CLUSTAL format seed alignment for MF_00445

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NQO14_PARDE      ------------------------------MTSLDFSTILPEVVLAGYALAALMAGAYLG
NUON_JANSC       ------------------------------MISADLAILTPEIVLSLFAMAGLLGAVYTS
NUON_AZOC5       ----------------------------MSSLLPPLGAVLPELLLALSAVVLVLIGAIQG
NUON_BEII9       ----------------------------MTPLPVVLAHALPELILAGGVLLLILIGAIRG
NUON_METNO       -------------------------MNAAEIVMPALGPALPELILTVGALVLILYGALRG
NUON_PARL1       -------------------------MENAISTVPEFLPALPEILLAVGAMALLMYGVFRK
NUON_MAGSA       -----------------------------MIKTLDLVPVLPEIFMAVAGLALLMLGVFRK
NUON_RHORT       ----------------------------MTFQSLILGPALPEILLAVLGLVLLMVGVFRK
NUON_RHOCS       -----------------------------MVAIPDFLPALPEMFLACAAMALLMLGVFRG
NUON_BARBK       -------------------------MLMQTEIIAQLVLILPEILIALGIMALLLIGVYSG
NUON_RHIEC       --------------------------MTAETILLSLHLSAPELILAVGALVLLMVGVFSG
NUON_GLUDA       ---------------------------------MNWTLALPEIVLALCGLAILVFGVVQK
NUON_GRABC       ---------------------------------MNWTLASPEIVLALCGLVILLVGVARN
NUON1_ACICJ      --------------------------------MSTFYTVLPILFLAIAGMIMLMSGVFTD
NUON_SPHWW       -----------------------------MSMTASLALTVPELILSVGALLLLLVAAFGG
NUON_SPHAL       -------------------------------MTADLALIWPELILTIGGLITLMLGTFMG
NUON_ERYLH       -----------------------------MELNASLTLILPEIVMAISAMALILITAYVG
NUON_CAUSK       -----------------------------MTFAANFSLVLPEVILGVSALVLLVWGAFQR
NUON_MARMM       --------------------------MTADMLSHDLSLLIPELVLAGGAMALLMLGVFLK
NUON_HIRBI       -----------------------------MDILNDISIAAPEALLIGVALIGVLLGATFK
NUON_HYPNA       ----------------------------MLDTQSIIQAMAPELWLAASGLMLVLVGAIVG
NUON_PELUB       --------------------------------MDNLNFILPEIFISLSIMFLLLLGVYKK
NUON_MAGMM       --------------------------MAIQMPDINLALMLPEIVISVVAMGLLLASAWWE
NUON_AZOSB       ----------------------------MNFVVPDFYPATAEIFVAVMALVIMLATTFAR
NUON_DECAR       --------------------------MFDNFVVPNLLPAAPEIFLATMALAILMIDLLVK
NUON_NITEU       ----------------------------MDFLLPDFTPAYPEIFLLLMVCVVMLADLFAG
NUON_THIDA       --------------------------MNMPLSLMQFAPALPEIFVLAMVSLILVIDAAVG
NUON_METGS       ----------------------------MNAIQSDLYAALPEIIILCMAMFVLLLDLFLK
NUON2_NITOC      ----------------------------MNFDIPEFLPALPEIAVLGMGCVLLLAVAYGG
NUON_THISH       ----------------------------MTFEIPDFMPVIPELFVLGMACAILVIDLFVP
NUON_ACIF2       ----------------------------MNSFLMHWTYAIPEIWVLTMACVVLLADLFWG
NUON_ALKEH       -----------------------MTVETPDFVMPDFSLALPEIWMLVMACVVLVVDLYSQ
NUON_HALHL       ----------------------------MSFETPDFSLALPEIWLLAATCGVLVVDLFSS
NUON_LARHH       ----------------------------MSWADLNLMPALPEIVLLIAVSAILIIDLFVK
NUON_NEIG1       ----------------------------MNWSDLNLMPALPEVALLSLLVLLLPADLWAS
NUON_HERAR       ------------------------------MNNLNLIPVIPEIFLAAATCAILLIDLFLS
NUON_POLNA       -----------------------------MIDKLSWIAVYPELVLLVMACLIALVDLGVK
NUON_BORA1       ----------------------------MMQSHIDFALATPEILLLVLALAVLLIDAVSS
NUON_PARP8       ------------------------------MQNAPMTALLPDALVMAAIVVAWLIDTFVG
NUON_CUPTR       -----------------------------MQPSSTLAPVAPIIFLAIAIAAINWIDLARG
NUON_POLNS       ------------------------------MQAFDLYAILPELVLLIATCLLLVASVYVP
NUON_RUTMC       ------------------------MNNFIEFDTSSLWIALPEIFLLSAIVIVLLIDLFLD
NUON_HYDCU       ----------------------------MNFVIPSFIPAIPEIVLLTLTSLLLIADTIWS
NUON_COXBU       ----------------------------MPSELPNFIPAVPEMFVLFMALVILLAGVFIK
NUON_LEGPL       ----------------------------MMTLLENIHVAIPEMIILITACLALLSDLFFR
NUON_XANC5       ---------------------MMTTPTLAPLTTADLAPLVPELVLIGGAFALLMLDLFVS
NUON_FRATF       -----------------------------MIMSLSILYILPEILLALGVIVVMFSGLFLH
NUON_EHRCJ       ------------------------------MYWNNFVYIIPEVFLVSSSLILLLLGIVLN
NUON_WOLTR       ---------------------------------MSYIQILPETFSIISSLVLLLLGIVFN
NUON_ANAPZ       ------------------------------MYLSDFLYIVPEITVLGSALALLVLGMFTS
NUON_ANAMF       ------------------------------MCWRELLYMLPELYLLGSAMIALLLGIVVD
NU2C_NOSP7       -----------------MDFANIAS-------QLNAGTILPEGIVILTLLGVLIVDLILG
NU2C_SYNJB       -----------------MDVFAPTG-------NLYAGAIWPEVVVTLTLLLVLVVDLVGG
NU2C_GLOVI       -------------------MNIDLA-------ALNAGTLWPEYIVTITLIVVLLVDLISG
NU2C_PROMA       ---------MPDMGTPLLTIQGMASPGELLNLSLNAKAILPEGFVLLALIGTLLVDLAGE
NU2C1_ARATH      MIWHVQNENFILDSTRIFMKAFHLL-------LFDGSFIFPECILIFGLILLLMIDLTSD
NU2C1_COFAR      MIWHVQNENFILDSTRIFMKAFHLL-------LFDGSLIFPECILIFGLILLLMIDSSSD
NU2C_ADICA       -----------MNDINLFLAKLTYT-------SAKLT-ILPEIILILGLVAVVVIDLLSK
NU2C_CHAGL       -----------------MEIQNNLY-------GIDLYTILPESILIFCLLTTLIIDLSLD
NU2C_CHAVU       -----------------MYFQHQFS-------SLNLNSFLPEGILIFNIIFILILDLVSQ
NU2C_STAPU       -----------------METNQLFS-------LDNLITILPECVLIICLLTILMIDVI--
NU2C_CHLAT       -----------------MEFKDLIS-------SLNLIRLLPEGIVTILLVFILLIDLTFQ
NU2C_NEPOL       -----------------MELSDILA-------SFHASNLIPEGIVACTILLVLLLDLVYS
NUON_ANADF       ---------------------MESFLPLVDENLRSALWFRPEMALTFGTLVLFVLDLV--
NUON2_SORC5      ------------------------MEPRTLDNVASLAYFAPELVLIAAALLLVVWDLASP
NUON_CHLCH       ---------------MFELPSGAEIQSIIATLKASVGFFIPEIYLSLLFMILIVVDLV--
NUON2_CHLT3      ---------------MFQVPSAGEIQELIGALKTGASAFVPEIFLSGLFLLVVTIDLF--
NUON_CARHZ       -----------------------------MSVNINYLLLIPEILVLSLGILLFVLALITP
NUON_DESRM       -------------------------------MEFNFALITTELALFILGLATFVLGLLVP
NUON_DESHD       ------------------------------MMSFELSLLSTEIIMAVLGLGLFAVGLILP
NUON_HELMI       ---------------------------------MNFSLLTTEMLTALLGIGLLAIGLLNR
NUON_CLOB8       ------------------------------------MSYIVELLTAALCLVLLIASLSLQ
NUON_MOOTA       --------------------------------MANLHLLTVEILTAALGLGLLALGLLVP
NUON2_SYMTH      ---------------------MPGVVSWSQLVNPSYVAILPHLIVTATLLVVIVLDAYFK
NUON_DEHMB       -----------------------------------MDLFMPEIIILITALLVIITDLFLT
NUON_METI4       --------------------------------MNAFFVFCTPECFLSLSALVLLLWQALA
NUON1_OPITP      ---------------------MNLEAVKHAASLNEWSGLIPEIALGCLALLLLVVEMVLP
NUON_RUBXD       ----------------------------MPVSGEAFLGLLPELVATGFLLVVLLGGVFAG
NUON_RHOP5       ------------------------------MTAAQLFALSPLAALAIGAVIAMLLAPVTK
NUON_RHOS5       --------------------------------MPSFAALLPVILLGAGAVTAMLAAP--R
NQO14_THET8      ------------------------------------MTLAILAVFSVALTLLGFVLP---
NUON1_STRGG      ------------------------MGMSVNSDPAALVPEITLLVSAVTGLLAGAWTPRER
NUON_MYCSJ       ------------------------MNPEEAMRPLLMASEMMMFGAGLVALIAGSFLRRQR
NUON_DEIRA       -----------------------MNLVLPDVSLAPMLPVLLVLVGAIVSTLGGFWLPRRT
NUON_GEOMG       ------------------------------MTITELWALIPLLILACGSVFVLMLGAI--
NUON_GEOUR       ------------------------------MTVADIWIIMPLAILAGASLLILLLGAV--
NUON_GEOBB       ------------------------------MIIPDLHTIMPIIITGVGALVVLLCGPL--
NUON_PELCD       ------------------------------MTWNMLLALLPLLVLFGGSITVLFLSE---
NUON1_DESMR      -------------------------------MSAFVVAYFPHLCLAFGGLLVLCLSMARS
NUON_PARUW       --------------------------MNPTLTLTDFISIGPLLIVLMTALIIILIESFSE
NUON1_SYMTH      -----------------------------MPVDLNFTIAAPLLALAAGALLILLLDLLFR
NUON_CHLSY       --------------------------MFQLTDIPRLLPEILLLVLALLVLGSDILERWGR
NUON1_ROSCS      -------------------------MSFQITDIPRILPELMLLLLGLLVLGSDVLTRWGR
NUON2_HERA2      -------------------------MNFQIADFTRLIPEFLLLAIAAMVLLGDVLTRWSK
NUON2_ACIC5      ------------------------MNPVSYSELLRLTLPQIALTVAAFFVLACDGMLLRR
NUON1_KORVE      -----------------------MTSLPNLLSRSDYLLALPMLVLSGFAVAILLLDLVLP
NUON2_SOLUE      -----------------------MIDFSLFYNSTDHFSIIPAVMLALFGCAILLFDFLIF
NUON2_RHIME      -----------------------MTAAALLQWA---LASVPEIIVVTGACVLLIVGELVR
NUON_THERP       --------------------------MSVRLAVPDWSLLVPPLIIVGTIVLLLIVDAVLR
NUON_DESDA       ------------------MTDTVIAPLSALPLLADLPALAPELVLLVTAVCLMLGDLFYP
NUON2_KORVE      -----------------------MSNFQFAIPTIDYIRILPEIVLAVFGIVVMMADALIP
NUON1_ACIC5      -------------------------MIQGMTDTYPLLRILPEIIFTITGVVVMVLEPLFP
NUON1_SOLUE      ------------------------MPVSPAFNPQDALRFLPEIILTVMGTLLMVLDPVIH
NUON_ANAD2       ---------------------------MSGFPTQDFVALVPVAILTMGALVLLMTEVFLT
NUON_MYXXD       -------------------------MNLPNLSLADFLPLLPAIIMVVGASILLLSEVFLS
NUON1_SORC5      ------------------------------MILGPYIAVSPLIVISLGGALLMLAEAFSH
NUON_CHLAD       -------------------------MDSLTIPPVDLRLLAPLLVVVTWATVLLLVDVFFI
NUON2_ROSCS      -------------------MWNDTQMTEIVIPPVDWRVATQLSIIFGWASVLLVI-ALFV
NUON1_HERA2      -----------------------MNDLTFITPEINWTVLGMPAFLMIWAMLVLIVDMFTS
NUON1_CHLT3      ---------------------------------MLEDFLKVMPLMTASGISILLILVEAA
NUON_GEOLS       ----------------------MDINVAQLFQTINLNVIMPEVILSVLGMALLLVNVFVP
NUON_SALRD       ------------------------MDLSTAFPTLVTDLPAAFSMSVVGGVGLAMIVLDAF
NUON_GEMAT       -------------------------MPDAMSAGAILRALLPEMLLSGGAMLLLLASVWTP
NUON_BDEBA       --------------------------MNINIGLSDVLLISPMIALFLASLLPITMKVLRG
NUON_ACIC1       -----------------MSFYAAANPNAIPAPHIEYRALLPMLIVFGVACAGVLVEAFVP
NUON_RHOOB       ---------------MSTSEFVLAQSATVPAPDIEYGQLSPMLIVFGVAVAGVLVEAFLP
NUON_FRASN       -------------MSAATTVLAQGAAQKITPPSIEYSSLSPMLILFGVALAGVLVDAFAP
NUON_MYCA9       ----------------------MTDIGILPAPAIAYGALSPMLIMFGVAVVSVLVEAFVP
NUON_BEUC1       --------------------------MNFVQPVIQWASLAPILIVLGAAVLGVLIEAFAP
NUON3_STRGG      ----MSATAVHSLWTTASGVTSAAPGNSFTAPKIEYTQLMPVLIIVVAAVLGILVEAFVP
NUON_SACEN       -------------------------MSQVELPLIDYAAITPILVILGAACLGVLVEAFLP
NUON_SALAI       -------------------------MSELKLPSIDYVALAPTLILLGAALVGVLVEAFVP
NUON_NOCSJ       --------------------------MDFIKPTIEYGDVWPLLVVFGVAAVGVLVEGFVP
NUON_THEFY       -------------MIPLSLSETTLPTVTTQAPDLDYWLLSPLLVVFAAGVIGVIVEAFVP
NUON_CUTAK       -----------MNPALLITASGLPALLDVAAPHLEWGPLAPVFVLMAGACVAVLVEAFVP
NUON_ANOFW       -------------------------MDFETLLSYEWGVMMPEFIILGVAVALSLIDLFMP
NUON_GEOSW       -------------------------MSMHTLLQYKWEMMTPEFIVLGTALILSLMDLFMP
NUON_GEOKA       ---------------------------MNDVWQSDWSMMAPEWIVLAAAIALLVMDLALP
NUON_BACAN       -------------------------MDMNTLLSLSWHLMVPEFIILGAAILLSICDLFF-
NUON_BREBN       -------------------------MEVKDIFSYDWSYLLPEFIILGFATFLSLLDLFAG
NUON_PAESJ       ------------------------MTEFVPLTWHDTLYLAPELILAAMFLILIVTDLILP
NUON_DESPS       -----------------------------------MMLFLPELALLITALVFFILTLKAP
NUON2_OPITP      --------------------------------MTSFVSFLPELVLLAGALALFVVTLGQN
NUON1_SYNFM      --------------------------------MMKWVLFIPELYYLLMAVVFFACSLSRR
NUON2_SYNFM      ---------------------------------MNWMSFAPELITLTSALWFLLLSMTAR
NUON2_DESMR      ---------------------------------MSIFSLLPELWLLGLVCALFVASISDK
NUON_BACFR       ------------------------------MDYSQFLYMKEELSLIAVILILFVVDLLTC
NUON_BACV8       ------------------------------MDITAILHMHAELSLTAVFILMFLLDLFLP
NUON_AZOPC       ------------------------------MDFSNFLCIEQELKLIALLVILFLYDTFCS
NUON1_THEYD      --------------------------MNISQIPLQVEALIPEITLTGFASLILLAGLLKL
NUON2_THEYD      --------------------------------MIQYKVLIPEISLLILAIISFFYGFISR
NUON_FLAJ1       --------------------------------------MNTLIAITGLGIFCLLFEILNF
NUON_FLAPJ       --------------------------------------MNTLIYISALGILSLLAEIFNA
NUON_CYTH3       --------------------------------------MNAIILISVLGILSMMSEFIGL
NUON_LEPBA       --------------------------MSYTPSSNDLIAISPMLILCGVALLSLVVQFLIP
NUON_LEPIN       -------MNLFDLSILPFLNLAQVVNESRVPNVPDLLSVLPALVLATGGVFLICLSVLFK
NUON1_AQUAE      ---------------------------------MNWNAILPEAILAIGILTVFILELFLE
NUON2_HYDS0      -----------------------------------MKALYPDIITTVGIIFLIILELFLP
NUON2_AQUAE      ---------------------MDLRALIGVIEIPDLKKFLPEFILLLLAFILFTLELFIK
NUON1_HYDS0      ---------------------MDIRLLLGSTNLYEFKYLLPEITVFIGAFVLFLLDIVMK
NUON_PERMH       --------------------MSILQQLVSGIGVPNFGVILPEIIILITAFILLVVELLIR
NUON_CAMC1       ----------------------MNEIAFLDLNEISLQSLSPMLSMMVFALFILIVGAIKK
NUON_CAMHC       ------------------------MKNLIDFGILNLSSIAPMMVLSLFAVFILVLNFINK
NUON_SULDN       ----------------------MLSPVNVSIESLNLMTLVPMLIPIIGALFIIVIDLFKS
NUON_WOLSU       ----------------------MLEVVNIPLESLNLSTILPMAVVIAGALVILGIDLFTK
NUON_SULNB       ----------------------MLQPINVSMESLNLITLAPMLVAIAGGLIILILDLINK
NUON_HELAH       ---------------------MLIDSLHISFDSFNFESILPMLVLVCGGIFTLLINAFTS
NUON_HELHP       ----------------------MPESMSFSLNQLNLQLLIPMCISLFGGIILLGVGVFNK
NUON_CAMJR       -----------------------MLNNFLNLELLNISLSYPFLFLITTAIVLLLCSGFWK
NUON_CAMLR       -------------------------MSGFSLEKFNFVLLFPVLSLLFWAIVLLLLDAFKK
NUON_BUCAI       ----------------------------MIINLQQLTALLPLLIIMLTVITVILSISYNR
NUON_BUCAP       ----------------------------MIINLQELIALLPFLILLLTVVIVILSISYNR
NUON_BUCBP       ----------------------------MIITGQQLVALSPLLILMSIAIVVMLFIAYNR
NUON_BUCCC       ----------------------------MIRLFNDIIPIFPILMLIFSIIILFFILNNKN
NUON1_NITOC      ------------------------------MSSLDFTALLPLILITLASLTLTLIVAGYR
NUON_NITMU       -------------------MNPMPSALPSDFLHVDLVTLSPLILLAAAAVVVMLTAAFYR
NUON2_ACICJ      -------------------------MTAPAFTAKAFAAFAPFTLLGAVTILVMLLIAVRR
NUON_METCA       ------------------------------MTTDALTALLPFIVLSAAAVAVMLAIAIRR
NUON_PSYA2       ------------------------MNDFTMNDLMGLLPYAPIIAVVITVLVVMIAITMKR
NUON_ACIB5       -------------------------MNFTVS-FSTLMPLAPVMIVALTAVVVMLLISIKR
NUON_AERHH       ----------------------------MTFTASQLLALLPLLLTTGAMVALMLAIAWKR
NUON_TOLAT       ----------------------------MSFNSVLFIAELPLLLTALTAIAVMLSIAWQR
NUON_CHRSD       --------------------------------MTSLLALSPLILVCATAIVVMLTIAWRR
NUON_PSEMY       -----------------------MEHHAVEFTAQHLIALLPLLVTCMSAIVVMLAIAARR
NUON_HAMD5       ----------------------MITSSQSALSGEMLMAMLPILIVAGTVVLLMLSIAWRR
NUON_ECOLI       ----------------------------MTITPQNLIALLPLLIVGLTVVVVMLSIAWRR
NUON_PROMH       ----------------------------MTITPEQLIAMLPLLVVILTVVVVMLSIAWRR
NUON_BLOFL       ----------------------------MIIFREQLIALLPIIVIGITIVGIMLSIIYSR
NUON_BLOPB       ----------------------------MLITWTHIILLLPILIIGMTTVIVMLSIAYRR
NUON_BAUCH       --------------------------------MKIITQILPLLIIGFTIILILLSIAWQR
NUON_SHEWM       ----------------------------------MSLHYLPAIIISIAILVLLLVIALKR
NUON_RICBR       -------------------------------------MLLPEITLTLTALLSQFFAVMLQ
NUON_ORITI       --------------------------------MEMLYGIMPEISLLLSALIFQLIGAYSN
NUON_ARCB4       --------------------------------MSQFLYLVPTLTILVGALVLMFMSMYDK
NUON_PELPD       ------------------------------MATDLLYGLLPEHILLGLILVLMLLEILSV
NUON_NEORI       --------------------------------MNQYLFLLPEITLFILSCLLLFLKSRNE
NUON_DESAP       ----------------------------MTAHLPILIVIIPLFVAMAARLLVRLSVPFTR
NUON_CAMFF       -----------------------------------MIALLPFILSLAATFINIFLCVTNI
NUON_SALTO       ---------------------------MSMVQTVDNVALLPAYLAAGTAVLVLLADLLVA
                                                                             

