMYDTMQFVKP--DVSTLCMGMAASMGAFLLAAGAKGKRYA
CLPP2_PARXL      DISFYINSPG--GSVSAGMAIYDTMQFIKP--DVSTLCMGLAASMGAFLLAAGAKGKRFA
CLPP_AROAE       DVYFYINSPG--GSVSSGMAIYDTMQFIKP--SVSTLCIGQAASMGSFLLAAGEKGKRFC
CLPP_DECAR       DIYFYINSPG--GSVTAGMSIYDTMQFIKP--DVSTLCIGQAASMGAFLLNAGAKGKRFA
CLPP_BORA1       DISFYINSPG--GSVYAGMAIFDTMQFVKP--DVSTLCTGLAASMGAFLLAAGKKGKRFS
CLPP_METFK       DIYFYINSPG--GSVTAGMGIYDTMQFVKP--DVSTLCVGQAASMGALLLAAGAQGKRFC
CLPP_NITEC       DISLYINSPG--GLVTAGLAVYDTMQFIKP--DVSTLCIGQAASMGALLLTAGAKGKRYC
CLPP_NITMU       DIHFYINSPG--GLVSAGMAVYDTMQFIKP--DVSTLCIGQAASMGSLLLAAGAKGKRFC
CLPP_THIDA       DIYLYINSPG--GSVSAGLAIYDTMQFIKP--DVSTLCIGQAASMGAFLLTAGAKGKRYC
CLPP1_PARXL      DISFYINSPG--GSVYDGLAIYDTMQFIKP--EVSTLCTGFAASMGTFLLTAGQRGKRYA
CLPP_NEIG1       DIFFYINSPG--GSVTAGMSIYDTMNFIKP--DVSTLCLGQAASMGAFLLSAGEKGKRFA
CLPP_CHRVO       DIHFYINSPG--GSITAGMSIYDTMNFIKP--DVSTLCIGQAASMGAFLLAAGTHGKRFA
CLPP_DICNV       DIHFYINSPG--GSVTAGMSIYDTMQFIKP--DVSTMVLGQAASMGAVLLAAGAAGKRYA
CLPP_FRAP2       DIYFYINSPG--GMVTAGMGVYDTMQFIKP--DVNTICIGLAASMGSLLLAGGAKGKRYS
CLPP1_TREDE      DISLYINSPG--GSVTAGLAIYDTMQHIRP--DVQTICLGQCASMGAVLLAGGAKNKRYA
CLPP1_TREPA      DISLYINSPG--GAVTAGLAVYDTMQHICP--EVQTICLGQASSMAAVLLAGGAPGKRFA
CLPP_BORBP       DIYLYLNSPG--GSITAGLAIYDTMQYIKP--DVRTICIGQAASMGAFLLAGGAKGKRES
CLPP_CAMJJ       DIYLYINSPG--GVITSGFSIYDTMNYIKP--DVCTICIGQAASMGAFLLSCGAEGKRFA
CLPP_WOLSU       DIYLYINSPG--GVITSGMSIYDTMNYVKP--DICTICIGQAASMGAFLLSCGTKGKRFS
CLPP_NITSB       DIYLYINSPG--GVITSGMSIYDTMNYIKP--DVSTICIGQAASMGAFLLSSGTKGKRYA
CLPP_HELHP       DINFYINSPG--GVITSAFSIYDTMNYIHS--DISTICIGQAASAGAFLLSSGTKGKRFS
CLPP_HELAH       DIGLYINSPG--GVITSGLSIYDTMNFIRP--DVSTICIGQAASMGAFLLSCGAKGKRFS
CLPP_CAMHC       DIYLYINSPG--GVVTSGFSIYDTMNYIKP--AVSTICIGQAASMGAFLLSCGEKGKRYA
CLPP_SULNB       DIYFYINSPG--GVITSGLSMFDTMNYIKP--DIVTICIGQAASMGAFLLASGTKGKRYA
CLPP_ARCB4       DIYLYINSPG--GVVTSGMSIFDTMNYIKP--DVCTICIGQAASMGAFLLSSGAKGKRYS
CLPP_SULDN       DIYFYINSPG--GVVTAGMAIYDTMNYIRP--DVATICVGQAASMGAFLLSSGAKGKRYA
CLPP_DESPS       DITFYINSPG--GSVTAGMAIYDTMQYIKC--DIATLCMGQAASMGAVLLAAGTAGKRYA
CLPP_CHLTE       DIYIYINSPG--GSVSAGLGIYDTMQYIRP--DISTVCVGMAASMGAFLLASGTSGKRAS
CLPP_AQUAE       DIYLYINSPG--GSVTAGLAIYDTMQYIKP--DVVTICMGQAASMGAILLAAGAPGKRYA
CLPP_CARHZ       DIHLYINSPG--GVITAGMAIYDTMQYIKP--DVSTICIGQAASMGAFLLAAGAKGKRFS
CLPP_DESRM       DIHLYINSPG--GVVTAGLAIYDTMQYIKP--AVSTICLGQAASMGSFLLAAGAPGKRYA
CLPP_KORVE       DISLYINSPG--GSITAGMAIYDTMQFIRP--DVATICIGQCASMGATLLASGAPGKRYA
CLPP_DESVV       EIHMYINSPG--GSVTAGMAIYDTMQYINS--PVSTLCMGQAASMGALLLAAGAPGLRFS
CLPP_DESAG       EIYLYINSPG--GVVTAGLAIYDTMQYISA--PVATLCMGQAASMGAFLLAAGQPGMRFA
CLPP_LAWIP       EIYLYINSPG--GSVTAGLAIYDTMNYITP--NVATVCMGRAASMGALLLAAGEKNMRYA
CLPP_GEOSL       DIHLYINSPG--GVVTSGMAIYDTMQYIKA--PVSTICVGQAASMGALLLSGGEKGKRFS
CLPP_GEOUR       DIHLYINSPG--GVVTAGMAIYDTMRYIKA--PVSTICVGQAASMGAFLLSGGEKGKRFS
CLPP_PELPD       DIHLYINSPG--GVVTSGMAIYDTMRYIKA--PVSTICVGQAASMGAVLLAAGEKGKRFS
CLPP_PELCD       EIFLYINSPG--GVVTAGMAIYDTMQYVRC--PVSTLCVGQAASMGAVLLAAGGEGKRFA
CLPP_SYNAS       EIFFYLNTPG--GHISSGMAIYDTMRYIKP--PVATVCVGQAASMGALLLAAGEQGKRSA
CLPP1_NOSS1      DIYLYINSPG--GSVTAGMGIFDTMKHIRP--DVCTICTGLAASMGAFLLSAGAKGKRMS
CLPP1_SYNY3      DIYLYINSPG--GSVSAGLGIFDTMNQIRP--DVCTICIGLAASMGAFLLSAGAKGKRMS
CLPP1_PROMA      DIFLYINSPG--GSVYDGFGIFDTIQHIKP--DVHTVCVGLAASMGAFLLCAGAKGKRSS
CLPP1_PROMP      DIYMYINSPG--GSVYDGLGIFDTMQHVKP--DIHTVCVGLAASMGAFLLAAGTKGKRSS
CLPP1_SYNP6      DIYLYINSPG--GSVYDGLGIFDTMNHIRP--DVSTVCVGLAASMGAFLLAAGAKGKRTS
CLPP3_TRIV2      DIQLYINSPG--GSVYAGMAIYDTIQQIRP--DVVTICFGLAASMGAFLLTAGTKGKRMS
CLPP2_SYNY3      DIQLYINSPG--GSVYAGLAIYDTMQQIRP--DVVTICFGLAASMGAFLLSGGCKGKRMA
CLPP1_THEEB      DIYLYINSPG--GSVTAGMAIYDTMKHIRP--DVCTLCFGLAASMGAFLLSGGTPGKRMA
CLPP3_PROMT      DIQLYVNSPG--GSVTAGLAIYDTMQQVSP--DVITICYGLAASMGAFLLSGGTKGKRLA
CLPP1_PROMM      DIQIYINSPG--GSVTAGLAIYDTMQQVAP--DVVTICYGLAASMGAFLLCGGTKGKRLA
CLPP3_PROMP      DIQIYINSPG--GSVTAGLAIYDTMQQISP--DVVTICFGVAASMGAFLLSGGAKGKRLA
CLPP2_SYNE7      DIQLYINSPG--GSVTAGMAIYDTMQQVAP--DVATICFGLAASMGAFLLSGGAQGKRMA
CLPP2_SYNJA      DIYLYINSPG--GSVYAGMAIYDTMQHIQP--DVSTICIGLAASMGAFLLAGGAKGKRIA
CLPP_FUSNN       DIIMYINSPG--GSVTDGMAIYDTMNYIKP--DVQTVCVGQAASMGAFLLAAGAKGKRFA
CLPP2_MYXXA      DINLYINSPG--GSVTAGLAIYDTMQYVKC--PVSTICVGQAASMGAVLLLAGAKGKRYA
CLPP2_MYXXD      GINLYINSPG--GSVTAGLAIYDTMQYVKC--PVSTICVGQAASMGALLLLAGAKGKRYA
CLPP_ANADE       DINLYINSPG--GSVTSGLAIYDTMQYVKP--QVSTICLGQAASMGAFLLAGGAAGKRFA
CLPP_LEPIN       DIYLYLNSPG--GYVSSGLAIYDTMQYIKP--DVRTLCLGQASSMAALLLAGGAAGKRSA
CLPP_SYNFM       DIHFYINSPG--GLVTAGLAIYDTMQFIKP--NVSTLCMGQAASMAAILLAAGVKGKRYA
CLPP_LACDB       DIYMYINSPG--GVITSGMAIVDTMNFIKS--PVSTIATGMAASMASIILAEGEKGKRFA
CLPP_LACP3       DIYLYINSPG--GVITSGLAMLDTMNFIKS--DVQTIAIGMAASMASVLLAGGTKGKRFA
CLPP_LACSS       DISIYINSPG--GSVTAGLAIMDTMNFIKS--DVQTIAMGMAASMASVLLSAGTKGKRFA
CLPP_LACJO       DISLYINSPG--GVITSGLAIMDTMNFIKS--DVSTIAIGMAASMASILLTSGTKGKRFA
CLPP_LACPL       DIYLYINSPG--GVVTAGLAIYDTMNFIKS--DVQTIVMGMAASMASVLASSGTKGKRFA
CLPP_LACBA       DISLYINSPG--GVVSSGLAIYDTMNFIQS--DVQTITLGMAASMASVLASSGTKGKRFA
CLPP_LACRD       DIYLYINSPG--GVVTSGMAIYDTMNFIKA--DVQTIVIGMAASMASVLVSSGAKGKRFG
CLPP_LACS1       DIYMYINSPG--GSVSAGLAIYDTMNFVNA--DVQTIVMGMAASMASVLATAGTKGKRFA
CLPP_STRA3       DIYLYVNTPG--GSVSAGLAIVDTMNFIKS--DVQTIVMGMAASMGTIIASSGAKGKRFM
CLPP_LACLS       DIYLYVNTPG--GSVSAGLAIVDTMNFIKS--DVLTIVMGMAASMGTIIASSGTKGKRFM
CLPP1_DESHY      DIHFYINSPG--GSVTDGLAIMDTMNYIKC--DVSTISIGQSGSAASLLLAAGAKGKRFA
CLPP1_SYMTH      PVNLYINSPG--GSVSAGLGIYDAMQHIKS--PVNTTVVGMAASMAALLLAAGT-GKRYA
CLPP2_SYMTH      EINMYINSSG--GITSAGLAIYDTMQHIKP--KVNTYAIGMAASMAAVLLAGGT-GTRYA
CLPP_BDEBA       PIHLYINSPG--GSVSAGLAIYDFMQFVKC--DVATYCMGMAASMGSLLLTAGTKGMRYS
CLPP_SYNWW       DISLYINSPG--GSITAGMAIYDTLQYIRP--DVSTICVGLAASMGAFLLAAGKKGKRYA
CLPP_MOOTA       DIHLYINSPG--GSISAGMAIFDTMQYIRP--DVSTICVGLAASMGAFLLAAGAKGKRFA
CLPP_ALKMQ       DIQIYINSPG--GSITAGMAIYDTMNYIKP--DVSTICVGMAASMGAFLLAAGAKGKRFA
CLPP_CALS8       DIYLYINSPG--GSVTAGFAIYDTIQYIKP--DVSTICVGMAASMGAFLLAAGAKGKRFA
CLPP_HUNT2       DIQLYINSPG--GSVTAGFAIYDTMQYVKP--DVSTICIGMAASMGAFLLAAGAKGKRFA
CLPP_CALS4       DIWLYINSPG--GSITAGLAIYDTMQYIKP--DVVTLCVGMAASMAAFLLAAGAKGKRFA
CLPP_CLOTE       DIFLYINSPG--GSITSGMAIYDTMQYIKP--DVSTICIGMAASMGAFLLAAGAKGKRFA
CLPP_CLOK5       DIYFYINSPG--GSITAGMAIYDTMQYIKS--DVSTICIGMAASMGAFLLAAGEKGKRFA
CLPP_CLOB1       DIHLYINSPG--GSITSGMAIYDTMQYIKP--DVSTICVGMAASMGAFLLAAGAKGKRYA
CLPP_CLOAB       DIYLYINSPG--GSITSGMAIYDTMQYVKP--DVSTICIGMAASMGSFLLTAGAPGKRFA
CLPP_CLOPS       DIHLYINSPG--GSITSGMAIYDTMQYIKP--DVSTICIGMAASMGAFLLSSGAKGKRFA
CLPP2_DESHY      DIFLYINSPG--GSISAGMAIYDTMQYIRA--DVHTICVGLAASMGAFLLTAGAKGKRQA
CLPP1_BACHD      DISLYINSPG--GSITAGMAIYDTMQYIKP--NVSTICIGMAASMGAFLLAAGAKGKRFA
CLPP2_BACSK      DISLYINSPG--GSITAGMAIYDTMQFIKP--DVSTICIGMAASMGAFLLTAGAKGKRMA
CLPP_OCEIH       DISLYINSPG--GSITAGMAIYDTMNFIKP--NVSTICIGMAASMGAFLLTAGEKGKRFA