NQO14_PARDE      KDR-------------LARTLLWVTVAAFLVVAAMVGLGN----------------HVDG
NUON_JANSC       KDA-------------LASAMCWGTAALFIIMAFYIGVTG----------------NGAR
NUON_AZOC5       EKS-------------ANLVNGLAIAALVAAGVLVMLQP-----------------AVTI
NUON_BEII9       KDS-------------DGPMTELAVGLLGIAILTLVLGT-----------------KTQA
NUON_METNO       ERS-------------TEGVTVGAIIVLIVALFSVVSQPL----------------GAKI
NUON_PARL1       DCD-------------ARETSLGALALFALVGAFLIIEP-----------------NAYV
NUON_MAGSA       EDS-------------TKSVSVLVILALGAAMVLVSSLGGE---------------R--L
NUON_RHORT       TDS-------------TGLVGLLAVYGLLMALAVVGLGAAP---------------ETPQ
NUON_RHOCS       ADS-------------TRLVSWLAVGAALVAGVLVLAASGD---------------R--A
NUON_BARBK       AHS-------------YLTVTGLTIALLFATIILIVLFP------------------KDG
NUON_RHIEC       ERS-------------GLVVTGLAIVLLLASGLWLLFVP------------------AEG
NUON_GLUDA       KEQP------------FLSCSMLTIGAFVLTGFLVVMSPD-------------------G
NUON_GRABC       RRED------------TFLCAMLTLGAFLVTGLLTVSGAL-------------------G
NUON1_ACICJ      RDH-------------SFAITAASIVVLAIAARLLVAAPG-------------------G
NUON_SPHWW       DGF-------------ARAIGWGAVALFAAAGFSLTGPAGNG------------GPG---
NUON_SPHAL       DRQ-------------VGTYQLSALLTLAAAAAAAIALFGVE------------TTV---
NUON_ERYLH       DKT-------------ARLVSILAAATLGAAAVMVAPALTSG------------ASGPDT
NUON_CAUSK       K--T------------SPLFTGAAVLALLGAAVAAV--VGP-----------------HG
NUON_MARMM       GDGT------------EKLVQWLTVGLLAAAALAALFLVSG-----------------EG
NUON_HIRBI       QSFN------------GLSRLLGALALAGAAFLAASQSAVD-----------------AS
NUON_HYPNA       ERFN------------SLSYKVGALVMFGAAALSAMHLQ-------------------GG
NUON_PELUB       NSS--------------NIVHNLAVGSLLITGILIFNNPLD----------------QNI
NUON_MAGMM       GAEG------------ARRIRRIAAGALMVAMVITLLGVGA----------------TQS
NUON_AZOSB       S-------------VARGLAYGLTLVTLIGAAIITYNTANP--------------RAV--
NUON_DECAR       D-------------SRRTVTFVLTQLTLIGCAAIQFATSTG--------------EIT--
NUON_NITEU       E-------------RNRYLAFYLSLLTLAGCALVTCGIYST--------------EVR--
NUON_THIDA       D-------------GKRYLAYGLSLVTLAGAAFLTVRDFST--------------LPV--
NUON_METGS       S-------------HNRSLIYIFTQLGLAAAAVVTACTHNV--------------SVVS-
NUON2_NITOC      G-------------QSGKIAYWITQLTLVIAALLTFYFLDY--------------SSQS-
NUON_THISH       Q-------------SRRDITYGLSQFTLIGAAILTIALASP--------------ETR--
NUON_ACIF2       D-------------GLRDLAAVLTVLTLSGAAVLTVFEMGQ--------------SGT--
NUON_ALKEH       D-------------SRRGMTFMLTQFTLVVAGVLAIVAHWG--------------EPA--
NUON_HALHL       D-------------PRRSATFYLTQGALLVTAVLALSTQWG--------------VNE--
NUON_LARHH       G-------------ERRGVTYLLSMLALVATGAATLAAWLP--------------YPV--
NUON_NEIG1       D-------------DKCRWTHYGALATVAVTAAVQLAVWEQ--------------GST--
NUON_HERAR       D-------------AKRYLTYVLSLATLVVCAVLSLSDFNA--------------GATS-
NUON_POLNA       S-------------PRRTLTYALTLLTLGAVAVMEASYALG--------------GQTF-
NUON_BORA1       H-------------PDRKTTYVLSLATLAILTVVSLFQWSN--------------GVSG-
NUON_PARP8       P-------------NSRRTTYFIALLSTVVAGIWFAIDALTP------------GAGPQ-
NUON_CUPTR       K-------------GKQSVAYPLSLLTTLVLTAWFGMNAAT--------------GETH-
NUON_POLNS       ERVTPTLGVEQDVFHTPRGVGFVYFFTIIMLVYLVFAFVGRM------------GDPAL-
NUON_RUTMC       K-------------NFKQVTYYLIQLSLFITGLLAFNLIDH---------------PQI-
NUON_HYDCU       K-------------RSEFATYYATQLILLVVGYLVLTSFST---------------SQV-
NUON_COXBU       --------------KRHQIPYYLTQITLILVAGLTWYIFTYS------------DFAETS
NUON_LEGPL       H-------------KLKSIAFYISCVGIIVSAAVSFVFIGSY------------KL----
NUON_XANC5       Q-------------RNKVWTHLFSVAVLAVVLVLLATGTGG---------------QGD-
NUON_FRATF       G-------------KIRNINYIFFQVFTLLALIATFAKEYL--------------IQTTG
NUON_EHRCJ       K----------------KVIHVLSLISLLVTVGIVG----IN------------LEIEPQ
NUON_WOLTR       R----------------RTINLLALGCTVITLIILI----LS------------AKDSGF
NUON_ANAPZ       E----------------RRVRSMSLISVAIAAVLAC-KELIY------------FSGEEV
NUON_ANAMF       A----------------RWVHRLSAVSMGVVVVLSWWSGVTD------------HVAEDV
NU2C_NOSP7       RTSARW-------IGYLAIAGLFTSIVALYFQWDN----------------------PNP
NU2C_SYNJB       SAARKS-------LPALSIFGLIGALVTLVLQWQQ----------------------PQL
NU2C_GLOVI       RKASWS-------LPYLALLGLGIATATLLPMWIL----------------------ENP
NU2C_PROMA       EISKRW-------SPPICYAGLGSALIILGFGWNQ----------------------SPE
NU2C1_ARATH      QKDIPW-------LYFISSTSFVMSITALLFRWRE----------------------EPM
NU2C1_COFAR      QKDIPW-------LYFIPSTSLVMSITALLFRWRE----------------------EPM
NU2C_ADICA       GKNTFL-------LYKISMVTLLASAVILLWQWG-------------------------F
NU2C_CHAGL       SKNKSW-------IIYLNTIGLILSGLFLCLQW-----N-----------------GIIP
NU2C_CHAVU       KENKSM-------LVKISFIGLLLSMLTLIQQW-----Y-----------------HEST
NU2C_STAPU       TKKSVW-------LSNIALLGLLTSTFILLFQLT---NN-----------------EVGF
NU2C_CHLAT       KRVLSW-------LLYIPLVGLVCSMVVLLRQWG----------------------SQDT
NU2C_NEPOL       RTCHAW-------LAWVAMAGLSLASVLLGQQWYQLMNL-----------------PTAT
NUON_ANADF       FRRSQA-------RVALLTAGALAVLAAAAGLLAIQPPD-------------------AQ
NUON2_SORC5      ARLKLA-------GLVILSLAALACSGGLGAYFLATDAA-------------------PR
NUON_CHLCH       -VKGRK-------STLLSVFSLVGLAGSLYFIYQQHAMQ-------------------AG
NUON2_CHLT3      -RIPSK-------RTIIPAVSVIGLIISGYFVYLQHAIP-------------------PD
NUON_CARHZ       R-NLQK-------G-IGYLTTIGLLGIFLYMP--IAWKH-------------------TG
NUON_DESRM       S-HSRR-------G-LGSFALLGLLLVLGITI--INWSN-------------------QG
NUON_DESHD       R-GSRQ-------G-MFPLTLFALLGTLAYAVYDFFYGG-------------------NA
NUON_HELMI       KKDSHR-------G-VAYAAVFGLLGILVVTF--FQYGI-------------------NT
NUON_CLOB8       RYKEKL-------SLFTGICLFIILIVSLFSEALLNGSQ-------------------SQ
NUON_MOOTA       HSDRR------------GIAYVATAGLAGILAAAFGMRE-------------------AS
NUON2_SYMTH      E-KRSL-------VWVTLGGVVLAMLSIWYTASDPQIQAGIA-------------AGRPP
NUON_DEHMB       KSKRHL-------AYLSLLGLGAAAVATVLNWDSP-----------------------PE
NUON_METI4       KI-HDK-------SIGILVLADYLVAGVLLLPFVE---N-------------------QG
NUON1_OPITP      KKRHDL-------IATIAIIGQFGILGWVAWDFHSPFLG-------------------RN
NUON_RUBXD       PRSEAL-------VAALAGLGTLASFAAAAGLLAAGF---------------------SG
NUON_RHOP5       SAAAARIAAATGLAVAA-----LLEILRAGVPPAPIGALFT-------------------
NUON_RHOS5       LPGLARWIAGFALVAAS-----VALALRLGAPDG-LSVLLA-------------------
NQO14_THET8      -PQGVKRATLLGLALAL-----ASLLLTWGKPFA--FGPYA-------------------
NUON1_STRGG      QGTIHVLAALATVVGLV-----ATALAARQPDETVF-GTYV-------------------
NUON_MYCSJ       QWWVGVMAAAAQVGVIG-----VAVVQMVGPDQMAFEGAFS-------------------
NUON_DEIRA       LTALNILFVLASGASLVWLWGGAPWAAGMDVPRSAFAGALR-------------------
NUON_GEOMG       VPGRCGTVIGVAVCAGT----ALWAMLAPPQPLAPPTLGVT-------------------
NUON_GEOUR       VPGRYGTAVGVAACVGA----ALWALQLQPAALSQ-TLGVA-------------------
NUON_GEOBB       LLSGTTSSIAAVTAAAA----GLWAIFTAPSAVPA-VAGLT-------------------
NUON_PELCD       RRALLSAAMCAVVAAGF----AWWPASLEAAGTPL----VA-------------------
NUON1_DESMR      VPAGFYPATAALFAALP----GLWAVAGPQG-----------------------------
NUON_PARUW       NCSKKWSSLISIGGLTLSI--FAVWGGISSNHSSLLNPWIH-------------------
NUON1_SYMTH      YETIQGPMYVAAVGAVLVA--GWYLVPLWRGAAEPFG-FHG-------------------
NUON_CHLSY       TPEAQLERVKSSASLTAIGLGMVLVVALLQSGYLYQLPETA--PVNFFTNIIRNLQSGGP
NUON1_ROSCS      GPAAQLERAREAGQLTAVGLGLVFIVGLVQSRFLFTVPDPAGGPLDVLLTLGRNLQTGGP
NUON2_HERA2      GKEALNDRTEEAISMTLMGLGLAFVMVLIQGGFFSWMQFGDWKFYDF--SIFQNLRSSGL
NUON2_ACIC5      SPIAVRARIAMLLSVAGSLVALALLPLTAPVQLLDGMLVLD-------------------
NUON1_KORVE      KGWKR-------WNAALALAGLAAATMSLAKVWQAVYYIETP-------------ESKRF
NUON2_SOLUE      PDPRQ-------RKFLLIFVVLAEAFTGFGLFRQQAW-LAAQ-------------NAPEL
NUON2_RHIME      KG----------RDDLLLWASVAIVLLAAVATLMLAGEMRPA------------------
NUON_THERP       RP----------PARLLLTLAFAGQVLALASLWTIDWAQGAT-------------T----
NUON_DESDA       RE-----------RVFQQWLTAAGAAVALALTLSMNFSGGAT-------------A----
NUON2_KORVE      QNNSK---------KPLGYLSLIGVLVSLGAIACQARYPGMY-------------DVNNG
NUON1_ACIC5      KHASR---------KPLGWLTVLGALLALAASFYQ------Y-------------GLPIG
NUON1_SOLUE      KRSS----------NAFGHISLIALVMALGASIYA------Y-------------GIA-G
NUON_ANAD2       S----------GRRAYQAYLTMVFAAAAAGYA--AWMPVPG-------------------
NUON_MYXXD       TT---------ASRAYQAVLTVVTAVAAGAMALTTMFEPPQ-------------------
NUON1_SORC5      RREES-HDRRSGPSSDMALGTAITLLAGAVFSGAVGFVGPET-------------LEG-F
NUON_CHLAD       PDG---------RKKLTGYLAIGGLVVAGLVGLPLWGVTGT-------------------
NUON2_ROSCS      PRS---------RTRIVGYLAMVGAMVAAAVGIPLWGVNAE-------------------
NUON1_HERA2      DR------------RVLLTLSLIGLGVTAALGALDYGSTIS-------------------
NUON1_CHLT3      TKNAR----------ITRLFAILGF-LLVFLSLPFSPSEPD-------------------
NUON_GEOLS       SKSKG----------YLAWLSLIGI-VGAGFAAVTGWGTTV-------------------
NUON_SALRD       RNDHP----------AIPWLGVAALGVSAVWEITHLGAPPS-------------------
NUON_GEMAT       QGNQPGAAEGAERTSVLARFGVILCLVVGLAVVIAWGDGAA-------------------
NUON_BDEBA       NREQ---------HALITLGQALMGIVAAVVLLVVFGGSDK-------------------
NUON_ACIC1       RAQRA------LTQTVLALGGLVAALIAVVSNTGL--------------------PRKLV
NUON_RHOOB       RRGRY------SSHLVLALGGLTAAFVAVVLLAG---------------------TRDSV
NUON_FRASN       PKARR------VLQPLLAGAGFIGAFVAVVLLHA---------------------HRQVL
NUON_MYCA9       RGHRL------RTQLALATVGILGAFVAVVALSG---------------------SHQVV
NUON_BEUC1       RRVRR------PVQVTLALLAAAGAFGAIAWRWAEVIGGGGG-------------APSTV
NUON3_STRGG      RRARY------HTQLFLTVVAVAGSFAAIVGLAAG--GYGTT-------------DAGIV
NUON_SACEN       RHQRW------SAQVGLSLLALVAAGVALALHARQGG------------------TGVTT
NUON_SALAI       RRLRH------MVQLTVAMLAVLSALTMVVVNANDR---------------------LIT
NUON_NOCSJ       RAQRY------LVQAALAIAGVVVALVGTILVARDLDVLGDG-------------AARGA
NUON_THEFY       AQRRY------SIQTALAMVAVGVAFVLTLVQVGALPADSAG-------------LTLAF
NUON_CUTAK       RSGRR------STQIIVTVATLVVAIASTLTTIAR---------------------GTRI
NUON_ANOFW       ENRNRQL------LGLFAFVGIAVSFVSLLSLWTS----------------------DVT
NUON_GEOSW       DDKDRRP------LAWIAFVGVAIALIATIGLIPA----------------------KAV
NUON_GEOKA       SDRSRRP------LAWGAAAAAALAMIATAAMIPA----------------------GSA
NUON_BACAN       -KLNHRY------VALGAIAAVVLAIVSLITLYSE----------------------PAG
NUON_BREBN       KRLGKQV------IGWLSFLGTVIAAIFVIINMNALN--------------------KPY
NUON_PAESJ       GRTNRAI------IGWLSLAGLLLSLAAVIWRMIDMNPSGVSAAEAAE-------AGKAI
NUON_DESPS       -DSPKLH------GVALISSVVVIITSLLCLGQTG-------------------------
NUON2_OPITP      -NVRLAR------ILSVATASGVLVAALATVNHSA-------------------------
NUON1_SYNFM      LQSGVLY------RWAVILAGGGLLATVLAVNQNG-------------------------
NUON2_SYNFM      SDPKREH------VAALVLSALGLAACLASVGAEG-------------------------
NUON2_DESMR      --KQSVA------SWLPMAAGLGVLAALFALGERG-------------------------
NUON_BACFR       PDQKGATPKVNVRSLTLPAVILMTLHTVINLFPG--TPA---------------------
NUON_BACV8       ATQR--------HWLRPMACILLTIQLLANLWP---EEV---------------------
NUON_AZOPC       KEWK--------KYFQNIAIVGFAIVIISEFPPYFTMYG---------------------
NUON1_THEYD      KNE-----------VLVWSSVLFLVIFAFFIPSF---EG---------------------
NUON2_THEYD      NYRT--------TYILSFLSILTAIILSVFNFG----QK---------------------
NUON_FLAJ1       RKGI------------VPFTILGLLGVLALNFYEFGTTA---------------------
NUON_FLAPJ       RKAI------------VPITIIGLLAIFGFNISEYNHLG---------------------
NUON_CYTH3       KKLI------------YPIILISLIGILGYNACTFWNNP---------------------
NUON_LEPBA       EEDEGKPLWVLSILG------ILVAMYALYHTTNSPGYG---------------------
NUON_LEPIN       TKEFIIVRYVSGLIL------LLAFAAVFYTSFRFPGNG---------------------
NUON1_AQUAE      R--KHYKFLSVLAFI-------FVVLSGYSIFFVNYPAK---------------------
NUON2_HYDS0      ----SFDLIGFLGFL-------ISFISGVLAIKYSLAGY---------------------
NUON2_AQUAE      GKE-RRLVLNVVSYV-------GYFSVLMSLLIPWMYKG---------------------
NUON1_HYDS0      NSETKKRIFLWISIL-------FLALSMLSFSFKNAFFK---------------------
NUON_PERMH       SRV----VISAITVT-------GLILAAASVFLIKK-GD---------------------
NUON_CAMC1       DLSRNFYCVFCIIAI------FVNLGITLDFNGLSL------------------------
NUON_CAMHC       NISRTFWTMLAILGL------AINIFFLFGYSGIVR------------------------
NUON_SULDN       EQDKSLYVMLSLLILGVDFVALVDSAGVFANNGTIM------------------------
NUON_WOLSU       NSSRSFYTMLSVIFI------VLDLGAVLYFEGYSR------------------------
NUON_SULNB       NLHKSLYVMLTILIL------VIDFGATLGLNVNER------------------------
NUON_HELAH       RFSRNLNMFLCMLFL------VLD--FLVVLGLEQQEN----------------------
NUON_HELHP       TKSRDLYITISMLFV------VLNLGFLFLEGNPIRQF----------------------
NUON_CAMJR       -FHRSFYIGISSLSL------IVSAFLILNNANAQGLEA---------------------
NUON_CAMLR       -LSRNFYIGASIIAL------FSTLCFLLIYNGFVLDNS---------------------
NUON_BUCAI       NH---------------FFVAVFSILGLIFALCSLYFL-----------------IEIIP
NUON_BUCAP       NH---------------FFIAFLTIISLIVSLCSLYFL-----------------IAIVP
NUON_BUCBP       NR---------------YIVFLLTSFGFLSVFISLFIV-----------------KKIVP
NUON_BUCCC       KV---------------KSGCIVTTISIFFSIIYILYI-----------------KRFFF
NUON1_NITOC      QH---------------RLTMVATLIALVLCLAVIPLA-----------------AAVSP
NUON_NITMU       HP---------------RPVMILTLAGLVLSFMALFLS-----------------QGTAS
NUON2_ACICJ      DH---------------RLVALSTIAGLLLCCIALPLA-----------------APASP
NUON_METCA       SF---------------RLVFWLTVGGLLAGLSTLPHA-----------------SSVAP
NUON_PSYA2       SH---------------MVTGTISVVGLNIGLFILLGQMAGIID----------SGSLVP
NUON_ACIB5       NH---------------NLIATTSVVGLNLAALYILLELFG--------------GKFVP
NUON_AERHH       CD---------------DTAFVVTIAGLNLALFSLPIV-----------------MAQGD
NUON_TOLAT       NH---------------KQVFYITVIGLNAALFSLLPA-----------------SSATP
NUON_CHRSD       HH---------------ELTATLTVVGLNLALAAQVVA-----------------WWQAP
NUON_PSEMY       NH---------------ALTFVLTVLGLNLALLSLLPA-----------------MGVAP
NUON_HAMD5       HH---------------FFNGSLTVIGLNCALFSLYTVWGLFH-----------FSQHDA
NUON_ECOLI       NH---------------FLNATLSVIGLNAALVSLWFV-----------------GQAGA
NUON_PROMH       DH---------------FTIATLTATGFIIALGSLYYV-----------------NALGV
NUON_BLOFL       NQ---------------FKHAVLTIIGMIIASVSSLLH--MMW-----------SMNKSG
NUON_BLOPB       NL---------------FLHTSLTIFGFSLAIIS--VG--LVW-----------DQRD--
NUON_BAUCH       NH---------------FMHASLTVVGLLLAIFS------LFF-----------VVHGSI
NUON_SHEWM       NH---------------QLAFYITGTGLCIACVSQCSL------------------LSAS
NUON_RICBR       GKNR----------IVANITILLTILTIFIILKYSYSESVL-------------------
NUON_ORITI       NTLTHV--------IAKMAIGFAAILIAILVFHPSWFNG---------------------
NUON_ARCB4       FNIKNH--------IFASSVFLIIALLFALSNVSNSFSVQPY-----------------E
NUON_PELPD       DKRAGS---------ALFIASLLAGAGVLVMQLQTGYTA---------------------
NUON_NEORI       -------------------FGLIAVLITLAATFFSQTCTSV-------------------
NUON_DESAP       GFVLAA-------ALAVLASGAVALAETLVRGEPWRYYVSGW-----------------P
NUON_CAMFF       SKRYSI---------NLNILFWVIIFISFFIVRSNFSNDFLM------------------
NUON_SALTO       RARV------------TISVAALGALATAAGAVLVGGGGERR---------------TFC
                                                                             

NQO14_PARDE      AAFHGMFIDDGFSRFAKVVTLVAAAGVLAMSADYMQRR----------------------
NUON_JANSC       EAFDGMIIDDAFSRFAKITILLSAAAILMISQDYMAKA----------------------
NUON_AZOC5       AGFNGSMLVDPFARFMKVVALLGAAVSLIMSVDWLNRA----------------------
NUON_BEII9       VLFDGSFIDDAFGRFMKVLVLIGSLVSLIMGQTYLARE----------------------
NUON_METNO       TTFNGSFIVDGFARVMKTLTLVGSLAALLLARDLFARE----------------------
NUON_PARL1       ETFGGMFVIDGFTKFMKLLILLAAAAAIVMSLTFIRRE----------------------
NUON_MAGSA       TAFNGLFVADRFAGFAKGLVLVASAIATAMSLPYLERE----------------------
NUON_RHORT       LAFGGLFIDDGFARYAKALTLLGAVLTLLLSMVWLKRE----------------------
NUON_RHOCS       VTFAGMFIADDFAVFAKVLILTATALTVVLSVNYLERE----------------------
NUON_BARBK       FFYTNALIIDAFSRYMKILTLIGALFSLILSVGFSSSQ----------------------
NUON_RHIEC       LAFGGVYMADGFSRFMKLVALIGSLVALFMTMGHAREN----------------------
NUON_GLUDA       VGYNHIFVNDDFARFMKILSLAGGAFATMLTVGYARNM----------------------
NUON_GRABC       LGFQGQFVADPFAVMVKLLILSGASIAVVLSLDYNRHH----------------------
NUON1_ACICJ      TIFHGLYQTNDFTRFADVLVALGAIGALALSVTFNRNI----------------------
NUON_SPHWW       --FDGLYIADSFAAFAKLLIYIAAAVSVAVAPGFFSRTG---------------------
NUON_SPHAL       --FSGTLSVDAFGGFAKLLIYAASFICILVAPRFFT------------------------
NUON_ERYLH       VAFGGQFLADSFASFAKILIYLSAIGCLMIAPAFFDRL----------------------
NUON_CAUSK       HAFNGVYAADAAATYAKVAIYLSSAVAIVLGDRWLAVR----------------------
NUON_MARMM       MAFNDSFVFDSLARFSKTAIGLVAAIAMLLAMPYLQAE----------------------
NUON_HIRBI       TAFNGLYKVTPFIAIAKAVSYGVGAIALLVAGGYLHRE----------------------
NUON_HYPNA       EAFNGLVKTTTFTNFTKVISFTLAGVAIFLSEGFLRRH----------------------
NUON_PELUB       SLFNDGYVVDNLSSFMKILTILGGAFVLSISTRYLKIF----------------------
NUON_MAGMM       STFGGMFVNDRFAAFMKVMLYLSTLLPMVVSWVYLEKS----------------------
NUON_AZOSB       TTFSNMFIGDLLGDVLKLLIYFSMAVALLYGRSYLA------------------------
NUON_DECAR       YTFSNMFVDDLMSDLLKLFLYMTVVIVMFYSRGYVI------------------------
NUON_NITEU       YTFTGMFVGDAMSDILKLLIYVTVAAVLIYSRSYIS------------------------
NUON_THIDA       LALGGLFIDDPLSDVLKLFLYLTVAIVLVYSRDYLR------------------------
NUON_METGS       YAFNGMFVDDPLSDVLKLMMYLTTSVMLVYTRQYVS------------------------
NUON2_NITOC      VTFNGSYIKDSLSDTLKLFIYIIVFAVFLYSRDYLQ------------------------
NUON_THISH       FTFNDTFIADGLSDLLKVAVYLITAVVFLYSRPYLQ------------------------
NUON_ACIF2       -AFAGLFVLDRFTNVAELFSYLAVLMVVLYSRRYLV------------------------
NUON_ALKEH       VTFSGTYVSDNLAAVLKVAIAGLGFLSFAYCRDYLE------------------------
NUON_HALHL       VTFSGHYMADSLGAVVKASVALLSVLALAYTRPYLG------------------------
NUON_LARHH       LTFSGMYVADPIASVAKLGLVVATGVAMIYARQYAF------------------------
NUON_NEIG1       SSFNGMYIADGMSRLAKMVLYALTFVLFVYAKPYNQ------------------------
NUON_HERAR       YSFGNMFVSDPMSNLLKFCTYIAVGLTLVYSRQYLE------------------------
NUON_POLNA       YGFGNMVVVDPMGSWLKCFSSIALMITVVYGRPYAA------------------------
NUON_BORA1       KTFNGMYVTDSFSHLLKITSYIAVAVTLIYGRVYAQ------------------------
NUON_PARP8       YFFSRMYVVDPFASVMKAVVSLGYAVSIVYSRKYLE------------------------
NUON_CUPTR       YAFANLVVIDPMANVLSAFCAAGLFVTLVYTRRYLA------------------------
NUON_POLNS       VAMNGLFQSDPFSNLLKACSCIAVLISLIYSKQYLM------------------------
NUON_RUTMC       IIFGGSFVLDNMASVFKVFMMAATMVAMVYSRHYLR------------------------
NUON_HYDCU       LTFDGSFVRDAFGDILKLVIVVVSMGIFLFSKEYLL------------------------
NUON_COXBU       FTFHHMFVLDRFSVYLKLFIYLSVFFAFIYAREYND------------------------
NUON_LEGPL       LIFNKLFISDDISHLMKLFIDITVLLSFVYSQNYLD------------------------
NUON_XANC5       -IFNGMFVRDTAADVMKTVIVLVSGLSLVYGWTYLR------------------------
NUON_FRATF       LVFEGQVVFSGFAYTLQLVILVLAVFVALYSRDYVK------------------------
NUON_EHRCJ       LIFNGLLKSDLYISIAKIIILLSSSSVLFMLLVSGKEY----------------------
NUON_WOLTR       FPFNSLLKLDLYIRSAQGLILIAGILVLLLLNLSKYDY----------------------
NUON_ANAPZ       SLFGGFVVRTAHTCLARAVVAVSGLFAFLLFFFAKRSY----------------------
NUON_ANAMF       HLFNGLVLHTRYTCISRMLVGVAGFVASLLFLCARREV----------------------
NU2C_NOSP7       ISFTGGFNGDDLSIVFRGIIALSAAVTILMSI----------------------------
NU2C_SYNJB       ESFLGSFAADPVSILFRGLVVGTAVLTVMMAE----------------------------
NU2C_GLOVI       VSFLGSFTADPLSVVFRAFILISAALTVLMSV----------------------------
NU2C_PROMA       SAFLGAFIADNFSIAFRAVVALSTLISLLISW----------------------------
NU2C1_ARATH      ISFSGNFQTNNFNEIFQFLILLCSTLCIPLSV----------------------------
NU2C1_COFAR      ISFSGNFQTNNFNEIFQFLILLCSTLCIPLSV----------------------------
NU2C_ADICA       FTAYERSHARDFGNIFRFFLLICSLLSISSSV----------------------------
NU2C_CHAGL       VTPFPSFKGDSFSIAFRFCIIIASLLSLLLSI----------------------------
NU2C_CHAVU       IAFLGSFEVNHFTTCFRLIISLCCILCIPLSF----------------------------
NU2C_STAPU       TAFLGSFQVDGFTIAFRCLLTLSSALCIPLST----------------------------
NU2C_CHLAT       LSFLGSFQGDSLSIAFRFFILLSAVLCILLSK----------------------------
NU2C_NEPOL       MTFGGSFQADSLSLVFRAIIAMSCVLCILLSI----------------------------
NUON_ANADF       ALFNGMLANDAFAIFFKWLFLAAGALTVIIAAQGR-------------------------
NUON2_SORC5      ALFHGLLAFDRFSNLFRVIFALVTGAIVLFLVPPRAP-----------------------
NUON_CHLCH       EFFFGMYVLDGFAIFFKYFFVLSGMLAVVITMADE-------------------------
NUON2_CHLT3      EFFLGMYAVDPFAIFFKYLFIVSGVFAVLISIDSV-------------------------
NUON_CARHZ       MAIEGMYQVDKVAIFFKALSLLAGVFVTAIA-----P-----------------------
NUON_DESRM       VLLDGMYLVDQYATFFKILCLISAILVVLGS-----F-----------------------
NUON_DESHD       AFLQGMYMHDQFAGFFKILFLVAALLVVLST-----K-----------------------
NUON_HELMI       NTFHQLWILDDYSVFMKEIFLVAAILVILSA-----I-----------------------
NUON_CLOB8       SLFGGAYINDSFSTFFKQLFLIAAVLTVLIS-----R-----------------------
NUON_MOOTA       GVVLGGYVIDPFGTYFKILFLVAAMLTAACS-----Y-----------------------
NUON2_SYMTH      EFWGGMIIADGFTFFMNGVLLGIAALVILLSA----D-----------------------
NUON_DEHMB       LAFGGMWALDGYASFFRILFISLSGLVIMASV----D-----------------------
NUON_METI4       IFWNGLYVWDKMAVLWKVFFLITGFLVSYLSLE---------------------------
NUON1_OPITP      DAFSGLLQFSYVGQAMRVFFLLSSIFVSILARV---------------------------
NUON_RUBXD       TFFGGGYAVDPFALYFKLIITATAFFTVIAAA----------------------------
NUON_RHOP5       --------DDGLARYGTAYAALFGLAALVFLRVAGV------------------------
NUON_RHOS5       --------DDRMSRLTGLVVCLSGIGSLAFLRPDGP------------------------
NQO14_THET8      --------VDGVSQVFTLLALLGALWTVGLVRSG--------------------------
NUON1_STRGG      --------LDTATHTTRAIVLVAVLALIALSRDTVAG-----------------------
NUON_MYCSJ       --------VDTATGVARIACAAGLLLIWAVAGAEMRA-----------------------
NUON_DEIRA       --------ADPAALLLGGTVLLGALLTLLVSLDTAYR-----------------------
NUON_GEOMG       --------VTPFTRFFLVFFAVTAGLSLLLARDHAAR-----------------------
NUON_GEOUR       --------FTPFARFFTVLFSLTAAATLLLSHDHNVR-----------------------
NUON_GEOBB       --------FTPLAQFLIPLFCAAALLTLLLSHGYNEN-----------------------
NUON_PELCD       --------SNLFARGCLTLWALLGAATCLLSDRYRGS-----------------------
NUON1_DESMR      --------GSPIACFYAGLLSVIALATIALLARYAER-----------------------
NUON_PARUW       --------FDTLARFFTVFFLVIGIGASLLATAFFQR-----------------------
NUON1_SYMTH      --------MLVMDRFAAVYGLVLLGAALLAILLSFGR-----------------------
NUON_CHLSY       GGDPIIGVFATDHLTMIARLLIIGAALVTSLLCLDIR-----------------------
NUON1_ROSCS      GGSPILGAFATDEFTMIARLTFIGAAFLTTLLAMGYR-----------------------
NUON2_HERA2      DGSILGGAFVVDPLTHIGRLVFIGAAFVTVILTSKAK-----------------------
NUON2_ACIC5      ---ARTGVVQVVLLLFTLAVTLLSGSVLAQQGREVSA-----------------------
NUON1_KORVE      SGFLGSLVMDRFAIYFYLLFIVGAAVAILMSIRYMEI-----------------------
NUON2_SOLUE      SGFGGSVTVDGFAIFFNWIFLVAAVVVAIVSYKYLEI-----------------------
NUON2_RHIME      --YAGMFISDRFAVFFKLVFYLATILTFFLSRKYAEI-----------------------
NUON_THERP       --FGQSYRADWFALAVALVALIAGALSVLVSAGYTESG----------------------
NUON_DESDA       --FGGVFRADGLAAAFKVVCLAALGLTALMSEAFCRH-----------------------
NUON2_KORVE      TGFWGMVHVDSFSLFFHVLIALITAAVLLVSFEYMDV-----------------------
NUON1_ACIC5      TAYFGVVQTDAFSVFFHILISGIVLVSALVTIDAIKP-----------------------
NUON1_SOLUE      PAFGGMLMVDGFATFFRVVVITVGILTVFPSYRFLAR-----------------------
NUON_ANAD2       NVFGRQAVVDSFSAFVTVVLCAGLALSALVGQSWLNA-----------------------
NUON_MYXXD       EVMLGFGVMDPFSSFLTFVVCVGLGLATLSSVSFLRK-----------------------
NUON1_SORC5      DSLAPYLVMDRFTLFFSFVLCLGGALAALLAGGYLPE-----------------------
NUON_CHLAD       -TFGGMLRLDPFALTLTWIFLLIGILSITMSLDYLPG-----------------------
NUON2_ROSCS      -TFSGMLRLDSYSLTLNWLFLAAAAITMVLSLDYLPR-----------------------
NUON1_HERA2      -GFSDMLVFDKFGVLVNWILLAGTALTLLIAFDYMPR-----------------------
NUON1_CHLT3      FAFSNMLQSGGFFTYTATVFSIGGLLITLISDKYLEM-----------------------
NUON_GEOLS       SSFSDSVVLDNFAIFFKIIFLLAAGLAVLISDQYMSR-----------------------
NUON_SALRD       TVFFETLRTGGFVAFINLIILLTGLATILLSVPYLNQ-----------------------
NUON_GEMAT       GTPDGRVAGDGFRWAVDLVILLGTALALMLLEAEHQR-----------------------
NUON_BDEBA       TAFNNGLIFDGVTQWMGIIALAGAGAAMVMMYENPST-----------------------
NUON_ACIC1       AQ--SAIAADGPTLFIQGTILALSIGALLLIADRSI--------------------GADS
NUON_RHOOB       VG--GAVAVDGPTLFLQGTILLISIPAILIIAERSVDSGVAAATAEVTAVRGAEPEGGTD
NUON_FRASN       AA--GAVAIDGPTLFLQGTILVFALLSVLLVAERRLD-------------------SSGG
NUON_MYCA9       MN--GAVAIDGPTLYLQGLILVASGLALVVMAQRRTVAAVPSAV-------GAGAGGGLD
NUON_BEUC1       VV--GQLVEDGPALAAQGIIAILAFVGILVIAERGRR---------------GAPGS-ED
NUON3_STRGG      AM--GAIAIDGPTLFLQGTILLVAMVALFTFAERRLDP--------------GSNGNRVD
NUON_SACEN       LS--DSLAIDAPTLFLWGTLLALGLGAILLIADRSVE--------------------SGG
NUON_SALAI       IG--GAIAVDGPALFLQGAILVLAAMALLLIGERSVE--------------------RGG
NUON_NOCSJ       IDVEGTIAVDGPALFIWGMLLVFALGGALLFAERRLE-------------------GGVS
NUON_THEFY       ----ATVVVDRPSLFFQGVILALALASLLLIAERR---------------------DGES
NUON_CUTAK       VAGQGTLAPDGPTLATWVILLATGLGTVVLFAERVGT--------------------TQT
NUON_ANOFW       SILGDTFRLDSFAKSFKALLLIGSALVLLLSIHYEPKE----------------------
NUON_GEOSW       SILNDTFRLDAFGKAFKLLLLAGGALSLLLAFDYRPKE----------------------
NUON_GEOKA       SILHDTFRLDAFAKAFKFILLAGGALALLLVAEWAPKE----------------------
NUON_BACAN       DILNGSFVLDGFSKGFKTLLLGGAALILCTAMSDDKKN----------------------
NUON_BREBN       SYMIDMIRIDDYGNAFKLIFLAGTAFAILISLSYLKAG----------------------
NUON_PAESJ       SLLGASYRVDDYGNLLKIIFLIGTSLVVLLGLGSTQKDD---------------------
NUON_DESPS       ELFYGAYGISSYSQIFKVFLGIGSLLILLTGKQF--CGI---------------------
NUON2_OPITP      VLFSGAYRVDAFSQLLKIAIAFGYLCVGILSGQL--RDI---------------------
NUON1_SYNFM      FIFFDCYRVDLYSQLFKILLALGTFWVIFSCSEL--QGI---------------------
NUON2_SYNFM      YCFAGAYKVDLFSQVFKVLLAAGLFLIVTLCGEL--SDI---------------------
NUON2_DESMR      EFLYAAYKLDGLSQFFKLLIAFGFAVVTGIAAGN--KEG---------------------
NUON_BACFR       EAFGGMYQYTPMQTIIKAVLNVGTIIVLLMAHEWLKREDT--------------------
NUON_BACV8       TLFGGMYHSTPMASVLKSILTIGTILVFLQADTWLKREDT--------------------
NUON_AZOPC       EAFGGIHISSQLTFFMKSILNVATFLVFLQANKWLSSEKM--------------------
NUON1_THEYD      EAFNGMFLNDFLTIYLKLIIIIGTIISLLVLTSYLKEK----------------------
NUON2_THEYD      EFTSELIKIDLYRQTLRILVLFIGVFIIGLSYSDLKLK----------------------
NUON_FLAJ1       SYYNNMITVSKFSTAFSSLFIILTIFLVALSHNFYENH----------------------
NUON_FLAPJ       SYYNNMMVVDKFSVAFSSLFIIITVFLVALSHEFYKEQ----------------------
NUON_CYTH3       ETHYGMLVHNNYSVAFGSLLITITLFWFILFRSSYSSG----------------------
NUON_LEPBA       KFFGSQISISPLTVWLSAIYLIAGLITLLVAPPFLSQH----------------------
NUON_LEPIN       FHFSGQIENSVLSFWLNLIYISMAIGTAAIVPRILKNH----------------------
NUON1_AQUAE      LFFDGF-SVDALNLIGKLFILAVTGFVLLSSYDYFSKK----------------------
NUON2_HYDS0      RFNEWLLDINAFSLLLKGVMYILTSFVIFSSVSFFKSK----------------------
NUON2_AQUAE      DTFYGNFTNDPLAVTVKIFAVLITLAILPFASSYFSAK----------------------
NUON1_HYDS0      DVFSGTYTIDTLGMFSKIFEIVLTLMVLPFLHTYMNKK----------------------
NUON_PERMH       VTFYGLYVVDMFSLIFKLFLILTTLFVVINLKPYLDSK----------------------
NUON_CAMC1       -SFWDMLLVDGISIISQIIILIASALFIPLALSTKEYF----------------------
NUON_CAMHC       -GFFDLVLIDGFAFISMIIILLFSILFLPLTLSKENFH----------------------
NUON_SULDN       -GVFDMMLIDGLAILSQFIIVGASMLFIPLALTHKRFH----------------------
NUON_WOLSU       -GFFDFMLIDGISILSQFIILIASALFIPLALTSKRFH----------------------
NUON_SULNB       -GFFDVMLIDGVSIVSQLLIIVASILFTPLALTSKRFH----------------------
NUON_HELAH       -AFFGFLSLDTLSLVSQSIVLISAFLLIFLALSKERFN----------------------
NUON_HELHP       -GFFNLLLVDGISLLTQIIMLLATFVLLLFFMNQNNLP----------------------
NUON_CAMJR       KAFLATLNNDIVSFYASLVILCFSFLYLLMQKEEN-------------------------
NUON_CAMLR       HAFFDLFVSDNYAIFAQIVILVFSMLYLLMDKDEQ-------------------------
NUON_BUCAI       INVSILFHFNSNAILYIGMILISSICTCIFS-YPWLLKYPFN------------------
NUON_BUCAP       IDITSLFHITKRSILYISMIIISSIATCVFA-YPWLLKYAFN------------------
NUON_BUCBP       IHATTLFHIDKYSLLYIGIVIISSFLACIFSHYCSLTNYLYN------------------
NUON_BUCCC       NYSSDLIRIDQYSFYFMILLLISSFFTCIFS-YSWLLLEDNY------------------
NUON1_NITOC      QHVPPLFIIDRYALFYMGLIFTAALAITLLA-YGYMKGL-VDQ-----------------
NUON_NITMU       SQVTTLLILDQYALFFIGLIVVATFVVAILC-YRYFGGG-ESR-----------------
NUON2_ACICJ      VAVTKLFVIDGAALFYAGLVLVSALVVAALS-WVYLDRVGEGP-----------------
NUON_METCA       LQVTDLLRVDAYGLFFHALFLLAALVVALLC-LAYFRRR-ENE-----------------
NUON_PSYA2       A-AEQLFVIDNFAQFNMVIIFICALACCTLS-YAYLADLKDH------------------
NUON_ACIB5       ANVMGMFMVDPFTMFYQFMILVASLACCTLS-HAYIETYKDN------------------
NUON_AERHH       QGVTPLLQIDGYAVFYMGLVLIGALATCTFG-RSWLKGYPDN------------------
NUON_TOLAT       VTVTPLLIVDSYSVFYSALILIGSLATVTLA-RAWLKKFPDN------------------
NUON_CHRSD       VSVTPLMTVDGLAVFGGVLILIATLACATLG-HAYLEGAQGP------------------
NUON_PSEMY       LEVTALLQIDRFAGYYMALVLAASLACVTLT-HAYLGGQSGKGYPG--------------
NUON_HAMD5       INVTPLLRINGYSIFYSGLVILASLATCTFA-YPWLQGYPDN------------------
NUON_ECOLI       MDVTPLMRVDGFAMLYTGLVLLASLATCTFA-YPWLEGYNDN------------------
NUON_PROMH       VDVTTLYHVDGYSSFFTALTIIAGLGTVAFA-YPWLEGYQDN------------------
NUON_BLOFL       QNFFQLICIDNFSVLYVILIMFVGIASSILG-YVWLVYYPVY------------------
NUON_BLOPB       RNFLQLICVDDFSILYIILVLVSGLSSSVLA-YKWLLIYPSN------------------
NUON_BAUCH       ANFTTLIHVDSFSIFYTGLVLIASLATSTLS-YTWLSNNKDY------------------
NUON_SHEWM       HFSDELFTFSSMSGVLSVLLLGILIFLWLQL-HTWLEKHEANH-----------------
NUON_RICBR       YLDYVMFTTNANIANYKAIILIFTIISMIIYRDYSVRS----------------------
NUON_ORITI       IYWNNTFIVNQSKIYLKIIILIFYIFLTLIYSGYIKVA----------------------
NUON_ARCB4       SFLNNVLTFDSFSNFFNILLIAGTLLTLLIGEHYFQHR----------------------
NUON_PELPD       DIVMNEIRIDRFSEIGRLIIVSCGAILGVYSLSSEAGH----------------------
NUON_NEORI       EILNGMLLISPFTQNVKLVILAFTCVFFIQAIAVKQSY----------------------
NUON_DESAP       PPWGIELVIDPLAGGLIVLVAFFGLAALVYAGPYLQGRTP--------------------
NUON_CAMFF       DFATPFISLDEFSFCFGVVLSALMIIFLISSFYSDDEK----------------------
NUON_SALTO       VGADCSYVFGGRAALVAVLVALLTLGVLGLSGPLLRAG----------------------
                                                                             