CLPP_GEOKA       DISLYINSPG--GSITAGLAIYDTMQFIKP--DVSTICIGMAASMGAFLLAAGAKGKRFA
CLPP2_BACC1      DIHLYINSPG--GSITAGMAIYDTMQFIKP--QVSTICIGMAASMGAFLLAAGEKGKRYA
CLPP_LISIN       DIFLYINSPG--GSISAGMAIYDTMNFVKA--DVQTIGMGMAASMGSFLLTAGANGKRFA
CLPP_ENTFA       DIYLYINSPG--GSVSAGLAIFDTMNFVKA--DVQTIVLGMAASMGSFLLTAGQKGKRFA
CLPP_STAS1       DIYLYINSPG--GSVTAGFAIYDTIQHIKP--DVQTICIGMAASMGSFLLAAGAKGKRFA
CLPP1_BACSK      DISIYINSPG--GSVSAGFAILDTMLYIKP--DIQTICTGMAASFAAVLLVGGTKGKRCA
CLPP2_BACLD      DISIYINSPG--GSTSAGYAILDTMDYVKP--DVRTICVGMAASMGAILLAGGAKGKRYA
CLPP1_BACC1      DIFLYINSPG--GSTXAGFAILDXMNLIXP--EVQTLCMGLAASFGALLLLAGAKGKRFA
CLPP2_BACHD      DIYLYINSPG--GSTSAGFAIYDTMQFVKP--SIHTICTGMAASFAAILLLAGTKGKRFA
CLPP_THEMA       DVYLYINSPG--GSVTAGLAIYDTMQYIKC--DVSTICVGQAASMAAVLLAAGAKGKRYA
CLPP_PSELT       DIQLYINSPG--GSVTAGLAIYDTMQYIKS--DVVTICVGQAASMAAVLLASGTKGKRFA
CLPP2_CHLPN      DIQIFINSPG--GYITAGLAIYDTIRFLGC--DVNTYCIGQAASMGALLLSAGTKGKRHA
CLPP2_PARUW      DVHIYINSLG--GYITSGLAIYDTMQYLGC--DINTYCIGQAASMGALLLTAGTKGKRFA
CLPP2_RHOBA      DIHMYINSPG--GSITAGMAIYDTMQFVSC--DVATYCIGQAASMGAVLLTAGAKGKRFA
CLPP2_SALRD      PINLYINSPG--GVIYSGLGVYDTMQYIGA--PVSTICVGLAASMGSVLLAAGEDDSRAC
CLPP1_SALRD      PINIYINSPG--GVIYSGLGVYDTMQYVEA--PISTTCVGLAASMGSVLLAGGEDGQRAC
CLPP_THET2       EIKLYINSPG--GEVDAGLAIYDTMQFVRA--PVSTIVIGMAASMAAVILAAGEKGRRYA
CLPP_DEIGD       EIQMYINCPG--GEVYAGLAIYDTMRYIKA--PVSTICVGIAMSMGSVLLMAGDKGKRLA
CLPP_DEHM1       DISLYIHSPG--GVISAGLAMYDTMQLIRP--KVSTICVGVAASMATVLLCAGAKGKRYA
CLPP2_FRACC      DISIYINSPG--GSFTSLTAIYDTMQFVRP--DISTICMGQAASAAAVLLAAGTPGKRFA
CLPP3_FRACC      DISIYINSPG--GSFTSLTAIYDTMQFVRP--DISTICMGQAASAAAVLLAAGTPGKRFA
CLPP2_CORJK      DITMYINSPG--GSFTSLMAIYDTMQYVRP--DVQTVCLGQAASAAAVLLAAGTPGKRAA
CLPP1_RHOJR      DITMYINSPG--GSFTSLMAIYDTMQYVRA--DITTVCLGQAASAAAVLLAAGSPGKRLA
CLPP1_THEFY      DITLYINSPG--GSFTSLMAIYDTMQFVRP--DIQTVCVGQAASAAAVLLAGGTKGKRTA
CLPP2_TROW8      DIIMYINSPG--GSFTAMTAIYDTMQYIRP--QIQTVCLGQAASAAAVILSAGTPGKRLA
CLPP2_LEIXX      DIVMYINSPG--GSFTAMTAIYDTMQYVRP--QIQTVVLGQAASAAAVLTAAGAPGKRLA
CLPP4_STRAW      DISVYINSPG--GSFTALTAIYDTMQFVKP--DIQTVCMGQAASAAAILLAAGTPGKRMA
CLPP5_STRAW      DISLYINSPG--GSFSAMTAVYDTMQFVSC--DVETICLGQAASAAAVLLAGGTPGKRLA
CLPP1_BIFLO      DVMMYINSPG--GSMTAMTAIYDTMQYIKP--DVQTVCLGQAASAAAILLASGTKGKRLM
CLPP1_CUTAK      QISMYINSPG--GSFTAMTAIYDTMNYVRP--DIQTICLGMAASAAAVLLAAGAKGQRLS
CLPP4_RHOJR      EIGLYINSPG--GSTTAMLAIYDTMQFLRP--TIATYCMGQAASAAAVLLAAGTKGHRHV
CLPP_RUBXD       DINLYINSPG--GSVSAGLAIYDTMQFVKP--DIVTTALGMAASMGAFLLAAGTKGKRFA
CLPP_BACTN       DISIYINSPG--GSVYAGLGIYDTMQFISS--DVATICTGMAASMAAVLLVAGAEGKRSA
CLPP_PORGI       DISIYLNSPG--GSVYAGYGIYDTMQYIGC--DVATICTGMAASMASVLLVAGTKGKRFA
CLPP1_CORJK      DISLYINSPG--GSVTAGMAIYDTMKYAPC--DIATYGMGLAASMGQFLLSAGTKGKRYA
CLPP2_COREF      DISLYINSPG--GSVTAGMAIYDTMKYSPC--DIATYGMGLAASMGQFLLSGGTPGKRYA
CLPP2_RHOJR      DISLYINSPG--GSVSAGMAIFDTMQFAEC--DVATFGMGLAASMGQFLLSAGAKGKRYA
CLPP2_MYCPA      DISLYINSPG--GSISAGMAIYDTMVLAPC--DIATYAMGMAASMGEFLLAAGTKGKRYA
CLPP1_FRACC      DIFLYINSPG--GSVSAGMAIYDTMQFVEN--DVATVSLGLAASMGQFLLCAGASGKRYS
CLPP4_FRACC      DIYLYINSPG--GSVSAGMAIYDTMQYVGN--DVATVALGLAGSMGQFLLCAGTAGKRYA
CLPP2_CUTAK      DIYLYINSPG--GSVTGGMAIYDTMQWISN--DVATVTMGMAASMGQFLLTAGTPGKRYA
CLPP3_STRCO      DISLYVNSPG--GSVHAGLAIYDTMRLIPN--DVSTLAMGFAASMGQFLLSVGTAGKRYA
CLPP1_STRAW      DISLYINSPG--GSVTAGLAIYDTMRLIPN--DVSTLAMGFAASMGQFLLSVGAAGKRFA
CLPP3_RHOJR      DIVLYINSPG--GSVFAGLAIYDTMKLVPN--DVVTVAMGFAASMGQVLLCSGTHGKRIS
CLPP2_THEFY      DITLYINSPG--GSVTAGMAIYDVMQYIPN--DVRTVGIGLAASMGQMLLCAGTRGKRYA
CLPP1_TROW8      DIFLYINSPG--GSITAGMAIYDTMQFVSN--DIVTVGIGMAASMGQVLLTSGTQNKRYI
CLPP1_LEIXX      DIYLYINSPG--GSITAGMAIYDTMQFVPN--DIVTVGIGMAASMGQLLLTAGTKGKRYI
CLPP2_BIFLO      DIWLYINSPG--GSITAGMAIYDTMQLIEP--DVATVGLGMCASMGQFLLSSGTKGKRYL
CLPP3_STRAW      DIYLYINSPG--GSITAGMAIYDTMQYIKN--DVVTIAMGMAASMGQFLLSAGTPGKRFA
CLPP3_NOSS1      DIYLYINSPG--GMVTSGLAIYDTMQHIKS--DVVTICVGLAASMGSFLLAAGTKGKRMA
CLPP2_THEEB      DIMLYINSPG--GSVTAGMAIYDTMQHIKS--DVVTICVGLAASMGSFLLAAGTKGKRLA
CLPP1_SYNJA      DIVMYINSPG--GSVTAGMAIYDTMNHVKP--DIVTVCVGQAASMGAFLLAAGTKGKRFA
CLPP2_SYNP6      PIYLYINSPG--GSVTAGMAIYDTMQYIKS--PVITICLGLAASMGAFLLCAGSKGKRLA
CLPP_RIPO1       PIYLYINSPG--GSVTAGMAIYDTMQYIKS--DVITICVGLAASMGAFLLASGTPGKRLA
CLPP2_PROMP      PIYLYINSPG--GSVTAGLAIYDTIKYVKS--DVVTICVGLAASMGAFLLGAGTKGKRVA
CLPP1_GLOVI      DIFLYINSPG--GSVSAGLAIYDTMQHVRA--DVATMCVGLAASMGSFLLTAGAKGKRTS
CLPP2_GLOVI      PIEIYINSPGVAGFETSAFAVYDTMRHVRM--PIKTICLGLAGGFSALLMAAGTKGQRMS
CLPP1_CHLMU      PIVFVINSPG--GSVDAGFAVWDQIKMISS--PVTTVVTGLAASMGSVLSLCAAPGRRFA
CLPP1_PARUW      PILFVINSPG--GAVDSGFAIWDQIKMITS--PVTTLVTGLAASMGSILSLCASPGRRFA
CLPP2_LEPIC      KITFYINSPG--GVVTSGMTVFDTIKMISS--PVHTVCMGMAASMGSVLLAAGTKGERSI
CLPP3_RHIME      DIRLFVNSPG--GHVESGDSIHDMIKFVKP--KVWTIGTGWVASAGALIYVAAPKEQRLC
CLPP3_AGRFC      DIRVYVNSPG--GHVESGDSIHDMIKFIKP--KVYIIGTGWVASAGALIYVSVPKERRLC
CLPP2_GLUOX      PIDVYVNSPG--GHVESGDTIHDMIRFVDSIAPINMIGTGWVASAGALIYAAGRPERRVC
CLPP2_PSEAE      PIYMFVNSPG--GHVESGDMIFDAIRFITP--KVIMIGSGSVASAGALIYAAADKENRYS
CLPP_PARDE       PINMLISSPG--GHVESGDMIHDVIKFIRP--TVRTIGLAWVASAGALIFVGADKENRYC
CLPP2_TREPA      PIYMYVDSPG--GDVDAGYAIFDVIRFVKT--PVYTIGMGLVASAGVLVLLAAKKDCRFG
CLPP2_TREDE      PIYIYIDSPG--GDADAGFAIFDMIRFIKA--PVYTIGMGLVASAASIILLAASKERRFG
CLPP2_BORBU      PIFVYIDSEG--GDIDAGFAIFNMIRFVKP--KVFTVGVGLVASAAALIFLAAKLENRFS
CLPP_OLTVI       DLYIYINSPG--GSVTCGIAVYDTMNYIKA--DVTTICVGTAASMASFVLAGGTQGKRIA
CLPP_TUPAK       GIYVYINSPG--GSVTCGVGVFDAMNYIKS--DVTTICVGTAASMASFVLAGGRKGKRLA
CLPP_OSTTA       SLFLYINSPG--GSVTAGLSVFDIMNYVQA--SVTTIGIGFAASMASFILAGGERGSRIA
CLPP_NEPOL       PLFMYINSPG--GSVTSGLGVFDIATVMMQ--DVTTICVGIAASMASLVLSGGSTGQRLA
CLPP_CHLAT       GIFFYINSPG--GSMNSGLGVYDMIQHINV--DVTTICMGLAASMASFILAGGTPGQRLM
CLPP_PLETE       EFFIYINSPG--GSVTSGIAIYDAMRFNNT--PVNTIAVGISASMASFILAGGDIGKRLA
CLPP_ADICA       DMYLYVNSPG--GAVLAGISVYDAMQFVVP--DVHTICMGLAASMGSFILAGGEITRRIA
CLPP_HUPLU       DMYLYVNSPG--GAVFAGISIYDAMQFVVP--DVQTICIGLAASMGSFVLAGGEITKRIA
CLPP_CYCTA       DIYPYINSPG--GAVIPGISIYDAMQFVVP--DVHTICMGLAASMGSSVLTGGEITKRIA
CLPP_ZYGCR       DMYMYINSPG--GAVLAGISVYDAMQFVVP--DVHTICMGLAASMGSFILTGGEISKRLA
CLPP_CHAVU       EMFMYINSPG--GSVVAGIAVFDAMQYVGP--DVTTICMGMAASMGSFILMGGEMTKRIA
CLPP_CHAGL       DMYLYINSPG--GAVVPGIAIYDTMQFVEP--EIRTICMGVAASMGSFILTGGEITKRIA
CLPP_PINKO       DIFSFINCPG--GSVIPGVGLFDMMQVIVP--NVHTICMGVAASMGSFILIGGEITKRMA
CLPP_ACOGR       DFFLFINSPG--GWVIPGIGLYDTMQFVPP--DVHTICMGLAASMGSFILVGGEITKRLA
CLPP_AMBTC       DLYLFINSPG--GWVIPGIAIYDAMQFVPP--DVHTICMGLAASMGSFVLAGGEITKRLA
CLPP_CUCSA       DQYLFINSPG--GSVIPGVGLFDTMQFVSP--DVHTICIGLAASMGSFILVGGEITKRLA
CLPP_EPIVI       EIYLFINSPG--GWVIPGVAIYDTMQFVRP--EVHTICMGLAASMGSFLLVGGEITKRLA
CLPP_PHAVU       DLYLFINSPG--GWVIPGIALYDTMQFVQP--DVQTVCLGLAASMGSFLLAGGTITKRLA
CLPP1_ARATH      DLYLFINSPG--GWVISGMAIYDTMQFVRP--DVQTICMGLAASIASFILVGGAITKRIA
CLPP_POPTR       DLYLFINSPG--GWVIPGIAIYDTMQFVRP--DVQTVCMGLAASMGSFILVGGKITKRLA