NQO14_PARDE      ---------------NMLRF---------EFPIIVALAVLGMMFMVSAGDLLTLYMGLEL
NUON_JANSC       ---------------DLLRF---------EFPVLIILAVVGMMIMVSAGDLIALYMGLEL
NUON_AZOC5       ---------------QQAKF---------EYAVLVVLASLGICILISAGDLIALYLGLEL
NUON_BEII9       ---------------KIDKF---------EFPILILLSTLGMLMLISATGLIALYLGLEL
NUON_METNO       ---------------RIERF---------EYPILIVLSSIGMLIMASANDLIGLYLGLEL
NUON_PARL1       ---------------GMDRF---------EYPVLIILATLGMFMMVSANGLISLYMGLEL
NUON_MAGSA       ---------------KIGRF---------EYPVLVLFATLGMMMMISANDFIALYLGLEL
NUON_RHORT       ---------------NEGRF---------EFPILVLFATIGMMMMISANDLIALYMGLEL
NUON_RHOCS       ---------------QMDRF---------EYPVLMLLATVGMMLMVSANDLISLYVGLEL
NUON_BARBK       ---------------KFDIF---------EFPILVLLATLGMMLMISSGNMLSLYMGLEL
NUON_RHIEC       ---------------QLDKF---------EFPVLLVLATLGILLMISANDLISLYLALEL
NUON_GLUDA       ---------------KVERF---------EFPVLLLFSTLGAMMMASSENLMTLFIGLEL
NUON_GRABC       ---------------GMERF---------EFPVLTLFSTVGMMVMVSASNFMTLYMGLEL
NUON1_ACICJ      ---------------GITRF---------EFPVLVLFAVTGMVVLVSASDLITLYIGFEI
NUON_SPHWW       ---------------GGYRA---------EYPVLILLSGVGMGMMVSAGDLLTLYVGLEL
NUON_SPHAL       ---------------GGMRA---------EYPTLILFAALGMGIMASSRDLMTLYVGLEL
NUON_ERYLH       ---------------KAMRP---------EYPVLVLLATLGMSIMVSAGDLITLYIGLEL
NUON_CAUSK       ---------------GDQKF---------EYAVLVILAAVGMGVTASAGDLISLYIGVEL
NUON_MARMM       ---------------KLGKI---------EYPVLVVLAVTGMMMMVSANDLIAMYMGIEL
NUON_HIRBI       ---------------NMNKF---------EYTLLVMFGSAGMGVMLSANNLMTLYMGIET
NUON_HYPNA       ---------------EISRY---------EYPLLMVLASLGMGIILSANNLMTLYMGIET
NUON_PELUB       ---------------KIFLI---------EYPVLILSSILGMMVMISSNDLMVFYIGLEL
NUON_MAGMM       ---------------KLGNG---------EYFVLTLFAMLGGMFMISSGSFLVLYLGIEL
NUON_AZOSB       -----------------DRK-LDK----PEYYVLALLMTLGMMVMVTSNHLLSMYIGLEL
NUON_DECAR       -----------------DRESMNK----GEYYVLALFATLGMMVMISANHFLTIYIGLEL
NUON_NITEU       -----------------TRG-LLK----GEFFSLALFATLGMMVMVSANHLITLYLGLEL
NUON_THIDA       -----------------VRG-LYK----GEFFVLALFALLGMMVMVSASHFLTLYLGLEL
NUON_METGS       -----------------LRD-MFR----GEYFALTLFALLGMMIMVSGQHFLTLYMGLEL
NUON2_NITOC      -----------------ARA-LDK----GEFYVLGLFGVLGMMVIASAHHFLTLYLGLEL
NUON_THISH       -----------------DRD-IYK----GEYYVLGLFGVLGMMIMISSYSFLTLYLGLEL
NUON_ACIF2       -----------------DRG-IYR----GEVFVLLLFALLGIMVMVSGGSLLSVYLGLEL
NUON_ALKEH       -----------------DRG-LLK----GEYFVLGLFSLLGMMIMASAHNLMTVYLGLEL
NUON_HALHL       -----------------DRG-LLQ----GEFYLLALFANLGMLVIASGGSLLSLYLGLEL
NUON_LARHH       -----------------DRG-FLK----GELFTLMLFALLGMCVMVSASHMLTLYIGLEL
NUON_NEIG1       -----------------VRG-IFK----GEFYTLSLFALLGMSVMVSAGHFLTAYIGLEL
NUON_HERAR       -----------------DRQ-MVNGRLGGEFYILSLFTVLGQMVMMSANNFLIIYLGLEI
NUON_POLNA       -----------------DRD-MLR---GGEFFTLSLFALLGMFVMISGHNFLVLYMGLEL
NUON_BORA1       -----------------SRD-MLR---GGELYVLTLLALLGQMVMISAGSLVSVYLGLEL
NUON_PARP8       -----------------DRG-LYE----GNFFLLGMFSLLGQLVMISGNNFLTLYLGLEL
NUON_CUPTR       -----------------ERD-MFA----GEFYMLALFTLGGQIVMITGNNFLTLYLGLEL
NUON_POLNS       -----------------DRD-LFR----SDFIVLALLALLGQFVLISGANLLTLYLGLEL
NUON_RUTMC       -----------------THS-LFR----GEYFVLVLLSVLGMMVMVSGYSLLTLYLGLEI
NUON_HYDCU       -----------------QNK-FYR----GEYFTLGLFGVLGMFVMVSAYNLITMYLGLEI
NUON_COXBU       -----------------ERK-IPH----TEFYVLGLLSMLGMVALVSSSNLLTVFLGLEL
NUON_LEGPL       -----------------ERQ-MPT----GDYYVLGLFSTLGMMILVSAHSLLTLYLGLEL
NUON_XANC5       -----------------ERN-LYQ----GEIPVLVLFATAGMMLLASAGSLLMVYLGLEL
NUON_FRATF       -----------------DRK-ISD----GDFYTLLMLCVLGAMVLTAAHSLVTIYVGLEL
NUON_EHRCJ       ---------------------------CYEFSIMILFAVFGLITLIAANSLLSFYLSFEI
NUON_WOLTR       ---------------------------EYEFSILILFTLFGMITLVSANNLISFYLSFEL
NUON_ANAPZ       ---------------------------RYEFAVLMLFAFLGTLTLVEAHHFLSFYLSFEL
NUON_ANAMF       ---------------------------RYEFSVVMLFATLGAMTLVQAGHFLSLYISLEL
NU2C_NOSP7       ------------------RYVDQSGTPLAEFIAILLSATLGGMFLSGASELVMIFISLET
NU2C_SYNJB       ------------------RYIAQSGAPTGEFYVLLLTATLGGMFLSGATDLILVFVSLET
NU2C_GLOVI       ------------------RYINQSSLATAEFYVLLLGATLGAMLLSGSSEMAMIFVALEL
NU2C_PROMA       ------------------RYAEQSGSPVGEYAAILLAATLGAMLLCGSTDLISIFISLET
NU2C1_ARATH      ------------------EYIECTEMAITEFLLFILTATLGGMFLCGANDLITIFVALEC
NU2C1_COFAR      ------------------EYIECTEMAITEFLLFVLTATLGGMFLCGANDFITIFVAPEC
NU2C_ADICA       ------------------DYILCSKMSLAEFLLFKLAAGLGGMVLSCANDLVTIYVSLEF
NU2C_CHAGL       ------------------DYIKRAGVQLMEFVIFLLGATIGGMFLCGANDLITIFTSLEC
NU2C_CHAVU       ------------------EYIKCSGIRLTEFIIFLLFTTLGAMILSSANDLITIFISLEC
NU2C_STAPU       ------------------EYIRRSGMTQAEFLILLLTATLGGMFLCGANDLVTIFVSLEC
NU2C_CHLAT       ------------------EYVERSRTALTEFFVLLLTAVIGGMLLSGANDLIMIFLSLET
NU2C_NEPOL       ------------------DYVESTGTAPSEFLVLIATASLGGMLVAGSNDLLMMFVSLET
NUON_ANADF       ------------------DFPPER---IGQFFALLMAIVLGMFMMASATDLLMVYLSLEL
NUON2_SORC5      ------------------GIEPELRRDSGELFTLILVLSLGMNLMAASRHLLLIYLSLEL
NUON_CHLCH       ------------------QFER-EISSMGEYYALVVAMVVGMMMMASSSDLLMIFLSMEL
NUON2_CHLT3      ------------------EVNLPESRSLGEYYSLIVAMVLGMFLMASSTDLLMMFLSLEM
NUON_CARHZ       ------------------RYMEK-IGYYSEFFVFAVFAVLGMMILVSATDFLTLYLGLEL
NUON_DESRM       ------------------RYIDKQVGNQFEYYSTVIFTTLGMVVMASAGDFITLYLGLEL
NUON_DESHD       ------------------NYVAKFQAYRGEFYPLLLLAALGMMLMAGAGDLLTMYVGLEL
NUON_HELMI       ------------------DYVDGLPRFKTEFYALLVFATLGMMVMASANDLVTLYVGMEL
NUON_CLOB8       ------------------DHLVS---KQGEFYALIVSALLGMMIMVSSGELIAIYIGLEL
NUON_MOOTA       ------------------DYVEKMGLNQGEYYALLVLATLGMMVLASSGELVSLYLGLEL
NUON2_SYMTH      ------------------YVGKFLRGAHMEFYEIILAVTLGMMFMVSSRDLLTIYIGLEL
NUON_DEHMB       ------------------YVNKF-RRFQGEYYALVLLALLGMIMMASTTNLITMYLSLEL
NUON_METI4       -------------------SDRLIPKARSEFYILPLFTTAGMALLASVRDFILLFVGLEI
NUON1_OPITP      -------------------SLAKQQLPRIEFYHIVLVATAAMMLLAQANHFVLFFVALET
NUON_RUBXD       -------------------RWAERTGDAPEYMTLIIAVALGGMLLVSMRDLFGVFLAVEL
NUON_RHOP5       ---------------------------AKEAPALVALVALGAASLTGAGHAATLFLGLEL
NUON_RHOS5       ---------------------------SKEGPALLLLATLGGVVLTGAVHAASLFLGLEL
NQO14_THET8      ---------------------------RFEFYLLVLYAALGMHLLASTRHLLLMLVALEA
NUON1_STRGG      -----------------------HK-RETEFVVLLQLGALGSIALAGAGDLIMLFAAFLL
NUON_MYCSJ       -----------------------SP-REAETYALLMFSATGVLVLAGAEDLLLLVAGYFL
NUON_DEIRA       -----------------------ARVSFAEFDALLMYAVTGCLLIAFSGDLIVMLIGLEI
NUON_GEOMG       -----------------------QGLKGEEYPATILFGTFGMGVVASAANFLTLFLGLEA
NUON_GEOUR       -----------------------RDISGEEYPATVIFAAFGMAVVSASANLLILFLGLEA
NUON_GEOBB       -----------------------RAIKGEEYPATVLFALFALCVLPCASNLLILFLAIES
NUON_PELCD       -----------------------RKLAAREYAALTLFAVLGMAILSASTSLVSLFLGLES
NUON1_DESMR      -----------------------RGFAGDALYGLLLWSALGMLLLADADDWIMLAVGLEL
NUON_PARUW       -----------------------FKASHGEYFFLLQSAVFGLILIGAAADLLTLFLGIET
NUON1_SYMTH      -----------------------VREDQSGYLALLLWAAMGMVLLGGAGNLMVIFLGIEL
NUON_CHLSY       -----------------------PNAHPGEFYALIIFATLGMCLMVGANELLLAYLAIEL
NUON1_ROSCS      -----------------------LTANPGEFYALLIFSTLGMSIMAAATEFILAYLALEL
NUON2_HERA2      -----------------------PSNNPAEFYALILFATLGMIFMTAGGELIMIYLGIEL
NUON2_ACIC5      -----------------------FTTHIGEFFALLLFATVAALFLVSTQNLLLIFLAVEF
NUON1_KORVE      -----------------------EHEDHGEYHALILFATIGMMCMASGMDLILLFVGLEL
NUON2_SOLUE      -----------------------SGEHHGEYYSLILFAQCGMYFLATGTDLITLFIGLEL
NUON2_RHIME      -----------------------EGIGRSEYYVLLLFALVGMMIMASAIDLLSIYVGLEL
NUON_THERP       --------------------LDPEGIGQAEYLSLLLFSVLGTMLVGAAGDFIVLLLGLEM
NUON_DESDA       -----------------------ASMRQGEYYSLMAFSTLGMCVMVSAGDAIVLYLGLEL
NUON2_KORVE      -----------------------QRMRSGEYYAIILFSALGMMLMTSATELVLIFIALEI
NUON1_ACIC5      -----------------------DTENTGELFALMAFGAVGMLLMTCAAELLLVFIGLEI
NUON1_SOLUE      -----------------------QDAETSEYHALLLFSIAGQCLMAASNDLIMVFIGLEI
NUON_ANAD2       -----------------------RNSERGEFYALALFGTAGMVLLGMATDLLIAFIAVEV
NUON_MYXXD       -----------------------RGAERGEFYALMLFASAGMSLLAMSNELITLFVNIEV
NUON1_SORC5      -----------------------HRLDRGEFYPLLTFSTVGAIILAGAGDLLTLFLGLET
NUON_CHLAD       -----------------------QGIEQGEYYPLIMFAVSGMILLAQGTDLIVLFLGIET
NUON2_ROSCS      -----------------------QGIERSEYYVLVLFATGGMMLLAQGADLIILFLGLEL
NUON1_HERA2      -----------------------QNLSQGEFYPLVLFATSGMLFLVQSTDLVTIFIGVET
NUON1_CHLT3      -----------------------EDAHHGEYYIILFMAVVGMMLMSAAANLTILFIGLEL
NUON_GEOLS       -----------------------EECNHGELYPIILFTTVGMMLMAAATDLMTIFLGLEL
NUON_SALRD       -----------------------LRYDYGEVYALIMFCTVGMIMLGSANNMVSIFLGLET
NUON_GEMAT       -----------------------SAAFGPEVPSLMLLASTGMMVLAGARDLMFVFLGVEL
NUON_BDEBA       -----------------------TGKQFSELIFLAMSSAVGMLILVSAVDLLMVFIGLEM
NUON_ACIC1       DFVAQAADLPGSEQ---ERASVQAGLRQTEVFPLAMFAVGGMMLFPAANDLITAFVALEV
NUON_RHOOB       AFTPQAFAVPGSVA---EREATRNAPGHTEVFPLTLFAVGGMLLFPASNDLLTMFVALEV
NUON_FRASN       ALVASAAVVPGSRG---STAQRTSPDVQTEAYPLMVFSVSGMLLFVASNNLLVMFVALEI
NUON_MYCA9       SFAAQASSVPGSEP---ERVLNRTGITQTEIFPLTLFAIAGMMLFPACNDLLTMFVALEV
NUON_BEUC1       AFAPQGASVPGSDY---EDRARRAGLVQTEVYPLVLFSVGGMLVFPAAGDLLTLFIALEV
NUON3_STRGG      SFAAQAGSVPGGEG---EKAAVRAGFTTTEVFPLLLFSVAGLLVFPAANDLLTLFIALEV
NUON_SACEN       AFVAESNDTGPAGAGEMTRATAAVAGMRTEVFPLALFALGGMMVFCAANDLLTMFIALEV
NUON_SALAI       AFVAQAAVTAESAD---DRRQAEGRPGATEVYPLTSFAVGGMLIFVAANDLLTMFIALEV
NUON_NOCSJ       AFAGQAAALPGTEA---ERQASTRGLEHTEVYPLMMFALGGMMLFAAANDLLTLFVALEV
NUON_THEFY       AFTGQAAAVPGSEE---ERAHVLAGSQHTEVYPLVMFAVLGMQLFTAANDFLTMFIALEV
NUON_CUTAK       AFVASASSVPGSPL---EAKAEQEHREHTEVYPLLMFAALGMMCFAAANDLIMMFVALEI
NUON_ANOFW       -----------------------RIAYRGEFYYLFLTALLGAMMMASSGDLITLFVGLEL
NUON_GEOSW       -----------------------GLKDRGEFYYLLLCALLGAMIMASSGDLITLFVGLEL
NUON_GEOKA       -----------------------GSPHRGEFVYMMLFALLGAMMMASSGDLLTLFVSLEL
NUON_BACAN       -----------------------PIEDKGEYYYLFLMALLGAMFMASSVDFVTLFVGLEL
NUON_BREBN       -----------------------EVQHRGEYYYLLLTGLLGAMVMASSADLITLFVGLEL
NUON_PAESJ       -----------------------AVTDKAEFYYLLLPAAAGAMIMASSGNLVTLYIGLEL
NUON_DESPS       -----------------------KARFRAEYYIFFFLAILGLMMMVSSLDILSILVALEL
NUON2_OPITP      -----------------------RGEAKPEYFLFLALSMTGLLALVSSIDVITLIIALEL
NUON1_SYNFM      -----------------------DSRYHAEFFLLTTVCTLGMMMLVSANELLTVYVSIEL
NUON2_SYNFM      -----------------------EERNRREFYVLLFVCTLAMMLLVGANHFLVVFISLEL
NUON2_DESMR      -----------------------KD-LTPDYFMLLALSAWGLMLLASCVELITLYLALEL
NUON_BACFR       ------------------------RIKQGEFYVLTLSTLLGMYFMISAGHFLMFFIGLEM
NUON_BACV8       ------------------------RHKQGEFYILTLSTLLGMYFMVSAGHFLLFFLGLEL
NUON_AZOPC       ------------------------LLRQGEFYVIMLISLLGMYFMISAENFVMLYIGMET
NUON1_THEYD      ------------------------LIRFNESIAFILFSALGMMLLVSARELISFFLSFEL
NUON2_THEYD      ------------------------SSKSVEYVFLLLLSLFGMNLMIVANDLLILYLALET
NUON_FLAJ1       ------------------------QTKISDFIAIKVFLLAGAVAMVSFGNLAMFFLGIEI
NUON_FLAPJ       ------------------------KTKISDYVGIKVFLLSGAVAMVSFGNLSMFFLGIEV
NUON_CYTH3       ------------------------EFNQGDHYALILFSTVGGLVLVSFSNMSMLFLGVEI
NUON_LEPBA       ------------------------KTLFPEFFPLMLFCLSGMMFLTSGYDLIVIFVGLEI
NUON_LEPIN       ------------------------KIEFPEFYPLLLFATCGMTLMTTGQDFILVFVALEL
NUON1_AQUAE      ------------------------NSQYGELPYLYLIATLGLMVMISSDNLAIIFTGLEL
NUON2_HYDS0      ------------------------K-TFVENVYTFLLISLGLSIMVSSKNLAVILAGLEL
NUON2_AQUAE      ------------------------KSFYGEFYYILAFTLLGVFVLASTYNLIILYVALEL
NUON1_HYDS0      ------------------------NTFYYEVYYITFLSLLGMMTLSSSYNLIVIYVSLEM
NUON_PERMH       ------------------------KSYYGEYYYIILFALIGMMIMVSSPNLVTFYIGLEL
NUON_CAMC1       ------------------------EYKIYEYYALFLFMIAGFLFMVSSNNLLIIFLGLEI
NUON_CAMHC       ------------------------DCSLAEFYALYLFMIVGYEFMVSSQNLIVILVGLET
NUON_SULDN       ------------------------EFSYPEFFALFLFMIAGFQFMVSTDNLILIFVGLET
NUON_WOLSU       ------------------------EFSYPEYYALFLFMIAGFQFMVSSDHLILIFVGLET
NUON_SULNB       ------------------------EYSYPEFFALFLFMVAGFQFMVASDNLILIFVGLET
NUON_HELAH       ------------------------EFQTAEFYPLYLFIIAGFQFMVSSNHLLLMLIGLET
NUON_HELHP       ------------------------ETQGAEFYALLLFSIAGFAFMASSQNLILILLGLET
NUON_CAMJR       ---------------------------QGEFYALFLFMIASLLLMVSSSNLVLIFIGLES
NUON_CAMLR       ---------------------------KAEFFSLFLFMIASLILMISSTNLIVIFLALEG
NUON_BUCAI       ---------------------------KEEFYLLVIISTLGAISLTISHHMASFFINIEL
NUON_BUCAP       ---------------------------KEEFYLLTLISTLGAIFLTISNHMASLFISVEL
NUON_BUCBP       ---------------------------FEEFYLLLLFCTIGCVSIIISNNLCTFFIGSEL
NUON_BUCCC       ---------------------------SIEFYFFVLLSTIGGMLIIISNHFLSLFLGIEL
NUON1_NITOC      ---------------------------PEEFYVLLLLASLGAAILAASNHFASLFLGLEI
NUON_NITMU       ---------------------------HEALYILLLLAALGGGVLVASSHFASFLLGLEL
NUON2_ACICJ      ---------------------------REEYYLLLLTATLGAAILPASVHFASFFLGIET
NUON_METCA       ---------------------------NEEIFVLLLTSTLGALLLVSSAHLAMFFLGLEV
NUON_PSYA2       ---------------------------KEELYLLMLLSTVGALLMVCAQHLASFFMSLEM
NUON_ACIB5       ---------------------------REELYLLLLASVAGAMLMVASSHYASFFISLEL
NUON_AERHH       ---------------------------REEFYLLLLIATAGGLVLAGSRHLASLFIGIEM
NUON_TOLAT       ---------------------------REEFYLLLSLASTGAMVMAQAHHLAAIFIGVEL
NUON_CHRSD       ---------------------------REEYYLLLLCAAAGGLALVSSRHLAALFFGLEL
NUON_PSEMY       --------------------------NREELYLLILLSAAGGLVLASAQHLVGLFIGLEL
NUON_HAMD5       ---------------------------REEFYLLLLISTLGALVLVSAQHLAAVFLGIEL
NUON_ECOLI       ---------------------------KDEFYLLVLIAALGGILLANANHLASLFLGIEL
NUON_PROMH       ---------------------------KEEFYMLVAIAVIGGILLSSAHHLASMFIGIEL
NUON_BLOFL       --------------------------RSDEFYLLLLIASIGGILLVITNHLIVLFLGIEL
NUON_BLOPB       --------------------------NRDEFYLLLLISSIGGILLATTNHLVILFLGMEL
NUON_BAUCH       --------------------------KPDEFYILLLISTMGGILLTCAHHLTALFLGIEL
NUON_SHEWM       ---------------------------KEEFYLLLLLASLGALGMIVSEHFASFFLTLEL
NUON_RICBR       -----------------------GEPLKFEFITLILLSTVGIFVAISAQNFLLLFCAMEL
NUON_ORITI       -----------------------NLKGHSEYIVLMQLGALGGLILVSANDFMVMYLGIEM
NUON_ARCB4       ------------------------SYFKGEFFSILLFALFGMMVLAQANELITAFIALEI
NUON_PELPD       -----------------------------KYWILIASSLLGAMIILDSAGFISLFMGIEI
NUON_NEORI       ---------------------------SKNFSVLVLLSLLGMLLSVSSSTLASLYLAVEL
NUON_DESAP       -------------------------REQGSFYALFLLAKAGLLGMCATGDLFNLYVFLEI
NUON_CAMFF       -------------------------FYKQEMFALASLAGFGLLAMSLSVELILTLIFLEV
NUON_SALTO       ------------------------ATPVGEYCFLLAASMTGGVALGAAGDLITLIVALET
                                                         .                   