CLPP_VITVI       DLYFFINSPG--GWVLPGIAIYDTMQFVPP--EVHTICLGLAASMGSFILVGGTITKRLA
CLPP_CITSI       DLYLFINSPG--GWVIPGIAIYDTMQFVRP--DVQTICMGLAASMGSFLLAAGASTKRLA
CLPP_SOLLC       DLYLFVNSPG--GWVIPGIAIYDTMQFVRP--DIHTICLGLAASMGSFILAGGQLTKRIA
CLPP_AGRST       DIFLFINSPG--GWLISGMAIFDTMQTVTP--DIYTICLGVAASMASFVLIGGEPTKRIA
CLPP_CUSRE       DIFLFINSPG--GGIISGFAIYDTMQFVRP--DIQTICVGLAASMGSFLLVGGAITKRLA
CLPP_CUSGR       DIFFFLNSPG--GGIISGLAIYDSMQVVRP--DTQTICVGLAASMACFLLVGGTITKRLA
CLPP_PELHO       TQTLYINCLG--GLIIPGLALYDTIGFVEP--DVKTICLGIAASMASVVLVGGTVTERCA
CLPP_OENEH       NLYFFINSPG--GLAVAGLLIYDTMQYVTP--PVYTLGLGVLASMASFLLVGGETSKRLM
CLPP_BIGNA       LIYFYINSVG--GSVLSGISIYDTMNFINS--EIVTLCIGIASSISSLILANGKRTKRFI
                      :   *  *       : :                .   . .  :        *  

CLPP1_RHOBA      LPNSRVMMHQPL---GGVSG--QVSDIEIQAAEMFRYRDKLNEIISSHCGKSVEQIAKDT
CLPP1_CYAPA      FASSRIMIHQPL---SKVEA--PWSHLDIQIRNGAYFKNLLNNILSFHTKQELKQIETDT
CLPP_ECOLI       LPNSRVMIHQPL---GGYQG--QATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDT
CLPP_BAUCH       LPNARMMIHQPM---GGFQG--QATDIQIHAKEILKVKNRMNELMAKHIGKTLQVIEQDT
CLPP_BLOPB       LPNARIMIHQPL---GSFQG--QATDIAIHTREILKIKNNINKLMAKHTGQSIDIINKDT
CLPP_BLOFL       LPNSRVMIHQPL---GSLHG--QATDIAIHATEILKVKENINKLMAKHTGKSIDVIRQDM
CLPP_WIGBR       LPNARIMIHQPL---GGSQG--QATDIAIHTTEILKIKKCMIELLSKHTGQSAEIISKDT
CLPP_BUCAI       LPNSKVMIHQPL---GGYQG--QASDIAIHAREIMEMKKKLNKLMSFHTGQSIKKINKDT
CLPP_BUCAP       LPNARIMIHQPL---GGYQG--QASDIAIHAEEINKMKKKLNKLMSLNTGQSIKKINKDT
CLPP_BUCBP       LPNSRIMIHQPI---GGYNG--QASDIEIHAKEIIKVKRKLNELMAFHTSQSINTIEKDT
CLPP2_METCA      LPHSRIMIHQPL---GGFQG--QASDIDIHAREILAVRDRLNKILAHHTGQPIEKIQIDT
CLPP_NITOC       LPHSRLLIHQPL---GGFQG--QATDIDIHAREILLVRERLNHILAKHTGQPIEKIQHDT
CLPP_HAHCH       LPHSRVMIHQPLL--GGLQG--QASDIEIHAKEILLLREKLNNILSKHTGQDIETIARDT
CLPP_CHRSD       LPHSRMMIHQPL---GGYQG--QAADIEIHTKEILNIRQQLNEILAKHTGQDAETVARDT
CLPP_PSEF5       LPNSRVMIHQPL---GGFQG--QASDIEIHAKEILFIRERLNTLMAKHSGRTLEEIERDT
CLPP_PSEMY       LPNSRVMIHQPL---GGFQG--QASDIEIHAKEILFIRERLNELLAHHTGQSLETIERDT
CLPP1_PSEAE      LPHSRMMIHQPL---GGFQG--QASDIEIHAKEILFIKERLNQILAHHTGQPLDVIARDT
CLPP_PHOPR       LPNSRVMIHQPL---GGFQG--QASDIQIHAKEILTIKHRLNSLLAKHTGQPLEVVEGDT
CLPP_SHEAM       LPNSRVMIHQPL---GGFQG--QASDIAIHAQEILGIKHKLNQMLSHHTGQPMEVIERDT
CLPP_IDILO       LPNSRVMIHQPL---GGFQG--QASDFEIHAKQILDLKERLNRMLAENTGQDYEKVARDT
CLPP_PSEA6       LPNARVMIHQPL---GGFQG--QASDFEIHAKEILSIKEKMNRLMAAHTGQDYDKVARDT
CLPP_COLP3       LPNARVMIHQPL---GGFQG--QASDFEIHAKEILFIKDKLNKLMAEHTGQTLDKVSQDT
CLPP_PSET1       LPNSRVMIHQPL---GGFQG--QASDFEIHAKEILSIKDKLNRLMAEHTGQPLDVISKDT
CLPP_HYDCU       LPNSRVMIHQPL---GGFQG--QASDIEIHAKEIIQIKQKLNKALADHTGQPIEVIENDT
CLPP_ALCBS       LPNARVMIHQPL---GGFQG--QASDIEIHAKEILKIKGQLNSLLAHHTGQPIEQLEKDT
CLPP_SACD2       LPNARTMIHQPS---GGAQG--QASDIHIQAQEILKLRERLNEIMAGHTGRGVEEIARDT
CLPP_ACIAD       LENARVMIHQPL---GGFRG--QASDIEIHAREILFIKERLNRLMAEHSGQDYERVARDT
CLPP_PSYA2       LANARVMIHQPS---GGAQG--QATDIEINAREILKTRARLNEILAERTGQSVEKIEKDV
CLPP_HISS2       LPHARVMIHQPL---GGFRG--QASDIQIHAQEILKIKQTLNERLAFHTGQSIEQIEQDT
CLPP_HAEDU       LPNARVMIHQPL---GGARG--QATDIQIQAQEILKLKEMLTRKMAEHSGQTFAKVAADT
CLPP_RUTMC       LPNVRCMIHQPL---GGFSG--QASDIDIHAQEILKVREKLNQIFKLHTSQTIKTIQKDT
CLPP_LEGPL       LPNSRVMIHQPL---GGYRG--QATDIEIHARETLAVRERLNNIMAKHTKKTPDQIMRDT
CLPP_COXBN       LPHSSVMIHQVL---GGYQG--QGTDIQIHAKQTQRVSDQLNQILAKHTGKDIERVEKDT
CLPP_XYLFT       LPNSRVMIHQPL---GGFQG--QATDIDIHAREILALRARLNEILAKHTGQSLETIAHDT
CLPP_MAGSA       LPNSRIMVHQPS---GGAQG--QATDIEIQAREILALRARLNNIYVEHTGQPLDVIEKVM
CLPP_AZOBR       LPNSRIMIHQPS---GGAQG--QASDIEIQAQEILKLRSRLNDIYVKHTGQSLDTIEAXM
CLPP_RHORT       TPNARIMIHQPS---GGFQG--QAADIEIQAREILALRERLNRIYVKHTGQPLETIERAM
CLPP1_GLUOX      LPNARVMVHQPS---GGAQG--QASDIEIQAREILIIRQRLNEIYREHTGQTLEQIEQKL
CLPP_NOVAD       LPNARIMIHQPS---GGARG--MASDIEIQAREILRIRKRMNDLYVKFTGRSLDEIEKAM
CLPP_SPHAL       LTNARVMVHQPS---GGARG--MASDIEIQAKEILRIRKRMNDLYVKYTGKSLKDIEKAM
CLPP_ZYMMO       TTNSRIMIHQPS---GGAQG--MAADIEIQAREILRMRKRLNALYAKYTNQPIEEIEKAM
CLPP_BARBK       LPNARIMVHQPS---GGFQG--QASDIERHAQDIIRMKRHLNEIYVQHTGQDYEIIENTL
CLPP_BRUSU       LPNARIMVHQPS---GGFQG--QASDIERHAQDIIKMKRRLNEIYVKHTGRDYDTIERTL
CLPP1_CHESB      TPNARVMVHQPS---GGFQG--QASDIERHAQDIIKLKRRLNEIYVKHTGQDYDTIERTL
CLPP2_AGRFC      TPNARIMVHQPS---GGFQG--QASDIERHARDIIKMKRRLNEVYVKHTGRTLEEVEKTL
CLPP_CAUVC       LPNARIMVHQPS---GGFRG--QASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTL
CLPP_MARMM       APNARIMVHQPS---GGFRG--QASDIERHAADIQKIKRRLNEIYVHHTGRTYDEIESAL
CLPP_RUEPO       LPNSRIMVHQPS---GGYQG--QASDIMIHAAETQKLKDRLYDIYVKHTGQTKKAVEKAL
CLPP_DINSH       LPNSRIMVHQPS---GGYQG--QATDIMIHAQETQKLKDRLNQIYVKHTGQPLKKVVDAL
CLPP_RHOS5       LPNSRVMVHQPS---GGYQG--QATDIMIHARETEKLKRRLNEIYVKHTGQDLDTVEAAL
CLPP_JANSC       LPNAEFLVHQPS---GGARG--TASDILISARSIEATRERLYQLYVKHTGQDYETVQRAL
CLPP_AZOC5       LPNARIMVHQPS---GGFQG--QVTDIMLHAQEILSLKKRLNEIYVKHTGQPIEKIEDAL
CLPP1_RHIEC      LPNASILIHQPS---GGFQG--QASDMLIHAEEILKTKQRMTRLYAEHCGRSYEDFERGM
CLPP1_BRADU      LPNASLHVHQPL---GGFQG--QASDILIHANEMQETKRRITRLYAQHCGRTEAEVERTL
CLPP2_CHESB      LPNASIILHQPL---GGFQG--QASDIERHAQNVMRHKRRMIRLYAEHCGRAEEDVERTL
CLPP1_RHILO      LPNATILLHQPL---GGFQG--QASDIQRHAERIGKTKQRMAELYAQHCGRSYEEVERTL
CLPP_PELUB       LPNSRIMVHQPS---AGFQG--QATDIEIHANEVLALKKRLNEIYSKHTGKSVDDVKKAL
CLPP_ANAPZ       LPNSRVMIHQPS---GGFRG--QATDIEIHAREILEIKRRLNEIFVRHTGKSLEEIESSM
CLPP_EHRRG       LPNSRIMIHQPS---GGFQG--QATDIEIHAKEILNIKSRLNYIYVKHTGRELSEVVASM
CLPP_WOLPM       LPHSRIMIHQPS---GGYHG--QATDIEIHANEILRVKKKLNQIYEKHTGNSLKKIEGMM
CLPP_RICPR       LPHSRIMIHQPS---GGYKG--QATDIEIHARETLKIKRLLNELYSKHTKQELKYIEKSM
CLPP_RICBR       LPHSRVMIHQPS---GGYRG--QATDIEIHAQETLKIKKILNSLYSKHTGQDVKHVEKSM
CLPP_NEOSM       LPHSRVMVHQPS---GGVRG--QATDMEIHVKEILQLKRMINEIYQKHTGETIKKIETLL
CLPP_RHOFT       LPNSKVMIHQPSG---GSQG--QATEIEIQAREILKTREQLNKILAERTGQPLARIERDT
CLPP_METPP       LPNSRVMIHQPSG---GAQG--QATDIEIQAREILKLRESLNGILAERTGQPLEKIRADS
CLPP_ACISJ       LPNSKIMIHQVLG---GARG--QATDIEIHARDILRTKEQMNRILAERTGQPIEKVKADT
CLPP_RALSO       LPNSRIMIHQPLG---GARG--QASDIEIQAREILYLRERLNTILSEVTGQPVDKIARDT
CLPP2_PARXL      LPNSRVMIHQPLG---GARG--QASDIEIQAREILYLKERLNHLLAHHTGQPVERIARDT
CLPP_AROAE       LPNSRVMIHQPLG---GFQG--QASDIEIHAREILGIRAKLNEMLAKHTGQPIEQIEKDT
CLPP_DECAR       LPNSRVMIHQPLG---GFQG--QASDIAIHAKEILSIRDRLNRIMAEHSGQPLERIEKDT
CLPP_BORA1       LPNSRIMIHQPSG---GAQG--QASDIQIQAKEILDLRERLNRILAENTGQSMERIAIDT
CLPP_METFK       LPNSRVMIHQPLG---GFQG--QASDIEIHAKEILFLREKLNHILASHTGQPVEKIALDT
CLPP_NITEC       LPNSRVMIHQPLG---GFQG--QASDIEIHAKEILALKGRLNEILAKHTSQTIRTIEKDT
CLPP_NITMU       LPNSRVMIHQPLG---GFQG--QASDIEIHAREILYLKNRLNELLSKHTGQSMETIERDT
CLPP_THIDA       LPNSRVMIHQPLG---GFQG--QASDIEIHAKEILYLKARLNGMLAKHTGQSLEVIDRDT
CLPP1_PARXL      LPNARIMIHQPSG---GSQG--TAADVEIQAKEVLYLRERLNAMMAERTGRSIEEIARDT
CLPP_NEIG1       LPNSRIMIHQPLI-SGGLGG--QASDIEIHARELLKIKEKLNRLMAKHCGRDLADLERDT
CLPP_CHRVO       LENSRVMIHQPLLYGGGLSG--QVTDIEIHARELVKVKAKMNELLAKHSGQTLERVQSDT
CLPP_DICNV       LPNSRVMIHQPLG---GFRG--QASDIDIHAREILFIRERLNQILAKHSGQDLETISRDT
CLPP_FRAP2       LPSSQIMIHQPLG---GFRG--QASDIEIHAKNILRIKDRLNKVLAHHTGQDLETIVRDT
CLPP1_TREDE      LPSSRVMIHQPW---GGVQG--QAVDINIQAKEIVRLKKLTIKYFAENTGKTEKQVAADM
CLPP1_TREPA      LPSSRVMIHQPW---GGVQG--QASDVCIQAQEILRLKTLTIAYFALHTGQSEEQVREDM
CLPP_BORBP       LAYSRIMIHQPW---GGISG--QASDINIQANEILRLKKLIIDIMSNQIGIDKEKLALDM
CLPP_CAMJJ       LPNSRIMIHQPL---GGARG--QATDIEIQAKEILRLKTILNDILAKNTKQKVAKIAKDT
CLPP_WOLSU       LPNSRIMIHQPL---GGAQG--QATDIEIQAKEILRLKSILNGILASNTGQPLEKIAKDT
CLPP_NITSB       LPHARIMIHQPL---GGAQG--QATDIEIQAKEILRLKKILNEILAENTGQSVKKIAKDT
CLPP_HELHP       LPNSRIMIHQPL---GGAQG--QATDIEIQAREILRLKKILNEIMAHNTGQKIEKITQDT
CLPP_HELAH       LPHSRIMIHQPL---GGAQG--QASDIEIISNEIIRLKGLMNSILAQNSKQSLERIAKDT
CLPP_CAMHC       LPNARIMIHQPL---GGAQG--QATDIEITTKEILRIKATLNKILAENSGQKLSKIEKDT
CLPP_SULNB       LPHARIMIHQPS---GGAQG--QSTDIQIQAQEIQRLKDTLNEIMAEKTGKTAKRIEKDT
CLPP_ARCB4       LPNSRIMIHQPL---GGARG--QATDIQIQAKEIQRLKDTLNGILASQTGQDFATIEKDT
CLPP_SULDN       LPHARIMIHQPL---GGAQG--QATDIAIQAKEILRMKEELNAILAKNCSQSIKKVEKDT
CLPP_DESPS       LPNSRIMIHQPL---GGFQG--QATDIEIHTKEILRIRKDLNNILAHHTGKTLKKIESDT
CLPP_CHLTE       LPHSRIMIHQPS---GGAQG--QETDILIQAREIEKIRHLLEDLLAKHTGQEVSRIREDS
CLPP_AQUAE       LPHSRIMIHQPL---GGIQG--QATDIIIHAEEIKRIKEMLIDILAKHTGQPKDKIANDI
CLPP_CARHZ       LPYARIMIHQPL---GGVQG--QATDIDIHAREILRMRDMLNELLTKHTGQPKEKIERDT
CLPP_DESRM       LPMARIMIHQPL---GGVQG--QATDIDIHAKEILRMKDLLNDRLAHHTGQPLEQITRDT
CLPP_KORVE       LPTSRILIHQPLM--SGLSG--QATDIDIHAREILRMREITNQLLAKHCNQRLEKVEKDV
CLPP_DESVV       LPHSRIMIHQPS---GGFQG--QATDIDIQAREVLRLKQSLNAIMSQHTGKPLEQVALDT
CLPP_DESAG       LPNSRIMIHQPM---GGAQG--QATDIDIQAREILRLKDRLNEILSRHTGQPLEKIVEHT
CLPP_LAWIP       LPNSQVMIHQPL---GGYQG--QATDIDIHAREILRMRQRLNEILMEQTGQSLEKVAQDT
CLPP_GEOSL       LKHSRIMIHQPL---GGFQG--QATDIHIHAQEILKLKKRLNEILAENTGQQLAKVEADT
CLPP_GEOUR       LTNSRIMIHQPL---GGFQG--QATDIHIHAQEILRMKKKLNELMAEHTGQPVEKLEADT
CLPP_PELPD       LNHSRIMIHQPL---GGFQG--QATDISIHAKEILRMKEELNSILADLTGQSKERIEADT
CLPP_PELCD       LPHARIMIHQPW---GGFQG--QATDINIHAQEILRLRETLNGVLASHTGQTLEKIATDT
CLPP_SYNAS       LPHSRILIHQPL---GGFQG--QATDIDIQAREILRLKDELSLILADLTNQPLDRIKTDT
CLPP1_NOSS1      LPHSRIMIHQPL---GGAQG--QATDIEIQAREILYHKRRLNDYLAEHTGQPIERIAEDT
CLPP1_SYNY3      LPNSRIMIHQPL---GGAQG--QATDIEIQAKEILYLKALLNQHLANHTGKSLEEITADT
CLPP1_PROMA      LQHSRIMIHQPL---GGARG--QATDIRIQADEILFLKQKLNTELSNRTGQPLSKIAEDT
CLPP1_PROMP      LRHSRIMIHQPL---GGARG--QASDIRIQADEILYLKERLNTELSERTGKELETIKGDT
CLPP1_SYNP6      LAHSRIMIHQPL---GGAQG--QAKDIEIQANEILYIKQNLNEVLAERTGQPLSRIEDDT
CLPP3_TRIV2      LPDSRIMIHQPL---GGAQG--QAIDIEIQAREILYIKAQLNQLLANHTGQPLERIEADT
CLPP2_SYNY3      LPSSRIMIHQPL---GGAQG--QAVEIEIQAREILYIKDRLNTMLVEHTGQPMEKLQEDT
CLPP1_THEEB      LPNARIMIHQPL---GGAQG--QAVDIEIQAREILYHKRKLNELLSQHTGQPIERIEADT
CLPP3_PROMT      LPNSRIMIHQPL---GGAQG--QAVEIEIQAKEILYLKETLNSLLAEHTGQNIQKISEDT
CLPP1_PROMM      LPNARIMIHQPL---GGAQG--QAVDIEIQAKEILFLKETLNGLLAEHTGQPLNKIAEDT
CLPP3_PROMP      LPNSRIMIHQPL---GGAQG--QAVEIEIQAKEILFLKKTLNSLLAKHTNQSLEKINEDT
CLPP2_SYNE7      LPSARIMIHQPL---GGAQG--QAVDIEIQAREILYHKSTLNDLLAQHTGQPLEKIEVDT
CLPP2_SYNJA      LPHARIMIHQPL---GGAQG--PATDIEIQAKEILFIKNSLNSLLAYHTGQPLERIERDT
CLPP_FUSNN       LENSRIMIHQPLIS-GGLKG--QATDISIHANELLKIKDRLAELLAKNTGKTKEQILRDT
CLPP2_MYXXA      LPSSRIMIHQPL---GGVRG--QATDIEIQAKEILRMKAKLNELIVKHTGQSIERVEKDT
CLPP2_MYXXD      LPNSRIMIHQPL---GGAQG--QATDIDIQAKEILRLRSYINGLIVKHTGHTIERIEKDT
CLPP_ANADE       VPNARIMIHQLS---GGFQG--QATDIEIQAKEALRLKAKLNEIMARHTRQPIERIERDT
CLPP_LEPIN       LPNARIMMHQPM---GGATG--QASDIEIQAREVLKLKEILNSIYHKHTGKTVEQIQKDT
CLPP_SYNFM       LPHVRIMLHQPM---GGFQG--QATDVEIQAKEILKLREELNDILVRHTGRPVEQIQRDT
CLPP_LACDB       LPHATVLIHQPL---GGAQG--QATEIQIAAEEILKTRKMINEILAKDSGQDIETIKRDT
CLPP_LACP3       LPNSTILIHQPS---GGAQG--QQTEIEIAAEEILKTRRKMNQILADATGQTIEQIKKDT
CLPP_LACSS       LPNSTVLIHQPL---GGAQG--QQTEIEIAAREILKTRKRLNQILADNSGQTFEKLQADT
CLPP_LACJO       LPNSTVLIHQPL---GGAQG--QQTDIQIAANEILKSRKKLNQILHETTGQPLDKILKDT
CLPP_LACPL       LPNSEILIHQPS---GGAQG--QQTEIEIVAEEILKTRKKINQILADNSGQSVEKLNHDT
CLPP_LACBA       LPHAQVMIHQPS---GGAQG--QQTEIEIAAREILKTRELINKILAENSGQPIERLNQDT
CLPP_LACRD       LPHSQVLIHQPS---GGAQG--QQTEIEIAATEILKTRKMLNGILAKNSGQPIEKIQADT
CLPP_LACS1       LPNSEIMIHQPL---GGAQG--QSTEIQIAAEHILKTRKLINQILADGSGQDIETINKDT
CLPP_STRA3       LPNAEYMIHQPM---GGTGGGTQQSDMAIAAEHLLKTRHTLEKILADNSGQSIEKVHDDA
CLPP_LACLS       LPNAEYLIHQPM---GGAGQGTQQTDMAIVAEQLLKTRKRLEQILADNSNRSLEQIHKDA
CLPP1_DESHY      LANSEVLIHQPSIS-GGLQG--QTTDIKIHSDWLTKTKEKLNETYSRLTGQPLEKIQKDM
CLPP1_SYMTH      LPNARVMIHQPHL--SGVGG--QVTDIEITAREAVKTKQLMAEILAKHSGQSVERILADT
CLPP2_SYMTH      LPHARILIHQPWVK-GGIGG--QVTDIEITAKELLHTKEKLAEIIAKHTGQPLEKVKEDS
CLPP_BDEBA       LPNTRIMIHQPLLSGGGLSG--QVTDIEIHAKELVKTKEKLTRIYETHTGRDYDTLRAAM
CLPP_SYNWW       LPNAEIMIHQPA---GGTQG--QATDIEIHARRIMNMKESLNKILAERTGQPLERIQKDT
CLPP_MOOTA       LPNSEIMIHQPM---GGTQG--QAVDIEIHAKRILAIRDNLNRILSEITGKPLEQIARDT
CLPP_ALKMQ       LPNAEVMIHQPL---GGTRG--QAEDIRIHAERIVKLRDTLNKILVERTGQPLERVQKDT
CLPP_CALS8       LPNSEIMIHQPI---GGVRG--QATDIKIHAEWILKIKQRINRILAERTGQPIEVIERDT
CLPP_HUNT2       LPNSEIMIHQPL---GGARG--QATDIKIHAEQIIKIKNKLNRILSERTGQPFEKIERDT
CLPP_CALS4       LPNSEIMIHQPW---GGMQG--QATDIKIHAERLLRLRDKLERILSENTGQPLEKIKADM
CLPP_CLOTE       LPNSEIMIHQPL---GGFQG--QATDIGIHADRILKIKQNLNSILSEKTGQPLEVIQRDT
CLPP_CLOK5       LPNSEIMIHQPL---GGFQG--QATDIGIHADRILRIKKKLNAIISERTGQSIEKVEKDT
CLPP_CLOB1       LPNSEVMIHQPL---GGFRG--QATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDT
CLPP_CLOAB       LPNSEIMIHQPL---GGFKG--QATDIGIHAQRILEIKKKLNSIYSERTGKPIEVIEKDT
CLPP_CLOPS       LPNAEIMIHQPL---GGFQG--QATDIDIHAKRILKIKDKLNQILSENTNQPLEKIKVDV
CLPP2_DESHY      LPNAEILIHQPLIGGGGISG--QATEIEIHAKHLLRVKERMNRILAERTGQTIERIEADT
CLPP1_BACHD      LPNSEVMIHQPL---GGTRG--QASDIEIHTRRILEMRETLNRILAERTGQPLEQIAKDT
CLPP2_BACSK      LPNSEVMIHQPL---GGMQG--QAADMEIHARRIIQMREKLNQIMAERSGQPYERIARDT
CLPP_OCEIH       LPNSEIMIHQPL---GGTQG--QATDIEIHAKRIIDIKRRMNEIMAEKTGQPIEVIERDT
CLPP_GEOKA       LPNSEIMIHQPL---GGAQG--QATEIEIAAKRILFLRDKLNRILSENTGQPIEVIERDT
CLPP2_BACC1      LPNSEVMIHQPL---GGAQG--QATEIEIAAKRILFLREKLNQILADRTGQPLEVLQRDT
CLPP_LISIN       LPNAEIMIHQPL---GGAQG--QATEIEIAARHILKIKERMNTIMAEKTGQPYEVIARDT
CLPP_ENTFA       LPNAEIMIHQPL---GGAQG--QATEIEIAARHILDTRQRLNSILAERTGQPIEVIERDT
CLPP_STAS1       LPNAEVMIHQPL---GGAQG--QATEIEIAANHILKTRAKLNQILAERTGQSIEKIEQDT
CLPP1_BACSK      LPHAEVMIHQPH---GGMKG--QASDMDIYAQRILKQRKEINHFIAERTGQTPDKIATDS
CLPP2_BACLD      LKNSEIMIHQPL---GGVKG--QATDMEISAKRIIKLREKIERFFHERTGQPIEKLKADM
CLPP1_BACC1      LPNSEIMIHQPL---GGVKG--QATEIEITAKRILKLKHDINKIIADRTGQPIEKIAHDT
CLPP2_BACHD      LPNSEIMIHQPS---GGAQG--QASDLAITAKRILGIREKLVTVTSERTGQSPEKVAKDM
CLPP_THEMA       LPNARIMIHQPL---GGAEG--PAKDVEIITRELLRIKDLLNRILSKHTGQPIEKIEKDT
CLPP_PSELT       LPNARIMLHQPL---GGAEG--PVKDVEIITKELLRIKNLINTILSEKTGQPLDRIEKDT