NQO14_PARDE      QSLALYVVAAMR---RDSVRSSEAGLKYFVLGSLSSGLLLYGASLVYGFAGTTGFEGIIS
NUON_JANSC       QSLALYVVAAMR---RDSVRSTEAGLKYFVLGALSSGLLLYGSSLAYGFAGTTQFAGIIE
NUON_AZOC5       MSLSLYVVAAIN---RDSVRSTEAGLKYFVLGALSSGMLLYGASLIYGFTGTVNFAGIAK
NUON_BEII9       MSLALYVIAAFH---RDDVKASEAGLKYFVLGALSSGMLLYGASLIYGFAGTVNFTGIAT
NUON_METNO       QSLAAYVIASFH---RDDVRSTEAGLKYFVLGALSSGMLLYGASLVYGFTGSVSFPGIVT
NUON_PARL1       QSLSLYVIAAFH---RDNTRATEAGLKYFVLGALASGMLLYGASLIYGFTGSVQFGSIAT
NUON_MAGSA       QSLALYVLAAYN---RDNARATEAGLKYFVLGSLASGLLLYGISLLYGFAGTTSFEGLAN
NUON_RHORT       QSLALYVIAAYQ---RDNLKSTEAGLKYFVLGALASGLLLYGMSLVYGFAGTTRFDGLAQ
NUON_RHOCS       QSLSLYVIAAFR---RDYAKSSEAGLKYFLLGSLSSCILLYGASLIYGFSGTTNFERLAV
NUON_BARBK       QSLALYVLAAIH---RDNVKSSEAGIKYFVLGALSSGLLLYGISLLYGFTGQIGFREISS
NUON_RHIEC       QSLALYVVAAIN---RDSLKSTEAGLKYFVLGALSSGMLLYGMSLVYGFTGHTHFTEIAQ
NUON_GLUDA       SSLAIYILCAFA---RDEVRGGEAGLKYFVLGSLASGLLLYGSSLVYGYAGTMEYGGIQM
NUON_GRABC       MSLAIYVLAAFA---RDELRSAEAGLKYFVLGSLASGLLLYGISLIYGFAGTMDFSALRE
NUON1_ACICJ      QSLALYVLAAFA---RHNLRSSEAGLKYFVLGALSSGLLLYGISLVYGFAGTTNFAGIAH
NUON_SPHWW       QSLSAYVLASFM---RRDTRSAEAGLKYFVLGALASGILLYGISLLYGFTGTTLFAGISD
NUON_SPHAL       NSLAAYVLASFM---RSDERSSEAGLKYFVLGALASGMLLYGISLLYGFTGTTDFAGIAA
NUON_ERYLH       NSLAAYVLASFL---RNDTRSAEAGLKYFVLGALASGILLYGMSLVYGFTGTTDFEGVRG
NUON_CAUSK       QSLALYVLAAFR---RDDAKSSEAGLKYFVLGALSSGLLLYGASLIYGFAGSTRFADIAA
NUON_MARMM       QSLALYVLAAFN---RDSLRASEAGLKYFVLGALSSGLLLYGASLVYGFAGSTGFGDIAL
NUON_HIRBI       LSLSSYVLAAFN---RDSRRSAEAGLKYFVLGALASGLLLFGCSLVYGYTGFASFEQIAA
NUON_HYPNA       LSLSSYVLAAFH---RDSARSSEAGLKYFVLGALASGILLYGASLVYGFTGTTSFDGLTL
NUON_PELUB       QSLALYVLASFN---RDQLKSSESGLKYFVLSALSSGLLLYGCSLVYGFSGSTNFNVIGD
NUON_MAGMM       LSLAIYVLAAYK---RDDLASNEAGLKYFVLGSMASGILLYGISLIYGVTGSVDFATINA
NUON_AZOSB       MSLSLYALVAFD---RDSARGTEAAMKYFVLGALASGLLLYGMSMLYGATGTLEISGIAK
NUON_DECAR       LSLSLYAMVAMN---RDSVVSTEAAMKYFVLGALASGLLLYGMSMIYGATGTLEITGIAE
NUON_NITEU       LSLSLYAMVALQ---RESAIATEAAIKFFVLGALASGFLLYGMSMLYGATGTLHLPELAK
NUON_THIDA       LSLSLYAMVALQ---RDSSVATEAAMKYFVLGALASGMLLYGMSMVYGVTGSLALGDIAI
NUON_METGS       LSLCLYALVAMD---RDNPRATEAAMKYFVLGALSSGMLLYGMSMLYGVTGTLDVAEVAN
NUON2_NITOC      LSLSQYAMVALL---RNNRWASEAAMKYFVLGALASGMLLYGMSMIYGATGDLHVAAVAE
NUON_THISH       LSLSLYAMVAFN---RDSARASEAAMKYFILGAIASGMLLYGMSILYGITGSLDIKEVSD
NUON_ACIF2       LALSQYALVAFY---RDSVMATEAGLKYFVLGALASGLLLYGMSLLYGLTGTLDVRDIAA
NUON_ALKEH       LALTLYAMVAFN---RDNLRATEAAMKYFVLGAIASGILLYGMSLIYGATGSLNLAEVAV
NUON_HALHL       LSLALYALVAYH---RDSRQAAEAAMKYFVLGSLASGILLYGMSMVYGATASLELSVIAE
NUON_LARHH       LSLALYALIALS---RESVPATEAAMKYFVLGALASGLLLYGVSMVYGGTQSLHIVAVAQ
NUON_NEIG1       LSLALYALIALR---RDSGFAAEAALKYFVLGALASGLLLYGISMVYGATGSLEFAGVLA
NUON_HERAR       MSLSLYALVAFR---RDNAVAIEAAMKYFVLGALASGFLLYGISMLYGATGSLDLTEVAR
NUON_POLNA       MTLCSYALVALR---RDDAQATEAAMKYFVLGALASGFLLYGLSMLYGATGSLNINEVFN
NUON_BORA1       MSLALYALIALR---RDDVVATEAAMKYFVLGALASGFLLYGMSMVYGSTGHLDLAEISR
NUON_PARP8       MSLSLYAAIALR---RENAPSTEAAMKYYVLGALASGFLLYGISMLYGATGSLELNEVLK
NUON_CUPTR       LSLSSYALVALR---RESRVTSESAMKYFVLGALASGFLLYGISMMYGATGSLNLGEVFR
NUON_POLNS       MALPTYALVAMR---HNSEKSVEAGIKYFILGALASGFLLYGMSMLYGVTGSLDLIEIFK
NUON_RUTMC       LSLSLYALIAIA---RERADAIEAALKYFVLGAIASGLLLYGMSMIYGISGSLNINDIAS
NUON_HYDCU       MSLALYAMVAMR---KDNQHALEAAMKYFVLGALATGMLLYGFSMIYGATGSIQFDEMAQ
NUON_COXBU       LSLPTYAMVALY---RNKTRSVEAGMKYFVIGAIASGMLLYGMSMIFGATQSLDLTEIAK
NUON_LEGPL       MSLPLYAMTAIR---RTDSDASEAAMKYFVMGAIASGMLLYGISLVYGATGKLDLLDVAN
NUON_XANC5       LALCSYALVASN---RDNGLATEAAMKYFVLGSLASGLLLYGMSLVYGATGTLSLAGIHD
NUON_FRATF       LSLPMYALIAIY---RDSGKGLEAAIKYFVLGAIASALLLFGMSFVYGMTGKLDITEIAN
NUON_EHRCJ       QSITLYALTCFD---KSAIKSSESGIKYFVLSALSSCIMLYGISMLYGYTTQVGFSGIYN
NUON_WOLTR       MSIPLYVLASFN---KDSVYSCEAGVKYFTLSALSSCIMLYGMSLLYGYTGLVNFSELSS
NUON_ANAPZ       IGFASYILVCFN---RSSIKASEAAIKFFVLGALSSCIMLYGISLVYGYASEFSLGVVSK
NUON_ANAMF       NSLSSCVLVCFN---RSSERASESALKFFILSALSSCIMLYGISLVYGYSTGLECNVMQE
NU2C_NOSP7       LSISSYLLTGYT---KRDPRSNEAALKYLLIGASSTAVFLYGVSLLYGLSGGQTELSAIA
NU2C_SYNJB       LGIASYLMAGYT---KRDPRSSEAALKYLLIGASSTAIFLYGMSLLYGLSGGQTKLEAIA
NU2C_GLOVI       LSITSYLLSGYA---KLDKRSNEASLKYLLIGAASSGIFLYGMSLLYGFSGGQTQLTEIA
NU2C_PROMA       LSVASYLLAGYL---KRDARSSEAALKYLLVGSAAAAVFLYGASLLYGLSG-STSLESIG
NU2C1_ARATH      FSLCSYLLSGYT---KKDIRSNEATMKYLLMGGASSSILVYGFSWLYGSSGGEIELQEIV
NU2C1_COFAR      FSLCSYLLSGYT---KKDVRSNEATMKYLLMGGASSSILVHGFSWLYGSSGGEIELQEIV
NU2C_ADICA       LALSSCFLSGYT---KRDMRSNEATMKFLLMSGASSSLLLYGFSLLYGLSGGQLQLDKIV
NU2C_CHAGL       LGLSSYLLAGYS---KQDIRSNEAAMKYLLVGGASSAILAYGFSWLYGLSGGKIILSEIV
NU2C_CHAVU       LGLGSYLLTGYV---KKDIRSNEAGMKYLIIGGTSSSIFAYGLSWLYGLSGGSIYLKSIA
NU2C_STAPU       LSLSSYLLAGQA---KKDIRSNEASLKYLLMGGASSSILVYGFSWLYGLSGGELQLSKIV
NU2C_CHLAT       LGLSSYLLTGYM---KKDLRSNEAAIKYLLIGAASSSILLYGLSLLYGLSGGAIEISTIA
NU2C_NEPOL       LGLASYLLTGYM---KRDVRSNEASLKYLLVGAASSGLFLYGISWMYGISGGHMELNSIA
NUON_ANADF       VSMVSYVLAGFR---KGDRKATEGSLKYVIYGGVASGVMLFGMSYLYGLTGTTSLHELGA
NUON2_SORC5      VSVISFVLAGFK---INDAKSSEAALKYVIFGGVASGIMLYGMSWIFGITASMRLDECAA
NUON_CHLCH       VSFTAFILAGYF---KSNMRSSEAALKYLIYGAVSSGLMIYGFSLIYGVTAQTNLIAISR
NUON2_CHLT3      VSIISYILVGYL---KGQVRSSEAGLKYVIYGSVSSGLMIYGFSIIYGLTGETNIFAINE
NUON_CARHZ       MTITFIILAAYR---RDSAIGAEAGIKYLILAGVSSAILLYGLSLFYGLTRTLNIVDIAA
NUON_DESRM       MTISFVILVAFR---SFEAKSLEAGMKYILLAGLSSAVLLYGLSLVYGATGTILIGEVAR
NUON_DESHD       MTITFYILVAYH---PNDPKSSEAGIKYLVLGAASSAVLLYGISLIYGLTGSTQMFTVAM
NUON_HELMI       MTITFFILVAYI---LGDGRSSEAGVKYLLLGGASSAVLLYGLSLLYGLTGTTVIPDLLA
NUON_CLOB8       MTISFCVLIAYK----GDDKSKEASLKYLILSAMSSAIFLYGLSLIYGITQTTAIKEIAE
NUON_MOOTA       MTITFCILAAFH---LGDAKSAEAGIKYVLLGAMSSAIFLYGLSLVYGSSGTTVIREIGQ
NUON2_SYMTH      TSISSYVLAGIL---RKDAKSNEAALKYFLTGATASAVLLFGLSLIYGVTGSTRLPEVAA
NUON_DEHMB       AGLAFYVLVGFL---KDQHSS-ESALKYLLLGGVASAMLVFGLVLIYGFSGETNLGSILN
NUON_METI4       VTVSFYVFVAFQ---REFPSALEAGVKYLIIGALASSFLVMGIAFVFGITGST-------
NUON1_OPITP      LTVGLYILVSYF---RTSPLSLEAGLKYLIMGALSSSLLLFGIVLLYGVAGNPALEGHTA
NUON_RUBXD       ATIPSYAMVAFD---RRRRESAEGGMKYLITGVIASSFLLYGIVLIYGVSGSA-------
NUON_RHOP5       ISLSLIALFAFP---LTGMAL-EASYKFLVMSGLATSAQLLGVALIYAE-------TGAL
NUON_RHOS5       ITLALVALFVLP---LDRPAL-EAGYKFLILGAAAAATLLMGLALGHAA-------TGSL
NQO14_THET8      LSLPLYALATWR----RGQGL-EAALKYFLLGALAAAFFLYGAALFYGA-------TGSL
NUON1_STRGG      ASVPFYALAGWA---KQGRAT-EAALKYYLAGALAGVTTAAGVTILFGV-------AGAT
NUON_MYCSJ       ASIPLYGLVGLA---RSAAAA-EAAMKAYLMGALFGILLMLGVTILYGL-------TGAT
NUON_DEIRA       MSLASYVLATLQ---DSRRSQ-EAGLKYFLLGSVGSAILIYGLAFLYGA-------TGTL
NUON_GEOMG       LTFAFYILVAYD---HNRPASGEAGLKYLLMGAVSAAFVAFGIALLYGA-------TGTL
NUON_GEOUR       LTFAFYILVAID---LNRAESAEAGLKYLLLGAISAACIAFGIALLYAA-------AGTL
NUON_GEOBB       VSFAFYILVTMD---LQRAESGEAGLKYLLMGAVAAAFTAFGFALIFAG-------SGTL
NUON_PELCD       MTLAFYVLIAVD---RENPTGAEAGLKYLLPGFLASALLAFGIALVYAA-------TGTF
NUON1_DESMR      ASLCLYALIAAR---LDDNLGTEAALKYFLPGAMALAVLLFGMALIYAA-------SGSM
NUON_PARUW       LSISLYVLCGYM---KKWEISHESSFKYFLMGSIVAGFLLYGIALVYGA-------IGTT
NUON1_SYMTH      LSLALYVMIAFA---PKRMAAREAAFKYFVLGSVAAAFLIFGFALIYGA-------AGTM
NUON_CHLSY       TSIPLYLLAGYF---RNDPRSAEAGLKYFLFGAISSAILLYGMSLAFGA-------ALNA
NUON1_ROSCS      SSLSLYVLAGYF---RESERSPEAGLKYFLFGSLSSAIFLYGISLTYGF-------VASE
NUON2_HERA2      TSIPLYVLAGYF---RRNPVSTEAGAKYYIFGALSSAILLFGMSLLLGL-------TLMN
NUON2_ACIC5      LSLVLYILTAFN---KHSRASAEAALKYFLFGGMSAGFLLFGISLLYGV-------SGSL
NUON1_KORVE      MALSTYVLVGFLK--RDKR-SNEAALKYLLLGAFSSGIFAYGLSLFYGL-------TGST
NUON2_SOLUE      MALCFYVMVGFLR--TERR-SNEAALKYLLLGAFSSGFLVYGFSVMYGI-------AGST
NUON2_RHIME      MVLCTYVLTGFLR--KERR-SNEAALKYVILGAVSTAIFLYGVSLIYGL-------TGTT
NUON_THERP       SAVAVYALTAFAR--RRVT-SVEGALKYFLLGAFASAILIYGMAWVYGS-------TGSI
NUON_DESDA       MALPIYALVALRT--ADPR-SSEAAIKYFLMGSFASALLLFGLSILYGL-------TGQT
NUON2_KORVE      SSIGSYVLAAMR---RRVAESAESSLKYFLLGSFATAFFLYGVALIFGA-------TGST
NUON1_ACIC5      SSIATYILAGFR---RRSAKGPESAIKYFLLGSFATAFFLYGIALTYGA-------TGTT
NUON1_SOLUE      SSIASYVLAGYL---RDDKRANEAALKYFLLGSFATGFFLYGVAWIYGL-------TRSV
NUON_ANAD2       MSLSTYCLAAFL---RRGKKPAEAAFKYVVLGSISSALLLYGSALLYGA-------SGST
NUON_MYXXD       LSLSTYALTSYL---RRGTRPSEAGFKYFILGAFSSAVLLYGAALLYGA-------TGTT
NUON1_SORC5      MSLGAYALTGFR---RTSPRSTEAAIKYFLLGSFAAALLLYGGALIYGA-------TGHT
NUON_CHLAD       LSITLYILTGFA---YPRLTSEEAAMKYLVLGAFAAGFFVYGIALIFGA-------TGST
NUON2_ROSCS      LSIVLYVLTGFA---YPRNASEEAGMKYLLIGAFAGGFVVFGIALLYGA-------TGSM
NUON1_HERA2      LSIALYVLTGFA---VPQFKSGEAAIKYLLLGGFAAGFLVYGIALIYGM-------TGKT
NUON1_CHLT3      MSIALYVLAGIM---RDDQRSNEAAIKYFLLGAFASGIFLYGIALIYGA-------TGTL
NUON_GEOLS       MSISLYVLAGFN---RDSIKSNEAGMKYFLLGAFSTGFLLYGMALIYGV-------TGTT
NUON_SALRD       MSVCLYVLTGFI---REDEGAVESALKYFLLGAFSTGFFLYGIALMYGA-------TGTM
NUON_GEMAT       MSLAVYVLAGVN---RRSARSAEAAVKYFLLGAISSGFLLYGMALLFGA-------TGST
NUON_BDEBA       MSLALYLMIAMS---HEEKLSKEAALKYFILGSFASAIFLYGVAFIFGS-------TGGT
NUON_ACIC1       LSLPLYLLAGMAR--RRRLLSQEAAVKYFLLGAFSSAFFVYGLALVYGY-------AKSV
NUON_RHOOB       LSLPLYLLCGLAR--RRRLLSQEAALKYFLLGAFSSAFFLFGVALLYGY-------AGTV
NUON_FRASN       LSLPLYLLCGLAR--RRRLLSQEAAMKYFLLGAFSSAFFLYGVAFAYGY-------AGSV
NUON_MYCA9       FSLPLYVMCALAR--RRRLLSQESALKYFLLGAFSSAFFLFGSAFVYGY-------AGTV
NUON_BEUC1       LSLPLYLLSGLAR--RRRLLSQEASMKYFLLGAFSSALLLFGIALLYGY-------SGSV
NUON3_STRGG      FSLPLYLLCAVAR--RKRLMSQEAAVKYFLLGAFSSAFLLFGIALLYGY-------AGSL
NUON_SACEN       LSLPLYLMCGLAK--RRRLLSQEAAVKYFLLGAFASAFFLYGLALLYGY-------AGSV
NUON_SALAI       LSLPLYLLCALAR--RRRLLSQEAAMKYFLLGAYASAFFLFGVALVYGYTAGVPDRAAGV
NUON_NOCSJ       LSLPLYLLSGLAR--RRRLLSQEAALKYFMLGAFSSGFFLYGAALVYGF-------SGSM
NUON_THEFY       MSLPLYLLCGLAR--RRRLFSQEAALKYFLLGAFSSAFFLFGIAMVYGY-------AGAV
NUON_CUTAK       FSLPLYLLCGMSR--RRRLLSQEAALKYFLLGALSSALFLYGIVLLYGC-------AGSF
NUON_ANOFW       LSISSYILVAIR---KKHTLANEAALKYVITGSIATAITLFGMSYIFGFTGSTNIKEIAV
NUON_GEOSW       LSISSYILAGIR---KTSMQANESAMKYVINGGISTAITLFGMSYIFGLTGTTNIKEIAL
NUON_GEOKA       LSVSSYILAGLR---KTAPASNEAALKYVINGGIATAIMLFGMSYVFGLTGTTNLGGIAR
NUON_BACAN       LSLSSYILVGIR---KKNRASNEAAMKYVINGGIGTAITLFGMSYLYGITGSTNIVDMQK
NUON_BREBN       LSLSSYVLVGLR---KKSRLSNESAFKYVVSGSIATAVLLFGMSYVYGLAGTTHIYEISF
NUON_PAESJ       LSITTYVLVGLR---KRSSLSAEAAFKYVVTGGIASAFVLFGMSYLYGVTGSVSLADFPT
NUON_DESPS       SSFSTYIMVALR-EDNPRGIHNEAAIKYLLYGVTATAFMLFGMSYLFGLTGSIQLAPLAE
NUON2_OPITP      SSFPLYLMVAMRREREGQRVQMESAIKYIMFGIAANGVMFFGFGYLYGLTGSTSLPVILE
NUON1_SYNFM      SSYSLYLLVPMR---KQTEIYVETGIKYFMIGVTASAFMLFGISFIFGVAHTTYVPDLVK
NUON2_SYNFM      SSYSLYVLVALR---RDRGLGLEAGIKYFLVGIFASGVMIFGLALLYGASGIAALDGMAR
NUON2_DESMR      SSYSLYALIPLR---GQDRRAAEAGIKYILFGAAVTALALFGLSYIIAAKHTTYLSGLAA
NUON_BACFR       ASIPMAALVAFD---KYRHHSAEAGAKYILTALFSSALLLFGLSMIYGT-------SGTL
NUON_BACV8       ATVPMACLVAFD---KYKGHSAEAGAKFILSALFSSGIFLYGISMIYGT-------AGTL
NUON_AZOPC       ASLPLACLVAFD---KYQEKSAEAAVKYILTSALSSGVMLFGLSFLYGS-------LGSF
NUON1_THEYD      MSLSIYVLVGIR---RYDVKSNEAAVKYFMLGGFSSAIMLFGIAFIYGA-------TNTT
NUON2_THEYD      FSLSLYILAGFY---RKESLSIEAGMKYFILGTLSSIILLGSIVFFYAQ-------TGST
NUON_FLAJ1       LSIALYVLAASD---RLNIKSNEAGMKYFLMGSFASGIILFGICLIYGA-------MGTF
NUON_FLAPJ       LSISLYILAASN---RLNLKSNEAGMKYFLMGSFASGIILFGICLIYGA-------TGSF
NUON_CYTH3       LSIPLYILAGSR---KKDLHSVESSIKYFILGSFATGIMLLGIALIYGA-------TGSF
NUON_LEPBA       LSLSLYVMIGMA---RTSVSALESAMKYFLLGTFSSGFMLLGIAFLYGG-------SGTT
NUON_LEPIN       MSICLYILIGMA---RSDLFSLEATLKYFLLGSFSSGFMLMGIAFLFGG-------SGST
NUON1_AQUAE      ASITMYILVGLF---RREYLSKEGAFKYLVIGTTGTSMYALGSALVYAS-------SGSM
NUON2_HYDS0      ASISMYISVGML---RDDYISKEASFKYLVLGSMTTAFFGIGSAFYIGA-------TSHL
NUON2_AQUAE      VSVGFYILTALL---RGSTEAKEGAFKYLILGGLSIALASYGAAFMYIY-------SGSL
NUON1_HYDS0      VSISFYIMTALF---RGSFISKEGAYKYLIIGGISIIIALYGAAFMYGA-------SKSL
NUON_PERMH       SAVSIYILAGTF---RKDYRSKEGAFKYLIMGGMGTAIISYAIALIYGR-------TGSF
NUON_CAMC1       SSLCLYTLIALH---NKAK-SVEAAIKYFAMGSLSAGFFAMAIAMFYLA-------TNSI
NUON_CAMHC       SSLALYTLIALH---NRTR-AIEAAIKYFTMGALSTGFFCFAIVIFYLS-------SASL
NUON_SULDN       ASLALYTLIAMH---NRDK-SFEAAVKYFTMGALAAGFFSFGSMVFYAL-------TGSV
NUON_WOLSU       ASLALYTLIAMH---NRQS-AFEAAIKYFTMGALAAGFFTFGSMLLYVA-------SGTL
NUON_SULNB       ASLSLYTLIALH---NRSN-SYEAAVKYFTMGALAAAFFAMGSAVIYAL-------TGSI
NUON_HELAH       ASLPICVLMALS---GKRY-GLEAGIKYFTMGAMASAFFAMGAMAFYLL-------TGSL
NUON_HELHP       ASLCLYALIALH---NQKS-AFEASIKYFIMGALATTFYAFGAMLLYAA-------TGSV
NUON_CAMJR       SSLALYTLIAMR---GSDN-AISSAIKYFSIAAVGAGFFVMAVAFIYLK-------TGTL
NUON_CAMLR       SSLALYTLIALR---GTHN-AISSSIKYFTLAAVGAGFFVFACAFVYLK-------TKSL
NUON_BUCAI       ISLPMFGLIAYS---RYQKYSLESSLKYIILSGVSSSFLLFGIAWVYSISGGLDFLSIHK
NUON_BUCAP       MSLPIFGLIAYS---NSQKYSLEASFKYLVLSGVSSSFLLLGISWIYAISGNLSLLCLNQ
NUON_BUCBP       ISLSSIGLISYT---FFEKKALEASIKYMVLSGIMSTLLLFGIALIYSVSGSLEFSSIIY
NUON_BUCCC       LFLPILGILNFF---SNSRKNLFSIVNYMILSVFSSALLLLGVSFIYFVSGRLSFSFFPL
NUON1_NITOC      LSVSLFALLAYP---RRFQLSLEAGVKYLILSSASSALLLFGMALIYAETGALGFGQLST
NUON_NITMU       LSISLFALIAYP---RFTEHPLEAGIKYLILAGFSSGLLLFGMALVYAQLGTMQFVKIGT
NUON2_ACICJ      LGISLLGLIAYA---GPRGSAAEAGTKYLILSGAASAFLLFGMALIYAAFGSMSFARIGA
NUON_METCA       LTISLFPMIAYS---VRASRPLEAGIKYLMLSGLASSFLMFGMAMVYGDLGVLSFEQIGA
NUON_PSYA2       LSIPLYGMLSYT---YMRTRSLESGLKYLVLSATASATLLMGMAFIYAEVGSLAFKPISL
NUON_ACIB5       MSIPVYGLLAYT---YQRSQSLEAGIKYLVLSATASAMLLMGMAYIYAYTGSLSFYDSVQ
NUON_AERHH       LTLPMFGLVGYA---YRERHSLEASIKYMVLSAAATAFLLFGMALLYAQAGSLSFSDLGL
NUON_TOLAT       MSLPLFGLVGYA---FRQRRSLEAAVKYMVLSASATAFLLFGIALIYAQVGSLDIATIGA
NUON_CHRSD       LSMPLYGMLAYT---YRERGALEAGIKYMVLSAAASAFLLFGMALLYSRTGHLDFAGLGE
NUON_PSEMY       LSVPTYGMIAYA---FFNKRSLEAGIKYMVLSAAGSAFLLFGMALLYAEAGDMGFRAIGA
NUON_HAMD5       IALPLFGLLGYA---YQQNRSLEASIKYFVLSAAASSFLLFGMAMLYAQTGGLSFTSLGN
NUON_ECOLI       ISLPLFGLVGYA---FRQKRSLEASIKYTILSAAASSFLLFGMALVYAQSGDLSFVALGK
NUON_PROMH       LTLPLFGLIGYA---FQQRPSLEASIKYMLLSAAASSFLLFGMALLYAEAGNLSFTAMGQ
NUON_BLOFL       ISISICGLISYP---VFSKKSIELSIKYIILSGVSSSFLLFGIVFIYCKTGSLSFIDIKE
NUON_BLOPB       ISLPLFGLIGYS---FFNKFSLEASIKYIILSGVSSSFILFGIALIYAATGFLSFTSISQ
NUON_BAUCH       MSLPLLGMVGYT---YRKKKVLEACIKYTIISSVASSFLLFGIALVYAVTGQLSFIGISN
NUON_SHEWM       MSLSFVGLIAYS---HSQLSSQEAGVKYLILSAVASAFMLMGIAIVYLQTGNLSFQYLAD
NUON_RICBR       TALTSYILAGFK---LSDIKSSEGALKYFILGSLVSCLSLFGISFIYGFGGSLQFSDIFY
NUON_ORITI       QGIIGYILTTFN---YNNSRSSEAGLKYFILGTVFSAIMLFGISLVYGTTQSIRYDIALH
NUON_ARCB4       ASFSIYIMVGYN---SDDSKRVEAIFKYLVLGSFIGAFYLLGMVLVYGATTSTNLADVST
NUON_PELPD       LSLPGFALMVLN---NGKSTASEGSIKYLLLSSVATALVLFGLSLVYGSTGNLNISSFTA
NUON_NEORI       HSIGQYILACIK---HKSIKSAEAGVKYTLLGTFMSAVMIYGISLIFVVSGDLSLKSLFI
NUON_DESAP       SSLAAYALIAFG-----GRRSIVAALRYLIIGTAAACFYLLGVGYLYAMTGSLNMADLAV
NUON_CAMFF       ASISIYAMIAMN---SIEYKSVEAAFKYFLLSSFMSAFYLLGAAFVFGVAGSTKYSFIAT
NUON_SALTO       LTLPLYVLVGLR---RGSLASIEAAVTFFVVSVVATTLTLLGAALLYATTGALHLGRLGA
                                                .         .                  