CLPP2_CHLPN      LPHSRMMIHQPS---GGIIG--TSADIQLQAAEILTLKKHLANILSECTGQPVEKIIEDS
CLPP2_PARUW      LPNSRIMIHQPY---GGVGG--TSADVALQAKEILELKKRLNHIMADSTRQPLEKIAADS
CLPP2_RHOBA      LPNARIMIHQPL---AGMQG--TAREVEIHVAELRRIKQRMNEIMIEHTGHSLEKIEEDT
CLPP2_SALRD      LPNSRVMIHQPM---GGAEG--QASDIEIQAEEIMWLKERLYEILALHTGQDIDQIEADA
CLPP1_SALRD      LPNSRVMMHQPM---GGTEG--QASDIEIQAKEMAWLKKRLYQILSFHTGKDIDQIEEDA
CLPP_THET2       LPHAKVMIHQPW---GGVRG--TASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDT
CLPP_DEIGD       LPNSRIMIHQGS---AGFRG--NTPDLEVQAKEVLRLRDTLIDIYHRHTNLPHEKLLRDM
CLPP_DEHM1       LPNATIHMHQAM---GGAQG--QASDIEIAAREIMRQQDILRNILVKHTGQPMEKIIHDS
CLPP2_FRACC      LENSRILIHQPS---AQGE--GQSSDIEIQAREILRMRSLLERMLAVHTGKKEEDIRKDI
CLPP3_FRACC      LENSRILIHQPS---AQGE--GQSSDIEIQAREILRVRALQETMLARHTGRTETEIRRDT
CLPP2_CORJK      LPNARVLIHQPA---TGGV-QGQVSDLEIQAKEIERMRKLMEETLARHTGKSAEQVRIDT
CLPP1_RHOJR      LPNARVLIHQPA---TGGI-QGQVSDLEIQAAEIERMRRLMETTLAKHTGKDAAVIRKDT
CLPP1_THEFY      LPNSRILIHQPA---TEGT-HGQASDVEIMANEIMRIRHQLETILAKHTGRSVEEISRDI
CLPP2_TROW8      LPNARILIHQPV---VASSGYGQASDIEIQAREIMRMREWLEKTLAQHSNKSVKQVSKDI
CLPP2_LEIXX      LPNARILIHQPA---VGEAGHGQASDILIQSNEINRMRAWLEETLVKHSSRTLEQVNKDI
CLPP4_STRAW      LPNARVLIHQPY---SETG-RGQVSDLEIAANEILRMRSQLEDMLAKHSTTPIEKIREDI
CLPP5_STRAW      LPGARVLIHQPS---LPAPVQGQASDLVIQAAELARTREQLEELLVRHTGQSPERVAADI
CLPP1_BIFLO      LPNARVLIHQPA---IDQG-FGKATEIEIQAKEMLRMREWLEETLAKHTGQDVEKIRRDI
CLPP1_CUTAK      LPNSTVLIHQPA---MGQATYGQATDIEILDDEIQRIRKLMENMLATATGQSVEQISKDI
CLPP4_RHOJR      LAHSRTLLHQPS---TQGN--GTISDLALQAAEIMRVRSQTEAILSKHTGQTVERLRRDT
CLPP_RUBXD       LPNTRILLHQPA---VGGL-AGQASDVEIHARELIRTKRRLNEILSEHTGQPYDKIERDT
CLPP_BACTN       LPHSRVMIHQPM---GGAQG--QASDIEITAREIQKLKKELYTIIADHSHTDFDKVWADS
CLPP_PORGI       LPHSRVMIHQPL---GGMQG--QASDLEIAAREILRVKKELYTIISSHSGKPVEQVEKDS
CLPP1_CORJK      LPHARIMMHQPS---AGVGG--TAADIAIQAEQFAYTKREMAELIAEFTGQTVEQITKDS
CLPP2_COREF      LPHARIMMHQPS---AGVGG--TAADIAIQAEQFAQTKREMAKLIAEHTGQTFEQVTKDS
CLPP2_RHOJR      LPHARIMMHQPS---AGIGG--TASDIAIMAEQFAHTKREMAELIAEHTGQTVEQITADS
CLPP2_MYCPA      LPHARILMHQPL---GGVTG--SAADIAIQAEQFHVIKKEMFRLNAEFTGQSIERIEADS
CLPP1_FRACC      LPHARIMMHQPS---GGIGG--TASDIAIQAEQMLYTKRMMQERIAFHTGQPIEQIERDS
CLPP4_FRACC      LPHARIMMHQPH---GGIGG--TAADISIQAEQMLYTKRTLQERIAFHTGQTVEQIETDS
CLPP2_CUTAK      LPHAKILMHQPL---GGVGG--TATEIAINAKMLKDTKRELSQLNADHSGHTLEQILEDS
CLPP3_STRCO      LPNARIMMHQPS---AGIGG--TTADIEIQADNLDFTKRTIERITAEHTGQSPETISRDG
CLPP1_STRAW      LPNARIMMHQPS---AGIGG--TTADIEIQAENLEFTKKAIERITAEHTGQSEETISRDG
CLPP3_RHOJR      LAHSRIMMHQPS---AGIGG--TAVDIAIQAESLERMKRQSQEILAAETGHPVEQIAEDS
CLPP2_THEFY      LPHTRIMMHQPS---GGIGG--TASDIRILADQLLYVKKMFLERISLHTGQPVEQIEKDA
CLPP1_TROW8      MPNARVLLHQPL---AGFGG--TASDIQTQAKLILDMKYRLSQITASRTGKTVEQIMEDG
CLPP1_LEIXX      TPNARVLLHQPH---GGFGG--TASDIRTQAQLILHMKKRLAEITSEATGKTVDQVNADG
CLPP2_BIFLO      TSHARVLMHQPS---GGIGG--TATDVRINAELIMDMKKTMSELTAEQTGHTLEEIYRDN
CLPP3_STRAW      LPNAEILIHQPS---AGLAG--SASDIKIHAERLLHTKKRMAELTAFHTGQTVEQVTRDS
CLPP3_NOSS1      LPHSRIMIHQPS---GGTRG--QATDIEIEAREILRIRHQLNQIYANNTSQPLAKIEKDM
CLPP2_THEEB      LPHSRIMIHQPS---GGTRG--QATDIEIEAREILRVRRQLNELYAYHTGQPLEKIERDM
CLPP1_SYNJA      LPHSRIMLHQPSL--GMIQG--QASDIEIRARETLRVKRRMNELLAQMTGQPLEKIERDV
CLPP2_SYNP6      LPHSRIMIHQPLG--GTGRR--QASDIEIEAKEILRIKKLLNQIMADRTGQPLEKIEKDT
CLPP_RIPO1       LPHARIMIHQPMG--GTGRR--QATDIQIEANEILRIRQQLNEILAHKTGQTIEKIQKDT
CLPP2_PROMP      LPHSRIMIHQPLG--GTSQR--QASDIEIEAREILRIKDMLNHSMSDMTGQSFEKIEKDT
CLPP1_GLOVI      LPHSRIMIHQPL---GGAQG--QATDIGIQAKEILYTKDRLNQILSERTGQPLERIERDT
CLPP2_GLOVI      LPNSRIILYQPY---GGARG--QATDINIRAQELLTTKRTLNQLLSIHTGKTVEQIDKDT
CLPP1_CHLMU      TPHARIMIHQPS---IGGTITGQATDLDIHAREILKTKARIIDVYVEATGQSREVIEKAI
CLPP1_PARUW      TPHSRIMIHQPL---LSGVIKGQATDLEIQAKEMLKTRNGLIEIYVQATGKNFAAIEKAI
CLPP2_LEPIC      WPNGKVMIHQPS---IGGQIVAPATDLKIHAEEILKTKTKLNQILADACGHPISKLEEDT
CLPP3_RHIME      LPNTRFLLHQPS---GG--TRGMASDIEIQAREIIKMNERLNRIFSEATGQPVDKIAKDT
CLPP3_AGRFC      LPNTRFLLHQPS---GG--TRGMASDIEIQAREIIKMNQRLIKIFSKATGQTEEKIAKDI
CLPP2_GLUOX      LPNTRFLLHQPM---GG--VRGPATDIDIEAREIIKMRERLNRIFAKETGQTYEKVAKDT
CLPP2_PSEAE      LPNTRFLLHQPS---GG--IQGPASNIEIYRREIVRMKERLDRIFAEATGQTPEKISADT
CLPP_PARDE       LPNTRFLIHQPS---VG--IGGTSTDMMIQAEQVRLMRDRLNQIFAEATGQPVERIEKDT
CLPP2_TREPA      LRNSRYLIHQPL---SG--MRGVATDIEIHARELEKTRSKLNALIASETGVSLDKVAQDT
CLPP2_TREDE      MPNSHYLIHQPL---SG--IKGVATEIEIHAKELEKMRVKINKLIAEETGTDEKKVAKDT
CLPP2_BORBU      LPFARYLLHQPL---SG--FKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDT
CLPP_OLTVI       LPHSRIMIHQPE---GGSRG--QASEVLSESEEVMRIRRQVGKIYAQRTGQPLRRISRDL
CLPP_TUPAK       LPHSRIMIHQPE---GGSQG--QASVVLSESEEVLRIRDEVAQIYSERTGQTLERISRDM
CLPP_OSTTA       LPHCRVMIHQPQ---GGMEG--QASEVVLEKEEIVRLRRLIGRLYVDLTGQPLSTIANDL
CLPP_NEPOL       LPHARMMIHQPE---GGSRG--QASDVMYESSEVERLRDIVVDCYVERTHQSRETIIIDL
CLPP_CHLAT       FPHARVMLHQPM---GGNGG--KAKYMVEESVEVKRLRELIAHLYAKRTGQPIERIRIDM
CLPP_PLETE       FPHSRIMIHQPE---GGSEG--QSSEIVHEAQEVVRIRRQVARIYAQRTGQPLDTIARDM
CLPP_ADICA       LPHARVMIHQPA---SSYYD-GQAGECVMEAEEVLKLRDCITKVYAQRTGKPLWLISEDM
CLPP_HUPLU       LPHARVMIHQPA---SSYYE-GQVGECIMEAEEVLKIRDCITKVYAQRTGKPLWVVSEDT
CLPP_CYCTA       LPHARVMIHQPA---SSYYD-GQAGECIMEAEEVLKLRDSITNVYVQRTGKPLWVISGDM
CLPP_ZYGCR       LPHARVMIHQPA---SSFYE-GQAGECMIEAEEVLKLKDCVTKVYMQRTGKPMAVISEDM
CLPP_CHAVU       LPHARVMIHQPA---SSYYD-GQAGECLMEAEEVLKLRDCIAKVYMNRTGQPGWVIYRDM
CLPP_CHAGL       LPHARVMIHQPS---SSYYK-DQAGELIMEAEEVLKLRDCITKVYVQRTGKPISVISEDM
CLPP_PINKO       LPHARVMIHQPA---SSYYD-GPAAEFHNEAKHITMLRNYITKCYIERTDNPEEVIQRDL
CLPP_ACOGR       FPHARVMIHQPA---SSFYE-AQAGEFVLEAEELLKLRETLTRVYVQRTGKPLWVVSEDM
CLPP_AMBTC       FPHARVMIHQPA---SSFYE-APAGEFILEAGELLKLRETITSVYVQRTGNPLWVVSEDM
CLPP_CUCSA       FPHARVMIHQPA---SSFSK-GKTGEFVLESTELLNLRETITKVYVQRTGKPLWVISEDL
CLPP_EPIVI       FPHARVMIHQPA---SYFFG-AQTGEFILEAEELLKLRETLTRVYVQRTGKPLWVISEDM
CLPP_PHAVU       FPHA--MIHQPA---SSFYE-AQAGEFILEAEELLKMRETITRVYVQRTGKSLWVISEDM
CLPP1_ARATH      FPHARVMIHQPA---SSFYE-AQTGEFILEAEELLKLRETITRVYVQRTGKPIWVISEDM
CLPP_POPTR       FPHARVMIHQPF---AAFYE-AQIGEFVLEAEELLKLREILTRVYAQRTGKPLWVVSEDM
CLPP_VITVI       FPHARVMIHQPA---AAFYE-AQAGEFVMEAEELLKLREIITKVYVQRTGKPLWVVSEDL
CLPP_CITSI       FPHARVMIHQPI---GAFYG-AQTGEFILDTEELLRLREILTMVYVQRSGKPLWVVSEDM
CLPP_SOLLC       FPHARVMIHEPY---SGFYM-AQVGEFVLEAIEMAKLRETLTRVYAEKTGQPVWVIHEDM
CLPP_AGRST       FPHARIMLHQPA---SAYYR-ARTPEFLLEVEELHKVREMITKVYALRTGKPFWVVSEDM
CLPP_CUSRE       FPHARVMIHQPM---SAFFE-TQTVEAILEAEELLKLRESLAKVYVQRTGKPDWVIAEDM
CLPP_CUSGR       FPHARVMMHQPL---STFFE-TQTGDAVMEVDELLKMRENLIEVYAQRTGKPHWVISEDI
CLPP_PELHO       FPNARVMIHQPR---AKEFD-DRFSDLNLEGHLFLQLRNCVTQIYIHRTNKPAWVIIADL
CLPP_OENEH       GPNGRVMIHQPE---SDYTHKDQSLEVQLDSGEVEDIRKMVIRVYLERTRLPREVLNDHL
CLPP_BIGNA       LPHSRVLLHQPI---MQVSG--QASDILIESEEILRLRRILTKIYIENIDQTISRVARDI
                        :::                                             .    

CLPP1_RHOBA      DRDFFLDAQQAKEYGLVDDLLLGTPASEEDED----------------------------
CLPP1_CYAPA      ERDFFLSATEAKQYGIIDHIFINNN-----------------------------------
CLPP_ECOLI       ERDRFLSAPEAVEYGLVDSILTHRN-----------------------------------
CLPP_BAUCH       ERDRFLSANEAVDYGLVDAILSHRI-----------------------------------
CLPP_BLOPB       ERDCFLSADEAMKYGLVDCVLSQRI-----------------------------------
CLPP_BLOFL       ERDCFLSADESVKYGLVDSVLSKRI-----------------------------------
CLPP_WIGBR       ERDRFFSGSEAVIYGLIDKVITCRK-----------------------------------
CLPP_BUCAI       ERDCFLSANQSIKYGLIDFILSQRQ-----------------------------------
CLPP_BUCAP       ERDCFLSAHESIKYGLIDLILTQR------------------------------------
CLPP_BUCBP       ERDCFLSANQAIKYGLIDTILSYRT-----------------------------------
CLPP2_METCA      DRDNFMGGDDAVSYGLIDKVLTHRTVTAA-------------------------------
CLPP_NITOC       DRDYFMSATESLAYGLVDSVLKQRAEISL-------------------------------
CLPP_HAHCH       DRDKFMDAEMAKNYGLIDSVLDKRVVG---------------------------------
CLPP_CHRSD       DRDNFMNGTQAVEYGLIDAMLDKRPVS---------------------------------
CLPP_PSEF5       NRDNFMSAEAAREYGLIDEVINQR--PA--------------------------------
CLPP_PSEMY       NRDNFMSAPRAVEYGIVDAVHEKRQMPV--------------------------------
CLPP1_PSEAE      DRDRFMSGDEAVKYGLIDKVMTQRDLAV--------------------------------
CLPP_PHOPR       DRDNFMSADQAVEYGLVDSVLTQRD-----------------------------------
CLPP_SHEAM       DRDNFMSATQAVEYGLIDSVLTSR------------------------------------
CLPP_IDILO       DRDHFLSAEESIDYGLVDGILRQRGEES--------------------------------
CLPP_PSEA6       DRDNFLSAQESVDYGLVDQVLANRPDASNSDAKK--------------------------
CLPP_COLP3       DRDNFLSAEAAVEYGLVDSILEQRNDK---------------------------------
CLPP_PSET1       DRDNFMSADQAVDYGIVDSVFKNRASK---------------------------------
CLPP_HYDCU       DRDNFMSADEACDYGLVDKVLTRR------------------------------------
CLPP_ALCBS       DRDNFMSADEAKEYGIIDAVLSQRPV----------------------------------
CLPP_SACD2       ERDRFMSAHESVEYGLIDKVLERRVGGE--------------------------------
CLPP_ACIAD       DRDNFMTAQAAKEYGLVDEVLSKRP-----------------------------------
CLPP_PSYA2       ERDYWLDAKEAKEYGLIDEVLERRPASL--------------------------------
CLPP_HISS2       DRDNFMSAEQAKLYGLVDDVLIKR------------------------------------
CLPP_HAEDU       ERDNFMSATEAKNYGLIDKVLTSRGEVA--------------------------------
CLPP_RUTMC       DRDNFMSANEATKYGLIDKVLAKR------------------------------------
CLPP_LEGPL       ERDNFMSATQAMEYGLIDKVLYDRQIAGHSTDL---------------------------
CLPP_COXBN       NRDYFLTPEEAVEYGLIDSIFTERP-----------------------------------
CLPP_XYLFT       ERDNFKSAVDAQAYGLVDQVFGQRQEELIQSS----------------------------
CLPP_MAGSA       ERDKFMTADEAKEFGLIDEVVNKRPAVEDDSAS---------------------------
CLPP_AZOBR       ERDKFMSPEEAKAFGLIDEVVEKRPGSIGDGAA---------------------------
CLPP_RHORT       DRDNYMTAEESRAFGLTDSVIERRALSDDGDTKSSS------------------------
CLPP1_GLUOX      ERDSYLSANEAREFGLIDKVVERNPHETTPDPS---------------------------
CLPP_NOVAD       DRDTFLEAEEAMKFGLVDKVFESRPATDSVGEGEGSGGAPA-------------------
CLPP_SPHAL       DRDTFLEADEAKEFGIVDHVYDRRPALPGDDAPRDVSEGPTP------------------
CLPP_ZYMMO       DRDNFLEADEAKAFGLIDKVFDKRPVASEEKE----------------------------
CLPP_BARBK       DRDHFMTAEEAKMFGLIDDVIQYRAETKKEEKD---------------------------
CLPP_BRUSU       DRDHFMTAQEALEFGLIDKVVEVRDVSADESK----------------------------
CLPP1_CHESB      DRDHFMTADEAQAFGLVDRVISEREAIEAPRTS---------------------------
CLPP2_AGRFC      DRDHFMDADEAKDWGVIDKILTSRQEMEGAVAN---------------------------
CLPP_CAUVC       DRDHFMSADEAKAWGLVDHVYDSRDAAE-AGAE---------------------------
CLPP_MARMM       DRDNFMSAQEGLEFGLVDKVIERRAEDEKEGSDS--------------------------
CLPP_RUEPO       DRDNFMSPEEAKEWGHIDEIVESRSKGDDAE-----------------------------
CLPP_DINSH       ERDNFMDAEQAKEWGLIDEIVESRANEDTSK-----------------------------
CLPP_RHOS5       ERDNFMSAEDAKAWGLIDEILESRGKTDDTAK----------------------------
CLPP_JANSC       DRDTWMTPEVALEWGHVDEIVTTRGADDAE------------------------------
CLPP_AZOC5       ERDNFMTANAAQEFGLIDTVIDKRPSDEPAKA----------------------------
CLPP1_RHIEC      DRDRFMTAEEALEWGLIERILKVREDTSSL------------------------------
CLPP1_BRADU      DRDHFMTAQQGVEWGLIDRVFAERDAT---------------------------------
CLPP2_CHESB      DRDFFMTAEDAREWGLVDHVYRRRAGDLPLIAPSS-------------------------
CLPP1_RHILO      DRDHFMTAREAQTWGIVDHVFDTRKKAA--------------------------------
CLPP_PELUB       ERDNFMTPDTAKEFGLIDEVVENRS-----------------------------------
CLPP_ANAPZ       ERDNFMIAEKARDFGIIDKVIEKRIEEK--------------------------------
CLPP_EHRRG       ERDNFMSADSAQDFGIIDKVIEKRLDIEV-------------------------------
CLPP_WOLPM       ERDKFMDPEEARKIGLIDRVIAERTDIEIENIKVKQKVG---------------------
CLPP_RICPR       ERDNFMSSEEAKKFGLVDNIISSRDTIAFLAQ----------------------------
CLPP_RICBR       ERDNFMSPEEAKKFGIIDKIITHRDIKLLKDKEQGQ------------------------
CLPP_NEOSM       ERDTFLSPEEAKKVGIIDDIITQRKENSGKQE----------------------------
CLPP_RHOFT       ERDYYMSADECKEYGLIDQVISKRA-----------------------------------
CLPP_METPP       ERDYFMSAEEATGYGLIDKVIAQRA-----------------------------------
CLPP_ACISJ       ERDYFMTADEAKDYGIVDQVIAKRP-----------------------------------
CLPP_RALSO       DRDNFMSGDQAKEYGLIDKVLARRGA----------------------------------
CLPP2_PARXL      DRDNFMSGDDAQAYGLVDQVAHKRP-----------------------------------
CLPP_AROAE       DRDRFMSAADAVEYGIVDKVLTNRADS---------------------------------
CLPP_DECAR       DRDNFLSAAEAAEYGLIDKVLTRRDAA---------------------------------
CLPP_BORA1       ERDTFMSAEDALSYGLVDKVLARREDV---------------------------------
CLPP_METFK       DRDNFMSAEQSVAYGIVDKVIASRADAA--------------------------------
CLPP_NITEC       DRDNFLGAEAAVKYSLVDAVLTSRKVKHE-------------------------------
CLPP_NITMU       DRDNFLGAEDSVKYGLVDAVLTSRGEGAG-------------------------------
CLPP_THIDA       DRDNFMSAEDSVKYGLVDKVLTSRNEAGN-------------------------------
CLPP1_PARXL      DRDNFMSAHAAKTYGLVDEVLETRAALGASPHLHDR------------------------
CLPP_NEIG1       DRDNFMSAEEAKEYGLIDQVLENRASLRL-------------------------------
CLPP_CHRVO       ERDNFMSAEEARAYGMIDKVLSSRRDVTA-------------------------------
CLPP_DICNV       ERDNFMSAERAQEYGLVDAILTHRESVSA-------------------------------
CLPP_FRAP2       DRDNFMMADEAKEYGLIDHVIESREAIIK-------------------------------
CLPP1_TREDE      ERDFFMSAEEALTYGIIDTVMNRRKDG---------------------------------
CLPP1_TREPA      ERDFFLSAEQACSYGIVDTVMKRRKHAQV-------------------------------
CLPP_BORBP       ERDYFMTSNDALKYGLIDSILVRE------------------------------------
CLPP_CAMJJ       ERDFFMSTQEAKEYGLIDKVLEKSFK----------------------------------
CLPP_WOLSU       DRDFFMSAQESKEYGLIDNVLEKSFK----------------------------------
CLPP_NITSB       ERDFFMSSEEAKEYGLIDQVLEKSAR----------------------------------
CLPP_HELHP       ERDFFMSGEEAKKYGLVDEILTKSLK----------------------------------
CLPP_HELAH       DRDFYMSALEAKEYGLIDKVLEKNVK----------------------------------
CLPP_CAMHC       DRDFYMSAQEAVKYGLIDKVLEKSLTE---------------------------------
CLPP_SULNB       ERDNFMSAKEAVEYGLIDKVLTKSFT----------------------------------
CLPP_ARCB4       DRDNFMSAEEACSYGLIDEVITKHK-----------------------------------
CLPP_SULDN       DRDNFMSAEESKEYGMIDEVLLKKSKE---------------------------------
CLPP_DESPS       ERDNFMSSVEAQKYGLIDEVLVKREDVEGAADNG--------------------------
CLPP_CHLTE       ERDRWMSAVEAKEYGLIDQIFEKRPAPKSEE-----------------------------
CLPP_AQUAE       ERDYFMSPYEAKDYGLIDKVIEKRE-----------------------------------
CLPP_CARHZ       ERDFFMSAAEAKEYGIIDEVITVRK-----------------------------------
CLPP_DESRM       ERDYFMSAEEAKKYGLIDEVMPYRK-----------------------------------
CLPP_KORVE       ERDFIMNAQQAKEYGLVDDIIYKHK-----------------------------------
CLPP_DESVV       ERDYFMGPEEAQAYGLIDRVLTSRSEATDTISK---------------------------
CLPP_DESAG       DRDYFMGPENAKNFGIIDRILTSRKDVEKDGK----------------------------
CLPP_LAWIP       ERDYFMTAEDAKAYGLIDKVLVSRKDLDIEHEKTE-------------------------
CLPP_GEOSL       ERDYFMSGAEAKDYGIIDNIIERNTPSGGTR-----------------------------
CLPP_GEOUR       ERDYFMSGEDAKNYGIIDSIISRNTITGGSR-----------------------------
CLPP_PELPD       DRDYFMSATEAEEYGLIDATFTRKPDSGGTP-----------------------------
CLPP_PELCD       ERDFFMGSEEAKKYGIVDDIVKRKV-----------------------------------
CLPP_SYNAS       ERDYYMTSQQAKEYGIIDEIIVKRS-----------------------------------
CLPP1_NOSS1      ERDFFMSPDEAKDYGLIDQVIDRHAAGSRPVAMVGQ------------------------
CLPP1_SYNY3      ERDFFMSAEESKEYGLIDQVINRRPSASDPI-----------------------------
CLPP1_PROMA      DRDFYMSPSEAISYGIIDNVLNKKPVSVL-------------------------------
CLPP1_PROMP      DRDFYMSPQEAVEYGLIDLVLDKKPVKNI-------------------------------
CLPP1_SYNP6      DRDFFMSASEAVEYGLIDRVIDRRALKATA------------------------------
CLPP3_TRIV2      DRDFFMSAEEAKNYGLIDQVISRQNLPTAGENVTIVK-----------------------
CLPP2_SYNY3      ERDFFMSAEEAKEYGLIDQVISRPNLPDPTTPVTSLG-----------------------