NQO14_PARDE      TIEAGHLSL-------------------------GVLFGLVFMLVGLSFKVSAVPFHMWT
NUON_JANSC       AAQGGDMPL-------------------------GLLFGLVFITAGLAFKVSAAPFHMWT
NUON_AZOC5       VATAPTT---------------------------GLVFGIVFLFAGLCFKVSAVPFHMWT
NUON_BEII9       ALHGETSL--------------------------GVVFGLVFLTAGLAFKMSTVPFHMWT
NUON_METNO       ALREAHAGL-------------------------GLVLGIVFVAAGVAFKLAAVPFHMWT
NUON_PARL1       VLQADGTNI-------------------------GVIFGIVFVLAGLAFKISAVPFHMWT
NUON_MAGSA       LFAGGHDHPIKPN--------------------MGIIAGLVFVLAGLSFKVSAVPFHMWA
NUON_RHORT       VAAAEGGI----S--------------------TGLLIGIVFIIAGLAFKVSAVPFHMWA
NUON_RHOCS       MFSSDVPA----A--------------------TGVVVGLVFVAAGLAFKISAVPFHMWT
NUON_BARBK       ALN-GNILH------------------------LGVIFGIVFILAGLAFKISAVPFHMWT
NUON_RHIEC       ALSVEGARS------------------------LGLIFGLVFILAGIAFKISAVPFHMWT
NUON_GLUDA       ALSTSSTAVPM-----------------------GLMFGIVFMLAGLTFKLSAVPFHMWT
NUON_GRABC       ALAHPAGTSP------------------------GLTVGVVFVIAGLAFKISAAPFHMWT
NUON1_ACICJ      ALAGHPTAAV------------------------GSTIGLVFVLVGLAFKISAAPFHMWT
NUON_SPHWW       SLAKGMGT--------------------------GQMFGMVFVFAGLAFKISAVPFHMWT
NUON_SPHAL       AMGGEPGI--------------------------GLIFGIVFVLSGLGFKISAVPFHMWT
NUON_ERYLH       ALTGDMST--------------------------GALFGVIFVLAGLAFKIAAVPFHMWT
NUON_CAUSK       VGAAAAHGTHG----------------------VGLLFGLVFLICGLAFKVSAAPFHMWT
NUON_MARMM       AVESGSN--------------------------IGLTVGLVFVICGLAFKVSAAPFHMWT
NUON_HIRBI       ADQS-----------------------------IGLTFGLVLILMALSFKASAAPFHVWT
NUON_HYPNA       AGES-----------------------------VGAMFGMVLMIVGLAFKISAAPMHVWT
NUON_PELUB       LMNSSHY---------------------------GLTFGIVFILVGLAFKISAVPFHMWA
NUON_MAGMM       YLQQDHHSM------------------------LGITMGLILVVSGLSFKIAAAPFHMWA
NUON_AZOSB       SVY-NQAAND-----------------------TVLLFGLVFLMAGICFKLGVVPFHMWI
NUON_DECAR       RLY-GGGVNK-----------------------SVLVFGLVFLVAGLAFKLGVVPFHMWI
NUON_NITEU       VIH-SGQADH-----------------------EIFIIGLVFVVAGIGFKLSAVPFHMWA
NUON_THIDA       VLQ-DGTDLR-----------------------IPLVFGIVFVVAGLAFKLGAVPFHMWV
NUON_METGS       ALL-QGAPDH-----------------------AVLVLGVVFLIAGLGFKLGAVPFQMWV
NUON2_NITOC      GI--GGSGSS-----------------------QVLVFGVVFIVVGLAFKFGAVPFHMWL
NUON_THISH       YLITSGAGLN-----------------------VPLVFALSFVIVGLAFKLGAVPFHMWV
NUON_ACIF2       DLV-NMTAGN-----------------------LVLVFAIVFIAAGIAFKLGAAPFHMWL
NUON_ALKEH       YAG-EQGAND-----------------------WLLLLGMTLVVVGVAFKFGAVPFHTWM
NUON_HALHL       VAG-RH-SDP-----------------------LMLLFGVVFMLVGVAFKLGAAPFHAWV
NUON_LARHH       SIA-SGNANV-----------------------TLVSLGLVFIVAGLAFKLGAVPFHMWV
NUON_NEIG1       SSF-NEEANE-----------------------WLLKLGLVFIVVAVAFKLGAVPFHMWM
NUON_HERAR       VIA-TGAVNK-----------------------PVLIFGLVFVVAGLAFKLGAVPFHMWV
NUON_POLNA       AIA-SRQVKH-----------------------QVLVFGLVFIVAGLAFKLGAVPFHMWL
NUON_BORA1       VIG-SGQAKE-----------------------LPLVFGIVFLVAGLAFKLGAVPFHMWV
NUON_PARP8       AVA-SGRIND-----------------------VVLLFGVIFIVAGVAFKMGAVPFHMWV
NUON_CUPTR       AVE-SGRINT-----------------------TMLAFGVVFIVAGLSFKLGAAPFHMWI
NUON_POLNS       VVA-DPRVNH-----------------------LVMAFGLVFIVAGLAFKLSVVPFHMWV
NUON_RUTMC       FASNTNLDSRE-T--------------------LIINFGLVFLVIGIAFKLGAVPFHMWV
NUON_HYDCU       IIASGNVDN------------------------VVLSFGVVFIVIGLAFKLGAVPFHMWV
NUON_COXBU       AVSATPLHQN-----------------------LILVFGLVFIVAGVAFKLGTAPFHMWV
NUON_LEGPL       AVAVNWQQQN-----------------------TLFAFAMVFILAGVGFKLAAVPFHMWA
NUON_XANC5       AIEGSNER-------------------------TLLLTGTIFMIAGVAFKLGAAPFHMWL
NUON_FRATF       VLAHGNFAGLQ-Q--------------------QFLLVYLVMMIATFLFKLGAFPFHMWL
NUON_EHRCJ       FFSNNEN----IP--------------------LGAILGVILILISIFFKLSASPFHMWV
NUON_WOLTR       FLENHQ-----MT--------------------YGIVFGLVLILIGLCFKLAIAPFHMWA
NUON_ANAPZ       VLGGEE------S--------------------LGATFGCALVLVGLLFKLGAVPFHMWI
NUON_ANAMF       ILAGRA------S--------------------LGATLGCAFVLVGVLFKLAVVPFHMWA
NU2C_NOSP7       NGIATAK----------------------VGQSLGLVIALVFAIAGIGFKISAAPFHQWT
NU2C_SYNJB       SSMGDA--------------------------GLAGIIALVLCIGGIGFKLAAVPFHQWT
NU2C_GLOVI       PRIVNL--------------------------GFPALLSLVLVAAGICFKLSAVPFHQWT
NU2C_PROMA       IALQTS-------------------------PTPLAALALVFILATVAFKIAAVPFHQWT
NU2C1_ARATH      NGLINTQMYNSP----------------------GISIALIFITVGIGFKLSLAPFHQWT
NU2C1_COFAR      NGLINTQMYNSP----------------------GISIALIFITVGIGFKLSPAPSHQWT
NU2C_ADICA       DGIIFNRYGSI------------------------IYLSAAFTTAGTAFKLSLFPFHQWT
NU2C_CHAGL       DGLIFADFVNP----------------------LIKWITLTCIIVGLGFKISAVPFHQWT
NU2C_CHAVU       YSFSHLNPSYS----------------------LASWFAYICIIVGIGFKLSLVPFHRWS
NU2C_STAPU       NGISSQDIYLSSA----------VSLDGKTFGALGLWVAFVCILVGIGFKISAVPFHQWT
NU2C_CHLAT       KNIVDKGLSQS----------------------FASWVALIFITVGIGFKVAAAPFHQWA
NU2C_NEPOL       HAIVSLDETKT----------------------TTCALALVLMTVGVGFKVAAAPFHQWT
NUON_ANADF       QLQALQAGSAVSV----------A------ATRVALVVAIVFVTAGIGYKVAAVPWHMWC
NUON2_SORC5      RIAALTAQQG--------------------KVPEVVFVGTAFMLAGFGYKISAAPFHMWT
NUON_CHLCH       ELALHGADSF------------------------VMLFAALLVLAGFGYKIGAVPFHFWA
NUON2_CHLT3      FLKHNEVDSI------------------------TLMLGSLLILGGFGYKAGVVPFHFWS
NUON_CARHZ       IVTNNGISPA-------------------------FVLAMVFVLAGFAFKISAVPFHMWA
NUON_DESRM       EIADKGSTPL-------------------------LIVGVVMLVAGLGFKISAVPFHMWS
NUON_DESHD       SLG-AEANTV-------------------------TILATVMMLAGFGFKISLVPFHMWA
NUON_HELMI       RL---TWSPA-------------------------LAIAVVTIIAGFGFKISAVPFHMWS
NUON_CLOB8       ALVTGQIAPL-------------------------EILGMIFLIAGFAFKIAIVPFHMWA
NUON_MOOTA       AVATRGASPA-------------------------LLLGTIFILAGFAFKVTAVPFHMWS
NUON2_SYMTH      ALAGGSHVVAAAG----------P------ALTPLLVAGMAFLMVGFGFKVAAVPVHQWA
NUON_DEHMB       YI---QTLPSGMD----------I------TAHTGFILGIILTITGLGFKVAAVPFQFWA
NUON_METI4       ---QFDEVARFAQ----------NNP-----VNGPLILGLVFILVGLGFKASAVPFHVWT
NUON1_OPITP      DPMNFAALTRFLA----------LNP-----DNFLAAAGIVLVLSGIAFKIGAFPFQIWI
NUON_RUBXD       ---NLSRVAEAFG----------EG------LSPVAIVGLVLMISGLAFKVSAAPFHFWT
NUON_RHOP5       DFPGWV------------------------GHGPLFALGTALLLAGLAFKFSLAPFHMWT
NUON_RHOS5       ALEAFG------------------------GREALLTFAAALLLAGLAFKLALVPFHMWT
NQO14_THET8      VLGAP-------------------------GEGPLYALALGLLLVGLGFKAALAPFHFWT
NUON1_STRGG      DYEKVAD----------------GISR---GPAAAAAVGLIAVLAGLAFKAGAVPAHFWV
NUON_MYCSJ       RYPQLAM----------------TLSG---APAVAVAAGVVGVLAGLMFEAGGVPAHFWV
NUON_DEIRA       NYAGIAQ----------------QVSALDPQNIGILVTGTLLVLSGFGVKIALVPFHQWT
NUON_GEOMG       EISRAVA----------------ASAA-GGG---IALAGWGLLLAGLAFKISLAPAHLWT
NUON_GEOUR       AIPEVVR----------------LTLS-AGAQDPIALAGWGLLLIGIAFKISLVPAHHWT
NUON_GEOBB       ELAGAVP----------------HADN-RAI----VAAGWGVVIMGMAFKLSLVPAHLWT
NUON_PELCD       ELSAAIS----------------LSMA-GAPMPSIALLGWTLIMAAAAFKASLAPFHLWT
NUON1_DESMR      EIAASLA----------------APGP-LTA------AGLALVLVGVGFKLSLAPVHLWT
NUON_PARUW       RLDVLLS---------------SYQTISLTTEKVLFFSGIAMITLGLAFKAALVPFHTWS
NUON1_SYMTH      SLTGIAAAAR------------SFTSEGAWSVGLYYKVGVGLAIVGLAFKMALVPFHIWA
NUON_CHLSY       ----VGGATNF---NDL-TRFDR-IGAFTGSSGGLLTLAMLFIVAGMGYKLAVVPFHGWS
NUON1_ROSCS      NQK-AGGAPII---ATLFSEVGR-FATGDAAGSPLLILGMLFIIAGLGYKISVVPFHTWA
NUON2_HERA2      GQTMTTTPTSL---RSVATAVELAFANPEGPSQGVAILALLFILAGMAYKVAIVPFHAWS
NUON2_ACIC5      DLQ--------------------QIALAASQPDSLLLVAIVLVILGFGFKIAAAPFHLWA
NUON1_KORVE      NLT-----------EIANKLAQRM-A--DNPRDPIALLALITTATGLLFKIAAVPFHQWA
NUON2_SOLUE      KLS-----------DIAAAIASR------PPWDPMVFLALSTTSVGLLFKVSAVPFHMWA
NUON2_RHIME      QLD-----------RMAEAVSGG-------PLDPALLLAVVFIVAGLVFKIGAVPFHMWV
NUON_THERP       VLR-----------DIAETLRTVV-MP-GQPLDPALLLALLLLAVGLGFKIAAVPFHMWT
NUON_DESDA       DIA-----------EMAHRLAVSL-SVSDMHTLPAAVVALGLVLAGLGFKVATVPFHVWA
NUON2_KORVE      NVY-----------TIAAALQ------NMHPLQPIIYLAVALMFIGLGFKVAAAPFHVWT
NUON1_ACIC5      NIP-----------DIAAALL------TSHAL-PLAVVGLSFILIGLAFKVSAAPFHLWT
NUON1_SOLUE      NLS-----------VVRGVFQ------HQPVDPTFVGIAAALMFVGLAFKVSAAPFQIWA
NUON_ANAD2       LFS-----------VLPRGQGS-----ALY------LAGIALVAGGVAFKIAAVPFHAWT
NUON_MYXXD       HLT-----------AMAGPLST-----AMSSQPGLVYAGIILVITGFAFKVAAVPFHMWT
NUON1_SORC5      DLA-----------GIGEAIAG--AKGAAAPNPALLLIGAALVLVGLAFKVSAVPFHMWT
NUON_CHLAD       RLG-----------EIGAYAA--S-RGIGDLNLTLLLGGAAMVLIAFSFKVALAPFHMWT
NUON2_ROSCS      NLR-----------AIGETLA--Q-QTLTLEERIYLLAGAALVVVGFGYKVAMAPFHMWA
NUON1_HERA2      NLA-----------QIANELSTWQ-STGKALDDPILLAGVGFVLIALGFKVSMFPFHAWT
NUON1_CHLT3      YIP-----------QISDHLA-----KNG--FDTLFLSGIALLMIGLLFKVAAVPFHQWS
NUON_GEOLS       RVA-----------KIASLVT-----QVGGASNTMLLIGMFLMLTGFLFKIAAAPFHMWT
NUON_SALRD       ALP-----------AMAAAEL-----GTL-STRLLFWGGFALFLVGFFFKVSAAPFHMWT
NUON_GEMAT       RLQ-----------DITEWAA-----AQA-TLSPLFMSGVALLLVGLAFKVAAAPFHLWT
NUON_BDEBA       NIL-----------SFMDNAA------ELVQTSRLFLFGVTFVILGFCFKVSIAPFHAWT
NUON_ACIC1       EYG-----------DIATALTAS------DRGDSLIIVGLALIGISLLFKLSGVPFHWWT
NUON_RHOOB       ALP-----------GIADALARG------TEDRTLALIGTALLSVGLLFKIGAVPFHSWI
NUON_FRASN       ELG-----------RVADAVGTV------GQNDTYLYLSLALLGVGLFFKIGAAPFHSWT
NUON_MYCA9       ELD-----------AVARAVDAD------AGERSFLLLGVAMLSVGLLFKVGAVPFHFWV
NUON_BEUC1       AIG-----------EIHAATQAT------TGMDGLLVVGLVLLISGLLFKVGAVPFHAWT
NUON3_STRGG      SYADIANVVDGSVLEIDPALADT------MGNDALLLIGGAMILTGLLFKVGAVPFHMWT
NUON_SACEN       KLS-----------AIAAATAGT------DRSDTLLFAGLGLLVVGLLFKASVGPFHTWT
NUON_SALAI       DFA-----------TIDAAVSES------QSSSVLLFGGMALIAIGLLFKAAAAPFHVWT
NUON_NOCSJ       GFA-----------EINEAVRDD------VGNQTLLLIGIGMLSVGLLFKVGAVPFHSWT
NUON_THEFY       EFA-----------AVRAAGSSGG---LIDGGEPLLLIGIAMIGVGMLFKVGTVPFHNWK
NUON_CUTAK       KLG-----------DLAAAGVTQ------VGSSKLIVAGMILVAVGLLFKIGAVPFASWT
NUON_ANOFW       QLASTSDENH----------------------QYVLSLAFLLTFVGLSFKLASAPFHMWA
NUON_GEOSW       EVQKLTDSGY----------------------QYILAIAFLMMLVGLSFKISSVPFHMWT
NUON_GEOKA       RLQETNE-------------------------PYMLALAFLLLLIGVSFKLATVPFHMWA
NUON_BACAN       VFAGELASGI----------------------QLLLALAFLLLLVGLSFKIATVPFHMWA
NUON_BREBN       RLAEAGMAGY----------------------QFLVYTAFAFLAVGLAFKISAAPNHMWA
NUON_PAESJ       ALPQAFTD-Y----------------------KALVYVGFFFLIAGFGIKIAAAPFHIWA
NUON_DESPS       KLPQLMNQ-------------------------PIAVTSFILLLAGVFYKLALFPFHFWA
NUON2_OPITP      KLPPLLSS-------------------------PLAVTGLALTLAGFLYKLAVFPFHFWT
NUON1_SYNFM      TLPSLIKE-------------------------PAAIIGLVLTLCGFFFKQALFPFHSWA
NUON2_SYNFM      VLPGIIHQ-------------------------PAVVIGLLLTLSGFFFKLAVFPFHFWA
NUON2_DESMR      TSWSFADA-------------------------PMAVIGLTLFLAGFFYKLALFPFHFWC
NUON_BACFR       YFN-DLPGHITGNML------------------Q--IMAFVFFFAGMGFKISLVPFHLWT
NUON_BACV8       YFE-DIPAGLTGTPL------------------Q--VLALVFFFSGLAFKLSLVPFHLWT
NUON_AZOPC       YYS-DIALNIVSSPL------------------V--KLGFVFFFGGLGFKLSLVPFHLWT
NUON1_THEYD      ELSLILKVISNYNPL------------------I--LIGLGLFIVGLCFKIALVPFHMWA
NUON2_THEYD      SYE-TFKLLKTENLN------------------I--LLGVVFLISAFAFKLSLAPFHAWA
NUON_FLAJ1       DIAEIHESSLSAELP------------------IWFPIGMILMTIGMFFKIAAVPFHFWA
NUON_FLAPJ       DLNKILILINTQAYP------------------QWYYIGIVFLLIGMLFKIATVPFHFWA
NUON_CYTH3       DFATIEKTASADPL---------------------FFIGITLLSIAFAFKVSAVPFHFWV
NUON_LEPBA       NLDGALRGLSLKG---Y--------------EANFSKLGLGLFFVGVSFKAALVPFHSWT
NUON_LEPIN       NITEALKPLTIAG---Y--------------QGNFAKIGLVLFITGVAFKIALFPYHAWT
NUON1_AQUAE      VLSPVK-EENTL-----------------------FALGVILIISALALKVSAVPFHFWT
NUON2_HYDS0      DIISVSVNHNTA-----------------------FALASLFLFVAFALKVSAAPFHFWT
NUON2_AQUAE      DLREIL-TYQGKD------------------IHYLVLG-LVFFLIGLAVKIGAVPFHYWV
NUON1_HYDS0      DIRAIMFSYNDTN------------------SVYLIVG-MILFLLAFAIKIGIIPFHFWL
NUON_PERMH       DFYTIASLINSNN------------------IDVGISGALILLIIGLALKAAAVPFHFWT
NUON_CAMC1       DIARIGVAIKDL--SLN--------------QNLIILLGCVFIASAIGFKLSLIPFHTWI
NUON_CAMHC       DISAISYSAKN-----T--------------DSILIATACIFLICSIGFKLSLIPFHTWI
NUON_SULDN       EINQIATVLTAN--NYA--------------DIGFVLVGVVFLLAAFGFKLSMVPFHTWT
NUON_WOLSU       ELNVMAEVLVER--DFQ--------------PSWLVFAGFVFLCSAIGFKISLVPFHTWT
NUON_SULNB       ELYRVADVLAARMGETG--------------LMIAIFGSSVLLLVAFAFKLSLFPFHTWA
NUON_HELAH       NLEVITLYLYTE--GVT--------------NPMLFAMGVIFLIGAIGFKVSLVPFHTWM
NUON_HELHP       DIISIATFLHQQ--SYQ--------------PSILVFAGFVFLLCALGFKVTLVPFHSWG
NUON_CAMJR       DLSANLALKNEFQ------------------KDPMLLGAGVMIFVLCAIKLSLAPFHFWL
NUON_CAMLR       DLDN--LLHSEYI------------------SDPILLCAGVMFLVIVGVKLSIAPFHFWL
NUON_BUCAI       SFNFASEK-----------------------EILVVLFGISMILLSLFFKLSIVPFHLWT
NUON_BUCAP       IFSDLSNS-----------------------EKMMVLFGIIMVLMSFFFKLSMVPFHLWT
NUON_BUCBP       ELTMITKSFH---------------------NAIILFFGVSLFIIACSFKLSLFPFHIWT
NUON_BUCCC       IFMYYPSII----------------------LNSMMIFGICMILLSLFFKLSLFPLHTWS
NUON1_NITOC      LLSTGALSS-----------------------EIFFLAGLALIMTGLGFKLSWVPFHLWA
NUON_NITMU       MLAAPGAAL-----------------------ELYGLAGLALIVTGVGFKLALVPFHMWT
NUON2_ACICJ      LAHQAGPA------------------------DLYRLAGIALILSGVAFKLSLVPFHMWT
NUON_METCA       HGAELEQK-------------------------PLALAGLFLILAAIGFKLSLVPFHLWT
NUON_PSYA2       TLADTF-------------------------ESPLLILGAAMMMFGIAFKLSAAPFHIWT
NUON_ACIB5       ALFGAI-------------------------KQPMVLLGLALIIFAVAFKLSLAPFHKWT
NUON_AERHH       TLATTP------------------------AHHPLLMGGLGLMLVGFAFKLSLAPFHLWT
NUON_TOLAT       QISRLPQ----AE----------------SAHITLLIVGLGMVVIGFGFKLSLVPFHLWT
NUON_CHRSD       ALATAG-------------------------GDGWLMAGMGMMLIGLGFKLSIVPFHLWT
NUON_PSEMY       SLAQ-G-------------------------SSLLVELGIGMMLIGLAFKLSLVPFHLWT
NUON_HAMD5       VFNEHV------------------------FSKPLILAGMGMILVGFGFKLSLVPFQLWT
NUON_ECOLI       NLGDGM------------------------LNEPLLLAGFGLMIVGLGFKLSLVPFHLWT
NUON_PROMH       SLSDSN------------------------IHKPLVLAGLGMMLVGIGFKLSLFPFQLWT
NUON_BLOFL       ILSTYNNVNHMLS----------------QPSMTLIVIGLSMMMIGMGFKLSCVPFHLWI
NUON_BLOPB       LL----RLHIIAS----------------NQSIFMSTIGLGMMMVGFGFKLSLVPFHLWT
NUON_BAUCH       YA--------LNE----------------INYPLMLLAGLGMMIVGISFKLSLVPFHLWT
NUON_SHEWM       NVNNTNP------------------------SSMLFTAGLIFILIGLLFKLSLVPCHLWV
NUON_RICBR       KLNDSSS------------------------VNLGLVIGVVLFLSSIFFKLSSAPLHFWA
NUON_ORITI       ALQNPSSD------------------------MAVLVAAILMILVGVLFKLSIAPFHMWT
NUON_ARCB4       FIATANQQD-----------------------MILVYIGLTLILFTFLFKIAAFPFQSWL
NUON_PELPD       AVATGG---------------------------VQNLAASVMILSGFFLKASVFPFHGWA
NUON_NEORI       ANS------------------------------KIHSIGILLFISGLMFKVAAAPFHAWI
NUON_DESAP       LLPPLMDS-------------------------PVVILALVFIVAGLGIKMALFPLHGWL
NUON_CAMFF       GLNSDF----------------------------LSIIGMILVLSMMFFKIAIFGFYRWS
NUON_SALTO       LFAERPELLDI----------------------PLTTVAVALVVVGLTVKVAAVPFHAWA
                                                                  :        * 

NQO14_PARDE      PDVYEG-------------------------------SPTPVTAFFATAPKVAAMALIAR
NUON_JANSC       PDVYEG-------------------------------SPTPITALFATAPKVAAMALFAR
NUON_AZOC5       PDVYEG-------------------------------APTPVTAFFATAPKVAAMAVFVR
NUON_BEII9       PDVYEG-------------------------------APTPVTAFFASAPKLAAIAITMR
NUON_METNO       PDVYEG-------------------------------APTPVTAFFASAPKMAAMAMTVR
NUON_PARL1       PDVYEG-------------------------------APTPVTAFFAGAPKVAAMALILR
NUON_MAGSA       PDVYEG-------------------------------APTPVTSFFAVAPKIAALCLLVR
NUON_RHORT       PDVYEG-------------------------------APTPVTAFFAVAPKIAALTLFAR
NUON_RHOCS       PDVYEG-------------------------------APTSVTAFFAVAPKVAALALFVR
NUON_BARBK       PDVYEG-------------------------------APTPITAFFAGAPKIAAMALIIR
NUON_RHIEC       PDVYEG-------------------------------APTPVTAFFAAAPKVAAMAMLTR
NUON_GLUDA       PDVYQG-------------------------------APTSVTAYMAGAPKFAAFALLLR
NUON_GRABC       PDVYEG-------------------------------SPTPVTAFMGTAPKVAAIAMMLR
NUON1_ACICJ      PDVYEG-------------------------------APTSVTAFFATAPKIAVFALLLR
NUON_SPHWW       PDVYEG-------------------------------APTPVTAFFASAPKVAGMALLLR
NUON_SPHAL       PDVYEG-------------------------------APTPVTTFFASAPKVAAMALMAR
NUON_ERYLH       PDVYEG-------------------------------APTPVTTFFATAPKVAAVALTAR
NUON_CAUSK       PDVYEG-------------------------------APTSVVGFFAAAPKLAAMMMFAR
NUON_MARMM       PDVYEG-------------------------------APTPVTAFFATAPKFAAIVLLAR
NUON_HIRBI       PDVYEG-------------------------------APTPVVTFFSTAPKLATVAVLAN
NUON_HYPNA       PDVYEG-------------------------------APTPVVAFFASAPKFASLVVFAN
NUON_PELUB       PDVYEG-------------------------------SPTAVTLFFAIVPKVAALTVFIR
NUON_MAGMM       PDVYEG-------------------------------APTSVTAFMAAMPKIAAFAALFR
NUON_AZOSB       PDVYHG-------------------------------ANTAVTLIIATAPKLAAFAMAVR
NUON_DECAR       PDVYQG-------------------------------APTSVTLFIGSAPKLAAFAIVIR
NUON_NITEU       PDIYEG-------------------------------APTAVTLFIGSAPKFAAFGFVMR
NUON_THIDA       PDVYHG-------------------------------APTAMTLFVGSAPKIAAFAFVVR
NUON_METGS       PDVYHG-------------------------------APTAVTLFIGSVTKLAAFAFMIR
NUON2_NITOC      PDVYHG-------------------------------APTAVTLYIGTAPKIAAFALLMR
NUON_THISH       PDVYHG-------------------------------APTSVTLFIGTAPKLAGLAIIMR
NUON_ACIF2       PDVYQG-------------------------------APTVVTAFLASAPKIGAFALIIR
NUON_ALKEH       PDVYQG-------------------------------APTTVALFASTAPKVAAVALFVR
NUON_HALHL       PDVYQG-------------------------------APTPVTLFLSTAPKVAAVALFMR
NUON_LARHH       PDVYQG-------------------------------APTAVTLFVGSAPKLAAFVFVIR
NUON_NEIG1       PDVYHG-------------------------------APTSVTALVGTAPKIAAVVFAFR
NUON_HERAR       PDVYQG-------------------------------APTAVTLMLGGAPKLAAFAITIR
NUON_POLNA       PDVYQG-------------------------------APTAVTLIIGGAPQLAAFAMTIR
NUON_BORA1       PDVYQG-------------------------------SPTAVTLILGGAPKLAAFAMTLR
NUON_PARP8       PDVYQG-------------------------------APTAMTLIVGGGPKVAAFAWGLR
NUON_CUPTR       PDIYQG-------------------------------SPTAVTLLIAGGPKVAAFALFIR
NUON_POLNS       PDVYQG-------------------------------TPTAVTLMIAAAPKLAAFALLFR
NUON_RUTMC       PDVYQG-------------------------------APTSVTLFISTVPKIAAFAMLVR
NUON_HYDCU       PDVYHG-------------------------------APTAVTLYIGTAPKIAAFAMLYR
NUON_COXBU       PDVYEG-------------------------------APSSVTLFISTAPKIAAYAMIIR
NUON_LEGPL       PDVYQG-------------------------------APSSVTLFISTAPKIAALGMALR
NUON_XANC5       PDVYQG-------------------------------APAPIALFISSAPKLAAFGMAYR
NUON_FRATF       PDVYQG-------------------------------APNAVANIVATIPKVAAFAMLVN
NUON_EHRCJ       PDVYQG-------------------------------TSTIMTMFFSIVPKSTFIFLLMR
NUON_WOLTR       PDVYQG-------------------------------APTIVTAFFSTVPKAALVTFLIR
NUON_ANAPZ       PDTYEG-------------------------------APTVAVVFFTIVTKTAMVLVFAG
NUON_ANAMF       VDTYHG-------------------------------SPMAAMAFFLIVTKSAAILLLAR
NU2C_NOSP7       PDVYEG-------------------------------APTPVIAFLSVGSKAAGFALAIR
NU2C_SYNJB       PDVYEG-------------------------------SPTPVVAFLSVGSKAAGFALAVR
NU2C_GLOVI       PDVYEG-------------------------------SPTPVVAFLSVGSKAAGFALAIR
NU2C_PROMA       PDVYEG-------------------------------SPTPVVAFLSVGSKAAGFALAVR
NU2C1_ARATH      PDVYEG-------------------------------SPTPVVAFLSVTSKVAALALATR
NU2C1_COFAR      PDVYEGVRFVREIPTSLSISEMFGFFKTPWTCRREILSPTPVVAFLSVTSKVAASASATR
NU2C_ADICA       PDVYEG-------------------------------SPTPVVAFFSVTSKVAALALFTR
NU2C_CHAGL       PDVYEG-------------------------------SPTPVVAFLSVASKTAGLALTIR
NU2C_CHAVU       PDVYEG-------------------------------SPTPVVAFLSIISKAGALALTIR
NU2C_STAPU       PDVYEG-------------------------------SPTPVVAFLSVGSKAAGLALATR
NU2C_CHLAT       PDVYEG-------------------------------SPTPVVAFLSVGSKAAGLALATR
NU2C_NEPOL       PDVYQG-------------------------------SPTPVVAFLSVGSKAAGFILAVR
NUON_ANADF       PDVYEG-------------------------------APTPFTAFLSVGPKAAGFALAIR
NUON2_SORC5      PDVYEG-------------------------------APTPVTAFLSVGPKAAGFAVLIR
NUON_CHLCH       PDVYEG-------------------------------SPTPVTAYLSVASKAAGFALLMR
NUON2_CHLT3      PDVYEG-------------------------------APTPITAYLSVGSKAAGFAMLIR
NUON_CARHZ       PDVYQG-------------------------------APTPVTAFLATGSKAASFAIFFR
NUON_DESRM       PDVYEG-------------------------------APTPVTSFLAVGSKAASFAVLLR
NUON_DESHD       PDIYEG-------------------------------APAPITAFLATASKAAGFAALVR
NUON_HELMI       PDIYEG-------------------------------APTPVTGFLAAASKAAGFAVLVR
NUON_CLOB8       PDIYEG-------------------------------APTSITVFLAVASKTAGLAVLLR
NUON_MOOTA       PDVYEG-------------------------------APTPVTGFLSVASKAAAFAALVR
NUON2_SYMTH      PDVYEG-------------------------------APTPVTAFFSAGPKGAAMAAILR
NUON_DEHMB       PDVYQG-------------------------------SPTPITLYLSIASKAAGFALFLR
NUON_METI4       PDVYQG-------------------------------ASTPITTYLAVGSKAAGFVVLLR
NUON1_OPITP      PDVYQG-------------------------------APTPTTAFLAVSSKAAGFAILLV
NUON_RUBXD       PDAYQG-------------------------------APTSAAAFLSVAPKAAIFAALLR
NUON_RHOP5       PDAFQG-------------------------------APAGAAALAGVVSKAAVAIAILR
NUON_RHOS5       PDAFTG-------------------------------APGAAAAFAGAASKVAVVTALVR
NQO14_THET8      PDVYQG-------------------------------SPTPVVLFMATSVKAAAFAALLR
NUON1_STRGG      PDIAEG-------------------------------TPPPVAAALTTVPKIGALVAFYR
NUON_MYCSJ       PDAAQG-------------------------------ANATAATFLTTVPKIGALVALYR
NUON_DEIRA       PDVYSG-------------------------------APTLVSLFLSTVVKVAAFAGMLR
NUON_GEOMG       PDIYQG-------------------------------GPTPVVAFLASGSKGAAIALFLL
NUON_GEOUR       PDVYQG-------------------------------APTPVVAFLSTASKGAAIAFLLL
NUON_GEOBB       PDVYQG-------------------------------APAPVAAFLSTSSKVAAASLLLM
NUON_PELCD       PDVYQG-------------------------------ASAPIAGFLASGSKGAVFAVLLG
NUON1_DESMR      PDVYQG-------------------------------APAPVAAFLSSGSKAAAAAALLH
NUON_PARUW       PDVYAG-------------------------------ASNPVTAFMAVGTKVGVFAAFVR
NUON1_SYMTH      PDVYQG-------------------------------APTPVTAFMAIGTKAAAFAAMAR
NUON_CHLSY       PDVYEG-------------------------------SPTPITAFISTASKAAGFILLFR
NUON1_ROSCS      PDVYQG-------------------------------APPPVTAFLSTASKAAGFLLLYR
NUON2_HERA2      PDVYQG-------------------------------APTSMTAFISTASKTAGFFLLYR
NUON2_ACIC5      PDAYQG-------------------------------APSLSAGFIASSSKVASFFVFAQ
NUON1_KORVE      PDAYEG-------------------------------APTAVTGFMSVAVKAAGWAMLLR
NUON2_SOLUE      PDAYEG-------------------------------APTTVTAYLSVASKAASIAFLLR
NUON2_RHIME      PDVYEG-------------------------------APTTITAFMSVAPKAAGFAVILR
NUON_THERP       PDAYQG-------------------------------APTPVSAYMSVVPKVAGFAAVAR
NUON_DESDA       PDVYEG-------------------------------APTTVTAFMSVAAKTASFAVLGR
NUON2_KORVE      PDVYEG-------------------------------APSPIVALMSTGPKAAAFAVLLR
NUON1_ACIC5      PDAYEG-------------------------------APSPVVGLMSTAPKAAAFAVLLR
NUON1_SOLUE      PDVYQG-------------------------------APTPVSAFLSAGPKAAAFAIFLR
NUON_ANAD2       PDVYEG-------------------------------APTPVTAFMAAGVKTAAFAVLVR
NUON_MYXXD       PDVYEG-------------------------------APTPVTALMSVGVKAAAFAAMVR
NUON1_SORC5      PDAYEG-------------------------------APTPATTFMAVAVKGAAFATLLR
NUON_CHLAD       PDVYEG-------------------------------SPTPVAAFMSVGTKGGALAALVR
NUON2_ROSCS      PDVYEG-------------------------------APTPIAGLLSVGSKAAGFAALLR
NUON1_HERA2      PDVYEG-------------------------------APTPVTAYMSVATKGAAFAAMLR
NUON1_CHLT3      PDVYEG-------------------------------SPTVATAFMATGAKAAALSSMIL
NUON_GEOLS       PDVYEG-------------------------------APTPMTAFMSAGPKAAGFAAMLR
NUON_SALRD       PDVYQG-------------------------------APTPLTGYMSTATKAAAFAALIL
NUON_GEMAT       PDVYDG-------------------------------APLPVTAFMSATVKTAAFAVFAR
NUON_BDEBA       PDVYQG-------------------------------APTPHTAFMATAVKTVSFAAFLR
NUON_ACIC1       PDVYQG-------------------------------APTPITAFMAAGTKVAAFGALLR
NUON_RHOOB       PDVYQG-------------------------------APTPITAFMAAATKVAAVGAMLR
NUON_FRASN       PDVYQG-------------------------------APTPITAFMAAGTKVAAFGALLR
NUON_MYCA9       PDVYQG-------------------------------APTPVTAFMAATTKIAAFGALLR
NUON_BEUC1       PDVYQG-------------------------------APTPITGFMAACTKVAAFGALLR
NUON3_STRGG      PDVYQG-------------------------------APTPVTGFMAAATKVAAFGALLR
NUON_SACEN       PDVYQG-------------------------------APTAVTGFMAACTKVAAFGGILR
NUON_SALAI       PDVYQG-------------------------------APTPITGFMAACTKVAAFGALLR
NUON_NOCSJ       PDVYQG-------------------------------APTAVTAFMAAGTKIAAFGAMLR
NUON_THEFY       PDVYQG-------------------------------APTPITALMASGTLVAAFGAMLR
NUON_CUTAK       PDVYTG-------------------------------APTPVSGWMAVATKLVALVGLMR
NUON_ANOFW       PDVYQG-------------------------------ATTPVVSFLSVVSKTAGFVIVLR
NUON_GEOSW       PDVYQG-------------------------------APTPVTAFLSVVSKTAGFVIVLR
NUON_GEOKA       PDVYEG-------------------------------APVPATAFFAVVSKTAGFALLLR
NUON_BACAN       PDVYEG-------------------------------AATPVTAFLGTISKMAGFLLIIR
NUON_BREBN       PDVYQG-------------------------------APTPVTVFLAVVSKAAGFALIFR
NUON_PAESJ       ADVYQG-------------------------------APTPVSAFLAVIAKGAALAAVFR
NUON_DESPS       PDVYEG-------------------------------AANETTAFAATLPKFGAIAVLIR
NUON2_OPITP      PDVYQG-------------------------------SSNETASLIASLPKLGAVAVLVR
NUON1_SYNFM      PDVYMG-------------------------------AANQVTTYIATASKMAAAAMVIR
NUON2_SYNFM      PDAYQG-------------------------------AANQVSAYIATASKVAAIGVLVR
NUON2_DESMR      PDVYQG-------------------------------AKNETAAYVATIPKLGAVVVLVR
NUON_BACFR       ADVYEG-------------------------------APTAVTSYLSVISKGSAAFVLMT
NUON_BACV8       ADTYQG-------------------------------APTTVSAYLSVISKGAAAFALMI
NUON_AZOPC       ADVYEG-------------------------------APTSVTAYLSVVSKGAATFALIF
NUON1_THEYD      PDVYEG-------------------------------APTPVTAFISTLPKVAILGAFGR
NUON2_THEYD      PDVYQG-------------------------------APTAVTAFLSTAPKVAVFGALIN
NUON_FLAJ1       PDVYEG-------------------------------SPALTTALMSTLAKVVAIATLFK
NUON_FLAPJ       PDVYEG-------------------------------SPALTTATMSTLAKIVAMATLYK
NUON_CYTH3       PDVYSG-------------------------------APTFITAFMSTFVKVAAFGAFYL
NUON_LEPBA       PDVYEG-------------------------------AQTPITGFMASAGKASALGLVII
NUON_LEPIN       PDAYEG-------------------------------ALTPVTGYMSTAAKAASIGLLLI
NUON1_AQUAE      PDAYEG-------------------------------APTPTTAYLSTVPKIGMYFLFVK
NUON2_HYDS0      PDAYEG-------------------------------APTSNTAFISTVPKIGFYAVLFL
NUON2_AQUAE      PDAYQG-------------------------------APTPVTALMASVGKLAFFIPLVR
NUON1_HYDS0      PDAYTA-------------------------------APTPITGFMASAGKLAFFIPLLR
NUON_PERMH       PDAYEG-------------------------------APTPITAFMAVAAKIATFAVILR
NUON_CAMC1       PDVYEG-------------------------------SNAPLAGYMSIVPKVAGFIVALR
NUON_CAMHC       PDVYEG-------------------------------SSEVMAGYISIVPKIAGFIVAMR
NUON_SULDN       PDVYEG-------------------------------SSAALAGYMSIVPKIAAFIVAMR
NUON_WOLSU       PDVYEG-------------------------------TNSVLAGYMSVVPKIAGFIVAMR
NUON_SULNB       PDVYEG-------------------------------ASAPLAGYMSVVPKVAAFVVSIR
NUON_HELAH       PDVYEG-------------------------------NNPVFASYISIVPKIAGFVVATR
NUON_HELHP       PDVYEG-------------------------------SNALLAAFIAIVPKIVTFAVIIR
NUON_CAMJR       KDVYYA-------------------------------AHTNLVAFISVVPKVAMLVVVIR
NUON_CAMLR       KDVYYG-------------------------------VHTNFIAFISIVPKIAMIIVVLR
NUON_BUCAI       PDIYQG-------------------------------SPTSVLSFFSTAGKISVFSVLLN
NUON_BUCAP       ADIYQG-------------------------------TPASVLSFFSVSGKIAIFSILLY
NUON_BUCBP       PDVYQG-------------------------------MSSEALMIFSTSVKIAIFSVLFK
NUON_BUCCC       PNIYQY-------------------------------SNPCSLIFFSTAVKISIFSFLLR
NUON1_NITOC      ADVYQG-------------------------------APAPVTAFLATVSKGAVFALLLR
NUON_NITMU       PDVYEG-------------------------------APVPITAFIATASKGAMLVLLLR
NUON2_ACICJ      PDVYEG-------------------------------APAPVTAFIAVVSKIAVFAVILR
NUON_METCA       PDVYQG-------------------------------APTPVTAFLATVSKASVFALLLR
NUON_PSYA2       PDVYEG-------------------------------APAPIATYLASVSKVAMMALAVR
NUON_ACIB5       PDVYAG-------------------------------APAPMATFLATAAKVATIGLFVR
NUON_AERHH       PDVYEG-------------------------------APAPVATFLATVSKIAVFCVLLR
NUON_TOLAT       PDVYQG-------------------------------APAPVTTYLATVSKIAVFAVLLR
NUON_CHRSD       PDVYEG-------------------------------SPAPAATFLASASKVAVLLVLLR