CLPP1_THEEB      ERDFFMSAEEAKAYGLIDQVVTRQTLLSP-------------------------------
CLPP3_PROMT      DRDHFLSPQEAVEYGLIDKVVSNLNSI---------------------------------
CLPP1_PROMM      DRDHFLSPAKAVEYGLIDRVVDSLTGGGIVKEG---------------------------
CLPP3_PROMP      ERDYFLSPEEAVEYGLIDKVIKNDK-----------------------------------
CLPP2_SYNE7      DRDFFMSPEEAKAYGLIDQVLTRPTMAITDHNDAVLQ-----------------------
CLPP2_SYNJA      DRDNFMTPEQAKEYGLIDQVITRRPQPSLAAVS---------------------------
CLPP_FUSNN       ERDNYLSSEEAVNYGLIDSVFRR-------------------------------------
CLPP2_MYXXA      DRDYFMGASEAKAYGIIDEIQNPRKVVGLGKEEKK-------------------------
CLPP2_MYXXD      ERDYFMSAEDARQYGLIDEVVEKQRVIAPTPAPAK-------------------------
CLPP_ANADE       ERDYFMSAGEAKEYGLIDDVFLHKKAADKKPQ----------------------------
CLPP_LEPIN       ERNFYMTADEAKNYGIIDTV----IQIDRKQTE---------------------------
CLPP_SYNFM       DRDFYMSGEQAREYGMVDHIFTSRLSILPSATS---------------------------
CLPP_LACDB       ERDHYMTAQEAKDYGLIDDIMVNQNK----------------------------------
CLPP_LACP3       ERDHYMSAQEAKDYGLIDDILVNKNTQK--------------------------------
CLPP_LACSS       DRDNYMTAQEAKDYGLIDDIMVNQPK----------------------------------
CLPP_LACJO       ERDNYLSAEEAKDYGLIDEILVNQKKD---------------------------------
CLPP_LACPL       ERDNYLSAQEAKDYGLIDDIMENNKLK---------------------------------
CLPP_LACBA       ERDNYLSAQEAVDYGLIDHIMTNSSEQKK-------------------------------
CLPP_LACRD       ERDHYLTAQEAVDYGLLDGVMENNSKLK--------------------------------
CLPP_LACS1       ERDNFMTAQQAVDYGLIDGIMKNKKKIK--------------------------------
CLPP_STRA3       ERDRWMSAQETLDYGFIDAIMENNNLQ---------------------------------
CLPP_LACLS       ERDHWMDAKETLEYGFIDEIMENNSLK---------------------------------
CLPP1_DESHY      ERDYYMTAGQAQDYGLIDKIL---------------------------------------
CLPP1_SYMTH      ERDRWMSAQEAVEYGLVDEVLHPREKASRSAR----------------------------
CLPP2_SYMTH      ERDRWMSAEEAKAYGLVDVVVQPRERKKA-------------------------------
CLPP_BDEBA       ERDNFMDPYQAKEFGLLDHVVESRKAKKG-------------------------------
CLPP_SYNWW       DRDYFMTAQEAKEYGIIDEVISHPKKTSKK------------------------------
CLPP_MOOTA       DRDHFMTAREAREYGLIDEVITKRELPAK-------------------------------
CLPP_ALKMQ       DRDFFMEAKEAKEYGIIDEVISSRK-----------------------------------
CLPP_CALS8       ERDFFMTAEEALKYGIIDKVIERRP-----------------------------------
CLPP_HUNT2       ERDFFMSAEEAKAYGIVDEVMERRK-----------------------------------
CLPP_CALS4       ERDYFMTAEEAKTYGIIDDILVRHKK----------------------------------
CLPP_CLOTE       ERDNFMDANQAKDYGLIDEVMVKKK-----------------------------------
CLPP_CLOK5       ERDNFMTAEEAKEYGLIDEVFTKKK-----------------------------------
CLPP_CLOB1       ERDHFLSAEEAKEYGLIDEVIDKKK-----------------------------------
CLPP_CLOAB       DRDHFLSAEEAKEYGLIDEVITKH------------------------------------
CLPP_CLOPS       ERDYFMEASEAVEYGLIDKVIERK------------------------------------
CLPP2_DESHY      DRDRYMTAEEAKEYGLIDEVLEKPNQPKK-------------------------------
CLPP1_BACHD      DRDNFMTAEKAREYGLIDKVIETTK-----------------------------------
CLPP2_BACSK      DRDNFMTAEQAKEYGLIDKVIETPTK----------------------------------
CLPP_OCEIH       ERDNFMTADQSVEYGLIDKILERK------------------------------------
CLPP_GEOKA       DRDNFMTAQKAMEYGIIDRVLTRADEK---------------------------------
CLPP2_BACC1      DRDNFMTAEKALEYGLIDKIFTNR------------------------------------
CLPP_LISIN       DRDNFMTAQEAKDYGLIDDIIVNKSGLKG-------------------------------
CLPP_ENTFA       DRDNYMTAEQAKEYGLIDEVMENSSALN--------------------------------
CLPP_STAS1       DRDNFLSAEEAKDYGLVDQVMVPES-----------------------------------
CLPP1_BACSK      ERDYFMSAAEAKDYGVIDNILPV-------------------------------------
CLPP2_BACLD      ERDYFMDADEAKAYGVIDAVL---------------------------------------
CLPP1_BACC1      ERDYFMTAEEAKEYGIVDGVVEKK------------------------------------
CLPP2_BACHD      DRDYFMSAEEALEYGIVDQIITSV------------------------------------
CLPP_THEMA       DRDFFMSAEEAKEYGIVDKVVSTRE-----------------------------------
CLPP_PSELT       DRDFFMSAYEALDYGLVDKVIESKRR----------------------------------
CLPP2_CHLPN      ERDFFMGAEEAISYGLIDKVVTSAKETNKDTSST--------------------------
CLPP2_PARUW      ERDFYMSAVEAKDYGLIDEVVVPKKKTT--------------------------------
CLPP2_RHOBA      DRDRFMSADEACSYGLIDKVVKSVDD----------------------------------
CLPP2_SALRD      DRNYWMSAEEAEEYGLVDNVLNPDNLEGLKSIQPNGEAADDSEDDA--------------
CLPP1_SALRD      DRNHWLSAEEAQEYGLVDQVMNEGNLDALKSIHANGEASDADSDEE--------------
CLPP_THET2       DRDYYLSAQEALEYGLIDQVVTREEA----------------------------------
CLPP_DEIGD       ERDYFMSPYEAQQYGLIDSVIEHTRQPEAAL-----------------------------
CLPP_DEHM1       DRDYYLNAQQAVEYGLIDEILQKPENK---------------------------------
CLPP2_FRACC      ERDKIFSADEAKEYGLIDEVIKTRKSSRLATAR---------------------------
CLPP3_FRACC      ERDKIFSADEAEEYGLIDEVIMSRKAARLLSARSA-------------------------
CLPP2_CORJK      DRDKILTAEEAKEYGIVDQVFDYRKLSAQN------------------------------
CLPP1_RHOJR      DRDKILTAAEAKEYGIIDDVLEYRKLSAQK------------------------------
CLPP1_THEFY      ERDKILTAEEAKEYGIVDDVLPYRKASLK-------------------------------
CLPP2_TROW8      DRDKILSSEQALEYGLIDQILVSRKAGLGKK-----------------------------
CLPP2_LEIXX      ERDNILSATEALKYGLIDQVLTSRKTLPALVK----------------------------
CLPP4_STRAW      ERDKILTAEDALAYGLIDQIISTRKMNNSAVA----------------------------
CLPP5_STRAW      ERDKILDAPAAVAYGLVDRVVPSRKSSAAAPGAR--------------------------
CLPP1_BIFLO      EVDTFLTAPEAKEYGIVDEVLEHRQ-----------------------------------
CLPP1_CUTAK      DRDKYLTAQGAKEYGLIDDILTSL------------------------------------
CLPP4_RHOJR      DRDRIFTAEEAIEYGLADTLVAA-------------------------------------
CLPP_RUBXD       DRDFIMGAEEAIEYGLIDDIVRHH------------------------------------
CLPP_BACTN       DRDYWMTAQEAKEYGMIDEVLIKK------------------------------------
CLPP_PORGI       DRDYWMTAPEALEYGMIDKILEKNRK----------------------------------
CLPP1_CORJK      DRDRWFTAQQAKEYGFVDHVITSAKES---------------------------------
CLPP2_COREF      DRDRWFTAEQAKEYGLVDHVITLAEGPISN------------------------------
CLPP2_RHOJR      DRDRWFTAQQALEYGFVDHVVSRAAQAGGTGQ----------------------------
CLPP2_MYCPA      DRDRWFTAQEALEYGFVDHIITRAATITNGEAQ---------------------------
CLPP1_FRACC      DRDRWFTAEEAKDYGFVDHVVQQARQVPSE----------------GPVS----------
CLPP4_FRACC      DRDRWFTAEEAKEYGLVDHVVVRADQVPSVVSGAGMGLRRAGRTGFGPGGGSGR------
CLPP2_CUTAK      DRDHWFTAQEALEYGLIDHVYSNASQLRGDAPNQ--------------------------
CLPP3_STRCO      DRDRWFTAEEAREYGMVDQVVQSLADVRPAATRRRMGL----------------------
CLPP1_STRAW      DRDRWFTAEQAKEYGMVDRVVESLDDVRPTASRRRMGL----------------------
CLPP3_RHOJR      DRDRWFTADEARDYGIVDRVVSSFAEIAPHTTAPRIGL----------------------
CLPP2_THEFY      DRDRWFTAQEALEYGFIDEVLTNTPDVTGGRS----------------------------
CLPP1_TROW8      DRDHWFTAEEALEYGFVDHIRTE-------------------------------------
CLPP1_LEIXX      DRDRWFTAQEALDYGFVDHIRESALLVAGGGGTAPAGK----------------------
CLPP2_BIFLO      EYDHWFTAQEALDYGFVDKLVTTPDTIGNNQQGE--------------------------
CLPP3_STRAW      DRDRWFDPVEAKEYGLIDDIMPTAAGMPGGGGTGAA------------------------
CLPP3_NOSS1      DRDFFMSAQEAMEYGLIDRVIEERV-----------------------------------
CLPP2_THEEB      DRDFFMSAEEAKNYGLIDRVIEERSN----------------------------------
CLPP1_SYNJA      ERDFYLSATEAQAYGIVDRVIQERSEAMAG------------------------------
CLPP2_SYNP6      DRDYFMSAEEAREYGLIDQVIAERPV----------------------------------
CLPP_RIPO1       DRDYYMSAEEAQAYGLIDKVIEDRTI----------------------------------
CLPP2_PROMP      DRDYFLSAEEAKNYGLIDRVISHPSEAS--------------------------------
CLPP1_GLOVI      DRDFFMSAEDAKQYGLIDQVVQHRPV----------------------------------
CLPP2_GLOVI      ERLFYMSPQEAVSYGLIDKVLEPSANKLAKLKAVGAPV----------------------
CLPP1_CHLMU      DRDMWMSANEAMEFGLLDGILFSFNDL---------------------------------
CLPP1_PARUW      DRDTWMTAQEALEFGLLDKVINSFEEIEST------------------------------
CLPP2_LEPIC      DRDYYMDAEEAIKYGIVDKLATKIDFN---------------------------------
CLPP3_RHIME      DRDYWLGAEEAKAYGLVSRIVTSIAEI---------------------------------
CLPP3_AGRFC      DRDYWLSADDAKDYGLVGKIVESQSEL---------------------------------
CLPP2_GLUOX      DRNYWMSANEAIAYGLVNRIIHSATELK--------------------------------
CLPP2_PSEAE      ERDFWLNAEEAVQYGLVNKIIVSEREITLPGQ----------------------------
CLPP_PARDE       QRDFWLNTQEALDYGLLGKVIRSVDELK--------------------------------
CLPP2_TREPA      NRDYWLDASQALEYGLISNLIEKRADLPKK------------------------------
CLPP2_TREDE      DRDCWLNAKESVEYGLISKIAKNRKDIPEK------------------------------
CLPP2_BORBU      DRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA---------------------------
CLPP_OLTVI       DRDQFLSAREAKDYGIVDQVATS-------------------------------------
CLPP_TUPAK       NRDQFMSAREAKDYGLVDQIASSVSQ----------------------------------
CLPP_OSTTA       DRDKYLSAREAREYGLVDLVATTETATV--------------------------------
CLPP_NEPOL       NRDLFMSPRQARSYGLIDAVALPAVKEEYTGFSMFS------------------------
CLPP_CHLAT       NRDNFMRPRAAKEYGLIDHMITHITELDELEKDASDLRRFGGVDLTKLNKQGS-------
CLPP_PLETE       DRDQFMSAREAKTYGIVDLVAAEK------------------------------------
CLPP_ADICA       ERDVFLSAEEAQDYGVVDLVAVENV--SR-------------------------------
CLPP_HUPLU       ERDVFTSAEEAKVYGVIDPVAVETS--SNSPISKLTKS----------------------
CLPP_CYCTA       ERDVFMSATEAQAYGIVDLVAVENT--EDLL-----------------------------
CLPP_ZYGCR       ERDVFMSAKEAQAYGIVDLVATDDEPSTNTPFDYGRKW----------------------
CLPP_CHAVU       DRDIFMSALEAKSYGIVDLVGEDPTATPSVWFRWPSLLDSKDSNEK--------------
CLPP_CHAGL       ERDVFMSAKEAKEYGIVDLVALDVD--SNS------------------------------
CLPP_PINKO       DRDVFMSATEARAYGIVDTVAEG-------------------------------------
CLPP_ACOGR       ERDVFLSATEAQAHGIVDLVGDENMGDLV-------------------------------
CLPP_AMBTC       ERDVFMSATEAQAHGIVDLIAVENTWDFP-------------------------------
CLPP_CUCSA       ERDVFMSAPEAQAHGIVDLVAV--------------------------------------
CLPP_EPIVI       ERDVFMSAKDAQAYGIVDLVAVE-------------------------------------
CLPP_PHAVU       ERDVFMSAAEAQAHGIVDLVAVE-------------------------------------
CLPP1_ARATH      ERDVFMSATEAQAYGIVDLVAVQ-------------------------------------
CLPP_POPTR       ERDVFMSAAEAQVHGIVDLVAVA-------------------------------------
CLPP_VITVI       ERDVFMSATEAQTHGIVDLVAVQ-------------------------------------
CLPP_CITSI       ERDTFMSATEAQAHGLVDLVAVG-------------------------------------
CLPP_SOLLC       ERDIFMSATEAQAYGIVDFVAVQGKEHGFHADL---------------------------
CLPP_AGRST       ERDVFMSADEAKAYGLVDIVGDEMVDEHCDTDPVWFPEMFKDW-----------------
CLPP_CUSRE       ERDVFLSATEAQSYGIVDVVGVALASKG--------------------------------
CLPP_CUSGR       ERDVFLSPTEAKTYGLVDVVGVTLI-----------------------------------
CLPP_PELHO       ERDTFMSATEARTYGIIDGVYAFEEEYEEWS-----------------------------
CLPP_OENEH       ERNYFMTATEAKYYGIVDDIGIQNLLARLRAESASQDNSLDPDAPDESASQDNSLDPDAP
CLPP_BIGNA       DRDCFLSSREAKNYGIVDYILTN-------------------------------------
                 :             .                                             

CLPP1_RHOBA      ---------
CLPP1_CYAPA      ---------
CLPP_ECOLI       ---------
CLPP_BAUCH       ---------
CLPP_BLOPB       ---------
CLPP_BLOFL       ---------
CLPP_WIGBR       ---------
CLPP_BUCAI       ---------
CLPP_BUCAP       ---------
CLPP_BUCBP       ---------
CLPP2_METCA      ---------
CLPP_NITOC       ---------
CLPP_HAHCH       ---------
CLPP_CHRSD       ---------
CLPP_PSEF5       ---------
CLPP_PSEMY       ---------
CLPP1_PSEAE      ---------
CLPP_PHOPR       ---------
CLPP_SHEAM       ---------
CLPP_IDILO       ---------
CLPP_PSEA6       ---------
CLPP_COLP3       ---------
CLPP_PSET1       ---------
CLPP_HYDCU       ---------
CLPP_ALCBS       ---------
CLPP_SACD2       ---------
CLPP_ACIAD       ---------
CLPP_PSYA2       ---------
CLPP_HISS2       ---------
CLPP_HAEDU       ---------
CLPP_RUTMC       ---------
CLPP_LEGPL       ---------
CLPP_COXBN       ---------
CLPP_XYLFT       ---------
CLPP_MAGSA       ---------
CLPP_AZOBR       ---------
CLPP_RHORT       ---------
CLPP1_GLUOX      ---------
CLPP_NOVAD       ---------
CLPP_SPHAL       ---------
CLPP_ZYMMO       ---------
CLPP_BARBK       ---------
CLPP_BRUSU       ---------
CLPP1_CHESB      ---------
CLPP2_AGRFC      ---------
CLPP_CAUVC       ---------
CLPP_MARMM       ---------
CLPP_RUEPO       ---------
CLPP_DINSH       ---------
CLPP_RHOS5       ---------
CLPP_JANSC       ---------
CLPP_AZOC5       ---------
CLPP1_RHIEC      ---------
CLPP1_BRADU      ---------
CLPP2_CHESB      ---------
CLPP1_RHILO      ---------
CLPP_PELUB       ---------
CLPP_ANAPZ       ---------
CLPP_EHRRG       ---------
CLPP_WOLPM       ---------
CLPP_RICPR       ---------
CLPP_RICBR       ---------
CLPP_NEOSM       ---------
CLPP_RHOFT       ---------
CLPP_METPP       ---------
CLPP_ACISJ       ---------
CLPP_RALSO       ---------
CLPP2_PARXL      ---------
CLPP_AROAE       ---------
CLPP_DECAR       ---------
CLPP_BORA1       ---------
CLPP_METFK       ---------
CLPP_NITEC       ---------
CLPP_NITMU       ---------
CLPP_THIDA       ---------
CLPP1_PARXL      ---------
CLPP_NEIG1       ---------
CLPP_CHRVO       ---------
CLPP_DICNV       ---------
CLPP_FRAP2       ---------
CLPP1_TREDE      ---------
CLPP1_TREPA      ---------
CLPP_BORBP       ---------
CLPP_CAMJJ       ---------
CLPP_WOLSU       ---------
CLPP_NITSB       ---------
CLPP_HELHP       ---------
CLPP_HELAH       ---------
CLPP_CAMHC       ---------
CLPP_SULNB       ---------
CLPP_ARCB4       ---------
CLPP_SULDN       ---------
CLPP_DESPS       ---------
CLPP_CHLTE       ---------
CLPP_AQUAE       ---------
CLPP_CARHZ       ---------
CLPP_DESRM       ---------
CLPP_KORVE       ---------
CLPP_DESVV       ---------
CLPP_DESAG       ---------
CLPP_LAWIP       ---------
CLPP_GEOSL       ---------
CLPP_GEOUR       ---------
CLPP_PELPD       ---------
CLPP_PELCD       ---------
CLPP_SYNAS       ---------
CLPP1_NOSS1      ---------
CLPP1_SYNY3      ---------
CLPP1_PROMA      ---------
CLPP1_PROMP      ---------
CLPP1_SYNP6      ---------
CLPP3_TRIV2      ---------
CLPP2_SYNY3      ---------
CLPP1_THEEB      ---------
CLPP3_PROMT      ---------
CLPP1_PROMM      ---------
CLPP3_PROMP      ---------
CLPP2_SYNE7      ---------
CLPP2_SYNJA      ---------
CLPP_FUSNN       ---------
CLPP2_MYXXA      ---------
CLPP2_MYXXD      ---------
CLPP_ANADE       ---------
CLPP_LEPIN       ---------
CLPP_SYNFM       ---------
CLPP_LACDB       ---------
CLPP_LACP3       ---------
CLPP_LACSS       ---------
CLPP_LACJO       ---------
CLPP_LACPL       ---------
CLPP_LACBA       ---------
CLPP_LACRD       ---------
CLPP_LACS1       ---------
CLPP_STRA3       ---------
CLPP_LACLS       ---------
CLPP1_DESHY      ---------
CLPP1_SYMTH      ---------
CLPP2_SYMTH      ---------
CLPP_BDEBA       ---------
CLPP_SYNWW       ---------
CLPP_MOOTA       ---------
CLPP_ALKMQ       ---------
CLPP_CALS8       ---------
CLPP_HUNT2       ---------
CLPP_CALS4       ---------
CLPP_CLOTE       ---------
CLPP_CLOK5       ---------
CLPP_CLOB1       ---------
CLPP_CLOAB       ---------
CLPP_CLOPS       ---------
CLPP2_DESHY      ---------
CLPP1_BACHD      ---------
CLPP2_BACSK      ---------
CLPP_OCEIH       ---------
CLPP_GEOKA       ---------
CLPP2_BACC1      ---------
CLPP_LISIN       ---------
CLPP_ENTFA       ---------
CLPP_STAS1       ---------
CLPP1_BACSK      ---------
CLPP2_BACLD      ---------
CLPP1_BACC1      ---------
CLPP2_BACHD      ---------
CLPP_THEMA       ---------
CLPP_PSELT       ---------
CLPP2_CHLPN      ---------
CLPP2_PARUW      ---------
CLPP2_RHOBA      ---------
CLPP2_SALRD      ---------
CLPP1_SALRD      ---------
CLPP_THET2       ---------
CLPP_DEIGD       ---------
CLPP_DEHM1       ---------
CLPP2_FRACC      ---------
CLPP3_FRACC      ---------
CLPP2_CORJK      ---------
CLPP1_RHOJR      ---------
CLPP1_THEFY      ---------
CLPP2_TROW8      ---------
CLPP2_LEIXX      ---------
CLPP4_STRAW      ---------
CLPP5_STRAW      ---------
CLPP1_BIFLO      ---------
CLPP1_CUTAK      ---------
CLPP4_RHOJR      ---------
CLPP_RUBXD       ---------
CLPP_BACTN       ---------
CLPP_PORGI       ---------
CLPP1_CORJK      ---------
CLPP2_COREF      ---------
CLPP2_RHOJR      ---------
CLPP2_MYCPA      ---------
CLPP1_FRACC      ---------
CLPP4_FRACC      ---------
CLPP2_CUTAK      ---------
CLPP3_STRCO      ---------
CLPP1_STRAW      ---------
CLPP3_RHOJR      ---------
CLPP2_THEFY      ---------
CLPP1_TROW8      ---------
CLPP1_LEIXX      ---------
CLPP2_BIFLO      ---------
CLPP3_STRAW      ---------
CLPP3_NOSS1      ---------
CLPP2_THEEB      ---------
CLPP1_SYNJA      ---------
CLPP2_SYNP6      ---------
CLPP_RIPO1       ---------
CLPP2_PROMP      ---------
CLPP1_GLOVI      ---------
CLPP2_GLOVI      ---------
CLPP1_CHLMU      ---------
CLPP1_PARUW      ---------
CLPP2_LEPIC      ---------
CLPP3_RHIME      ---------
CLPP3_AGRFC      ---------
CLPP2_GLUOX      ---------
CLPP2_PSEAE      ---------
CLPP_PARDE       ---------
CLPP2_TREPA      ---------
CLPP2_TREDE      ---------
CLPP2_BORBU      ---------
CLPP_OLTVI       ---------
CLPP_TUPAK       ---------
CLPP_OSTTA       ---------
CLPP_NEPOL       ---------
CLPP_CHLAT       ---------
CLPP_PLETE       ---------
CLPP_ADICA       ---------
CLPP_HUPLU       ---------
CLPP_CYCTA       ---------
CLPP_ZYGCR       ---------
CLPP_CHAVU       ---------
CLPP_CHAGL       ---------
CLPP_PINKO       ---------
CLPP_ACOGR       ---------
CLPP_AMBTC       ---------
CLPP_CUCSA       ---------
CLPP_EPIVI       ---------
CLPP_PHAVU       ---------
CLPP1_ARATH      ---------
CLPP_POPTR       ---------
CLPP_VITVI       ---------
CLPP_CITSI       ---------
CLPP_SOLLC       ---------
CLPP_AGRST       ---------
CLPP_CUSRE       ---------
CLPP_CUSGR       ---------
CLPP_PELHO       ---------
CLPP_OENEH       DETRPPKLR
CLPP_BIGNA       ---------