NUON_PSEMY       PDVYEG-------------------------------APAPVAAFLATASKVAVFAVLLR
NUON_HAMD5       PDVYQG-------------------------------APAPVTTFLGTVGKIALLAGVMR
NUON_ECOLI       PDVYQG-------------------------------APAPVSTFLATASKIAIFGVVMR
NUON_PROMH       PDVYQG-------------------------------APAPTGAFLATASKIGIFAVVMR
NUON_BLOFL       SDIYQG-------------------------------TPTAVSMYLATGSKIAVTAVLMR
NUON_BLOPB       PDVYQG-------------------------------APSSISLYLTTSSKIAVISVLIR
NUON_BAUCH       PDIYQG-------------------------------APTPVSTYLATVSKIAIFASLMR
NUON_SHEWM       ADIFEG-------------------------------APLPTTALLSTVSKLASFVVLWK
NUON_RICBR       PDVYEG-------------------------------SPIASVTYFTAASKIGAVAILLN
NUON_ORITI       PDIYDG-------------------------------APLVVVALFSSLPKISVLALLGN
NUON_ARCB4       LDVYRG-------------------------------APMIITAYMASTFKIAIFSFFLR
NUON_PELPD       PDAYSS-------------------------------ARLPVTAFLASIVKAAVVLGLVR
NUON_NEORI       GDIYEG-------------------------------APTVSTTFFAVLPKLSLIVVLVS
NUON_DESAP       PDAYSY-------------------------------TPAPVLAFMAAVMTKVSAYALYR
NUON_CAMFF       IDVYYG-------------------------------SNLNIAGFLASAFKLASFAILIK
NUON_SALTO       PTTYDG-------------------------------APLPVAAYLSTVSKLGGVVALLA
                                                                             

NQO14_PARDE      LVFDAFGHV-------------IGDWSQIVAALAVMSMFLGSIAGIGQTNIKRLMAYSSI
NUON_JANSC       VVHDAFGGV-------------IGDWQQIVAFLAVVSMFLGAIAAIGQTDIKRLMAYSSI
NUON_AZOC5       VAVEALPHV-------------THSWQQIVTFVSIASMALGAFAAIGQRNIKRLLAYSSI
NUON_BEII9       IMITAFAGI-------------KPQWQQIIVFISILSMALGSFAAIGQTNIKRLMAYSSI
NUON_METNO       VFIGAFPGV-------------VAEWQQIIVFIAIASMALGSFAAIGQRNLKRLMAYSSI
NUON_PARL1       VLFVAFPSM-------------ESEWQQIIVFIAIASMVLGAFAAIGQSNIKRLMAYSSI
NUON_MAGSA       VMTGPFADL-------------VEQWRQVVTFIAIGSMFVGSFAAVVQTNIKRLMAYSSI
NUON_RHORT       VMMGPFAAY-------------ADQWQQVIILISILSMLLGGFAAIVQTNIKRLMAYSSI
NUON_RHOCS       VLVDPFGEL-------------LAQWQQVVWFSAVASMLLGSLAAIQQRNIKRMMAYSSI
NUON_BARBK       VIVFAFIPLESSDNF-------MPAWQQILIFMAISSMALGAFAAIGQTNIKRLMAYSSI
NUON_RHIEC       IVITAFQPV-------------LADWQQVVVFISIASMLLGSFAAIGQKNIKRLMAYSSI
NUON_GLUDA       VMAGPFGHV-------------APQWQILVEGVSMLSMLFGSLAAIPQTDIKRLMAYSSI
NUON_GRABC       TLVTPFHGV-------------LVQWQHVVALISVVSMVWGALAAIGQTSIKRLMAYSSI
NUON1_ACICJ      VMLGPFGPV-------------LGQWRDLVQIIAAASMVIGAIGAIRQTSIKRLMGYSSI
NUON_SPHWW       VAIEAMGSG-------------TDTWRQIVVFAALASTILGAVAAIGQTSMKRLLAYSSI
NUON_SPHAL       IVIDAMGPA-------------VGAWQQIVIFLALASIILGAVGAIGQKNIKRLLAYSSI
NUON_ERYLH       VALSPFGEQ-------------TEAWQQIVIFAALASIVLGALGAIGQTNLKRLLAYSSI
NUON_CAUSK       VLGDAFPDS-------------VAQWRQVLIIASLASVFVGAFAGLAQTNLKRLWAYSSI
NUON_MARMM       VLMEPFGAV-------------VDQWRDVIWMIAVLSMAVGAFGALTQQNIKRLMAYSSI
NUON_HIRBI       IMFTVFGVY-------------EESWMLIIAIVSAISMLVGAFGGLAQNNIKRLLAYSSI
NUON_HYPNA       VMFTLFGSV-------------MDQWQLIVAIIAGLSMIVGSLGGLTQNNIKRLLAYSSI
NUON_PELUB       FLYIPFVNM-------------IDQWQPILIFLSIASMIFGAIAAIGQNNLKRLIAYSSI
NUON_MAGMM       VLVEAFGPM-------------HATWGPIMALLAVVSMGVGALAGLGQSNIKRLLAYSSI
NUON_AZOSB       LLVWGLFDV-------------AEHWQTMLMFVAVLSIVLGNLAAIAQTNLKRMLAYSGI
NUON_DECAR       LLVNGLITL-------------AADWQAMLVILSVLSMAIGNLAAIAQTNLKRMLAYSAI
NUON_NITEU       LLVGGLGDL-------------VTDWQGMLVLLAVASMAVGNIAAIAQQNIKRMLAYSTI
NUON_THIDA       VLGQGLESQ-------------VSEWRDMLVILAVLSMAIGNIAAIAQSNLKRMFAYSTI
NUON_METGS       LLIQGLYVL-------------AIDWQGMLAIMAVLSILIGNITAIAQTNLKRMLAYSTI
NUON2_NITOC      LLVEALGDV-------------QAHWQDMLIILSVLSMAIGNVVAIAQTNLKRMLAYSTI
NUON_THISH       LLVDGLGPL-------------HHDWQGMLTILAVLSLAVGNVVAIAQTNIKRMLAYSTI
NUON_ACIF2       LLVDGGYGM-------------QESWQQIFVALTVVSLVVGNVIAIAQQNIKRMLAYSTI
NUON_ALKEH       LLSEGLGPI-------------HDQWQPMIILLAVASLVVGNLAALAQTNIKRMLAYSTA
NUON_HALHL       LLVDGLGPM-------------HEQLEPMLMILAVASLLVGNLIAIVQTNFKRMLAYSAI
NUON_LARHH       FLAQALEPA-------------AVAWQPMLILLAIASLVVGNLAAIMQTNIKRMLAYSTI
NUON_NEIG1       ILVTGLGTV-------------HHDWSLMFALLAAASLLVGNLAAIMQTNIKRMLAYSTV
NUON_HERAR       LLVEALPAL-------------AIDWQQMLTILSVLSMAIGNITAIMQTNIKRMLAYSTI
NUON_POLNA       LLVEGLLPL-------------AIDWQQMLALMAIGSLVIGNLAAVAQTNLKRMLAFSTI
NUON_BORA1       LLVDGLHGL-------------AADWQSMLMILAVLSLAIGNLTAIVQTNFKRMLAYSTI
NUON_PARP8       FLVMGLLPL-------------AVDWQEMLVILAALSLIVGNITGIVQRNVKRMLAYSAI
NUON_CUPTR       VLVEGLLPL-------------ASDWQMMLVVLSIISLAIGNLTAIVQSNLKRMLAYSTI
NUON_POLNS       LLVNTLLPL-------------LGDWQPMLVLLAVLSLVVGNVTAIAQTNVKRMLAYSAI
NUON_RUTMC       ILVDGLDSM-------------HAYWSDLFMVLSILSIALGSVVALMQSNIKRMLAYSTI
NUON_HYDCU       ILVEGLPGL-------------VEDWQSLIVMISVLSLIVGAVITLVQENLKRLLAYSGI
NUON_COXBU       LLILGMPAL-------------HVQWHQMLIVVAILSMGIGNFAAIVQSNIKRMLAYSSI
NUON_LEGPL       FLTIGLVDI-------------TMQWQQIILVMALLSTGIGNLLAVIQTRIKRLLAYSAI
NUON_XANC5       LLEVGMGPL-------------SPQWHLLIGGLSAVSLVVGNLMAIAQSNLKRMLAYSTV
NUON_FRATF       ILFVGFPSL-------------KDSWIYLFRIIGILSIFFGSLVALSQTNVKRLLGYSTV
NUON_EHRCJ       I-LNEVLPSL------------SKDWQQIMICVSMLSIFVSAFGAMRQTNLKRLFSYAAI
NUON_WOLTR       FFMGEELVGV------------EKYFQPVLLYISALSVLISAFGALRQRNLKRLLAYSSI
NUON_ANAPZ       LMQGVVIPIT------------GFVWS--MLLMAALSMVVGEFSAMQQKNVKRLFAYANI
NUON_ANAMF       IVGENGILQQ------------SILYG--IISVSGLSALVGELGALRQSNIKRLLAYSNI
NU2C_NOSP7       LLTTAFPLVADEWR-------------FVFTALAVLSMILGNVVALAQTSMKRMLAYSSI
NU2C_SYNJB       FLATVFPAMTEEWR-------------AVLSVLAILTMVLGNVVAIAQTRLKRLLAYSSI
NU2C_GLOVI       FMTSAYPGFSEQWQ-------------TLFVLLAILSMVLGNVVAIAQTSMKRMLAYSSI
NU2C_PROMA       ILVGCFNAFDDQWK-------------LLFTVLAVLSMTLGNVVALAQTSMKRMLAYSSI
NU2C1_ARATH      IFDIPFYFSSNEWH-------------LLLEILAILSMIFGNLIAITQTSMKRMLAYSSI
NU2C1_COFAR      IFDIPFYFSSNGWH-------------LLLEILAILSMILGNLIAITQTSMKRMLAYSSI
NU2C_ADICA       LFGLIFPYFSNEWH-------------VAVGLLATFSMILGNLIAVTQRSVKRMLAFSSI
NU2C_CHAGL       IIATIFPYLENEWQ-------------FLLQILACLTMIVGNLVAITQTSMKRMLAYSSI
NU2C_CHAVU       ISDIIFPILEQDSN-------------SILQILAILSMIVGNLLAMVETSMKRILTYSSI
NU2C_STAPU       LLSIVFPAIEDQWH-------------IVLEIVAFLSMVFGNLIAATQTSMKRMLAYSSI
NU2C_CHLAT       ILTTLFPYLTNEWH-------------LLFQVLASLSMILGNLIAISQTSMKRMLGYSSV
NU2C_NEPOL       MCTTLFPSFNTEWH-------------LIFTILSILSMIVGNFIAVTQTSLKRMLGYSSV
NUON_ANADF       IFHSALAGPSSPVTG-FAESLAGIPWPAVVGVIAAVTMTLGNLTALGQTNLKRLLAYSSI
NUON2_SORC5      FFSDALGAGSAPPG-------VATPWPVLFGCLAMATMTVGNLSALEQENVKRMLAYSSI
NUON_CHLCH       FVYVALPHTNNVQA-----ATLGIDWFTLLVILAVASMIYGNVVALWQKNVKRLLAYSSI
NUON2_CHLT3      FFRVTIP-TGAGST-----DLLAFDWVTLLSVVSVVSMVLGNVVALWQSNVKRLLAYSSI
NUON_CARHZ       FFYLAFP--GIREH-----------WVGLLATLAALTMVVGNLVAIPQTNLKRMLAYSSI
NUON_DESRM       LFAGGFG--GIQEQ-----------WTLLVAVLAALSMLIGNLVAIPQTNIKRMLAYSSI
NUON_DESHD       FYVLMMYNHSMAEA-----------GLILLLVLAAITMIIGNLMAFPQKNIQRLMAYSGI
NUON_HELMI       LFLEGMPLQGGAD------------WLTVIAVLAGVTMVIGNVVAIPQTNIKRMLAYSSV
NUON_CLOB8       LFMTGMS--SASSY-----------WIDLIIVLSVITLVLGNLVAIPQTNIKRLLAYSSI
NUON_MOOTA       VFFGALP--DLHSF-----------WVQLFIALAVLTIVLGNLVAIPQTNIKRLLAYSSI
NUON2_SYMTH      VFVGGL-GVAPFTD----------KWALIWALAAAASMTVGNLVALQQTNIKRMMAYSSI
NUON_DEHMB       LFYTVFTDPLALSQ----------EWALIVAVLATAGMTLGNVLAIPQKNIKRMLGYSSI
NUON_METI4       ILNLPFYDPGFQKHW-----------IPLISLMALLSVIVGNLAAIPQRNIKRMLGYSSI
NUON1_OPITP      LVNSVFGPYWWLVQ-------------PVLVAMAVATILFGNIAALTQHNVKRLIGLSGV
NUON_RUBXD       ILLDGMPQAAPTWT-------------ALMAVIAIVTMFVGNLLALRQSNVRRMLAYSSV
NUON_RHOP5       LNSEAQLP-QP-------------LWSAGLATLGAASVLVGNVLALRQQLLPRMLGYSTI
NUON_RHOS5       LDA-VGLP-Q--------------VWALGLGTFAGVSILLGNLAALRQDGVARMLGYSSV
NQO14_THET8      VAA----------------------PPEALALLVALSVVVGNLAALAQKEAKRLLAYSSI
NUON1_STRGG      LLDTAIPA-AAI------------DWRLITAVLATAGMTLGNLAAFAQTSALRMLGYSTV
NUON_MYCSJ       L--TTVLP-DTL------------AWPVLIAVFAVISMTLGNLAAYWQQDPRRLLGWSTV
NUON_DEIRA       VFGGALAA-GP-------------GWHSVLQILVALTLVIGNAAALYQQNFKRLLAYSAV
NUON_GEOMG       ILSPLGTL-GT--------------LRAPLWGLAFLSMTVGNLAALLQPNVKRMLAYSSV
NUON_GEOUR       LLPSGSGF-KT--------------LHTPLWWLSLLSMLVGNLAALLQTNLKRMLAYSSI
NUON_GEOBB       LLTFSPPM-PE--------------LRIPLVLLSLLSMVVGNLAALRQQNIKRMLAYSSI
NUON_PELCD       SAP-LALI-VP--------------LRPLLGGLAALSMIWGTLAALRQTNLKRMLAYSSV
NUON1_DESMR      VCSEVSPE-ARE------------LLWPALAVGAGLTMAVGNLGAVAQASVKRLLAYSSI
NUON_PARUW       LFFEALPQ-FDA------------AWNQVIDTLVYATLIYANFVALKQIQLRRFFAYSSI
NUON1_SYMTH      LLVAAVPQAYQP------------SFLLPLSILAFASMMLGATVGIWQSDLKRLMAYSGI
NUON_CHLSY       LLTETF--PAMAGAPTLN--EEAGGWTAVLAVLALLTVVIGNLAALPQTNVKRLLAYSSI
NUON1_ROSCS      LLTTAF--PGAVGAPRL---EEFNGWTSILAILALVTVIVGNLAALPQTNARRLLAYSSI
NUON2_HERA2      VLVTGFGAPSILGTAAIGTSTSFGGWTSLIAILAALTMLVGNLAALPQTNAKRMLAYSSI
NUON2_ACIC5      VLFIGVASASGNAAWHLS----APGWMPILAAVAVLSMLLGNLAALAQTSLRRLLAYSAI
NUON1_KORVE      IFLFM-------------LWPMREQYTPILIFVAVATMIGGNFAALTQTNVKRLLAYSSI
NUON2_SOLUE      IFLGP-------------LASARAVWEPLLAFIAIITLTIGNLAAINQTNIKRLLAYSSI
NUON2_RHIME      VFLNP-------------LVEASNAWI-IVAAIAVATMALGSFVALVQDNFKRLLAYSSI
NUON_THERP       VLVQG-------------LQPLSEQWTGLLGMLAAITMIYGNVVAIAQRDLKRMLGYSAI
NUON_DESDA       VLLQG-------------LPQLSPLWSDALAGLAVLTMLLGNIAALAQTSLKRMLAYSAI
NUON2_KORVE      VL----------------FAMNAPGWFWIVWVSAALSMTIGNIGALVQSNVKRLLAYSSI
NUON1_ACIC5      IAYEA-------------FPVFHFHWVPLLWIIAALSMTIGNLGALRQRNVKRMLAYSSI
NUON1_SOLUE      IFMTA-------------FEPISDKWQPLVWTAALASMCIGNFAAILQTNIKRMLAYSSI
NUON_ANAD2       LFLATESG--------SAAMSTSLG--TVLSALAVLTMIFGNLLALPQRSVKRMLAYSSI
NUON_MYXXD       VFFMV--G--------KGVDPQMLL--GLFSVLAFLTMVAGNLLAIPQRNVKRMLAYSSI
NUON1_SORC5      VLLGAFGS--------PALSSWAAGWPPAVAVMALLTMTVANLIAGRQESVKRMLAYSSI
NUON_CHLAD       LLFEG-------------LPTLNEYWLPVLAGLTALTMVVGNLGAVAQTNVKRMLAYSSI
NUON2_ROSCS      FLVEA-------------LAGEWQIWAPVLAVLAIATLAVGNIGALTQRNVKRMLAYSSI
NUON1_HERA2      FLNVA-------------FPALKPEWQLLFGLFAAATMAYGNIVAVAQTNLKRMLAYSSI
NUON1_CHLT3      VGISI-----------APILETFTAWPTAIAMIATLTMFFGNIAALIQTNLKRMFAYSSI
NUON_GEOLS       LLLVA-----------FPAM--IADWSDLLWILAVLTMTVGNFTALRQDNIKRMLAYSSI
NUON_SALRD       VLVHA-----------VPGG----EWQLSVAAVAVLTMVIGNVMALAQTNVKRLLAYSSI
NUON_GEMAT       IMIEG-----------LAVA--APRWHMGLWWLAAVTMVVGNVFALSQRNLVRMLAYSSI
NUON_BDEBA       IIATK-------------SLTGSDQLFDILQWMAVITMIVGNAAAIMQNNFKRMIAYSSV
NUON_ACIC1       VFFVA-------------FGGLAWDWRPVIWGVAIATMVVGAILGITQTDVKRLLAYSSI
NUON_RHOOB       IFYVA-------------LPDLRADWRPVMWGVAILTMVVGAVMAVTQNDVKRMLAYSSV
NUON_FRASN       VFYVA-------------FGGMRWDWRPVIWAVAILTMVVGAVLALTQRDIKRMLAYSAV
NUON_MYCA9       VLYVA-------------LPGITTDWRPVLWGVAIATMLIGSIGAVTQTDVKRMLAYSAV
NUON_BEUC1       VVYVV-------------APAMTWDIQPFLWVVAVLTMVVGTVLAIVQTDMKRTLAYSSV
NUON3_STRGG      LLYVA-------------LPGLAWDLRPVMWAVAIVTMLGGAIVAITQTDIKRLLAYSSI
NUON_SACEN       VLQVA-------------FEASSWEWRGVLYAVAIVSMAIGVVLGLTQSDIKRMIAYSSV
NUON_SALAI       VFHVA-------------FEGARWDFTPILGVVAVLTMLVGAVLAVTQTDIKRLLAYSSI
NUON_NOCSJ       LFYVA-------------FGSDRWSWQPMLWIIAILTMLVGALIAIVQTDMKRMLAYSSV
NUON_THEFY       VFYVA-------------FGTTVAQWRPMLWVVAILTMVVAAVIAVTQRDIKRLLAYSSV
NUON_CUTAK       VLYVG-------------LGAMRWDWQIVLAVVAVASMGVGAIVGLAQTDMKRLLAYSAI
NUON_ANOFW       VIVSVFAQTPAG-----SSASMLMTFAPYIAFLSGATMIIGNTIALRQRNVKRMLAYSSV
NUON_GEOSW       LFITIFTQAPAQGK---DPSSLLFSMQDYIAFLAGATMIIGNTIALKQRSMKRLFAYSSI
NUON_GEOKA       LLVTIFAAAPSEGR---DPSSLLLSMQPIITVLAGLTMIIGSVVALRQRSLKRLLAYSGI
NUON_BACAN       LFLMVFASVSVQG----DMQSLYGRMSIYIAVLASITMIIGNVVALKQYNVKRLFAYSGI
NUON_BREBN       VMMISFFNVSDGTG---SGRFFFEEGSLYLGLMAAASMIIGNTMALRQTNVKRMMAYSGI
NUON_PAESJ       FLYSSAFFLTGG-----PGKQAGDDVFFALLVIAAAAMIAGTVSALRQKQVKRLLALSGV
NUON_DESPS       FATLPGEN--------------SQLIINVLLGCALISMFYGNLAALVQKDVKRLLAFSGI
NUON2_OPITP      FVSLAAPG--------------HETLATLLTCLAIASMVYGNLIALVQTDLKRLLGFSGI
NUON1_SYNFM      FVNLSGGE--------------SPLFTQVLVGLAVLSMTFGNLVAIIQKDLKRLLAYSSI
NUON2_SYNFM      VIASAGDG--------------GTYLVHVLAVLSVVSMTVGNLAAIAQQDLKRLLAYSTV
NUON2_DESMR      LAAFVAP---------------HLEVTTILAILGAVSMTAGNLAALVQRDLKRLLGFSSV
NUON_BACFR       ILMKVFAPMVAQWQ-------------EVLFWVTIASITIANLFAIRQQNLKRFMAFSAI
NUON_BACV8       ILMKVFGPMTEQWS-------------EILCIIIVATITIANLFAIRQNNLKRFMAFSSI
NUON_AZOPC       VLYKVFGRIELIWN-------------NILCWLLLATIVLGNLFAIRQQNIKRFFAFSSI
NUON1_THEYD      VLVEIFRDYYIDWS-------------NFLIVLSIATMATGNFFALIQKNIKRMLAYSSI
NUON2_THEYD      IFLSI--NLKLNIQ-------------DLIVIISALSMLVGNVLALRQNNLKRMLAYSSI
NUON_FLAJ1       LVSGLNLIPSLENQDLS------NTFTNVILTISIASMTVGNIMALRQVNVKRMLAFSGI
NUON_FLAPJ       LVTVLLPIQLYSIQ-------------IIIVCVAIASMLLGNIMALRQNNVKRMFAFSGI
NUON_CYTH3       MLDSIFESVPTYLS-------------HTLIGLSALTIVVGNIAASYQDNVKRMLAFSGV
NUON_LEPBA       LFNHIPMGEMGNVWKY------------LMGTIALISMTWGNIVALKQDNLKRMLAYSSI
NUON_LEPIN       LYTKLPLPLENSTWAW------------LPGILALCSMIYGNLLALKQENLKRMLAYSSI
NUON1_AQUAE      LTMYLFS-AF-PDWKY------------VVMLLAVLSMFYGNIVAYAQKSVKRLLAYSSI
NUON2_HYDS0      LASYIFP-VT-NNFSY------------IVGIVGVISMFWGNLVAYAQNSAKRMLAYSSI
NUON2_AQUAE      VMPLVQEKFS-LVWTI------------TVGVIAALTMLYGNLVALVQKDVKRLLAYSSI
NUON1_HYDS0      LVPYVNQYLY-SSWMI------------SVSILAAITMIVGNALALVQSDLKRLLAYSSI
NUON_PERMH       VMVEAFPFIS-KEWSF------------AWAILAAASMIIGNIIALRQENVKRMLAYSSV
NUON_CAMC1       IFAMLEGSGI-SWIKD------------MLYIIAVLTMSLANIMALVQKDVKRMLAFSSI
NUON_CAMHC       VFESLYDSNI-AFIQI------------SLYIIAVLTMTLANIMALIQNDVKRMLAFSSI
NUON_SULDN       LFEFLIHSGV-VWLEV------------ILYMGVVVTMTMANIWALVQSDVKRMLAYSSI
NUON_WOLSU       FFDIFLASEI-EWVRN------------LLYFLTILTITLPNIMALVQEDVKRMLAYSSI
NUON_SULNB       IFGMYIDLGV-EWVRV------------VILVLAVLTMTLANLMALVQEDVKRMLAYSSI
NUON_HELAH       LFGAFIDTRI-AWVED------------IFYALILITITIPNLIALWQEDVKRMLAYSSI
NUON_HELHP       IFSVFIDSHS-AFVEY------------TLYVIVVLTMTIPNLIALTQKDVKRMLAYSSI
NUON_CAMJR       LFDFLNN----TGFEY------------IIIVLAIFSMLIGAFAALSQNNIKKMFAYSSV
NUON_CAMLR       IFSALGGG---VKFEY------------IVALLAIFSMLAVSIVALIQKDVKKMLAYSSI
NUON_BUCAI       FLSYFSNSD-------------NKVIYFILSLIIILSILVGNLMALFQKDIKRFLGYTSI
NUON_BUCAP       FFSYFSVFD-------------NKVIFLILSLISFFSILFGNLMAIFQTNIKRFFGYSSI
NUON_BUCBP       IFIVLSYFHI------------EEVFYYLVSIISCLSMIFGNIMAINQTSIKRLMGYSSI
NUON_BUCCC       FLNFFPYIYK------------IKSIYYIIYLISMFSVFFGNIIGIIQNNVQRLIGYLSI
NUON1_NITOC      LFVQVDGPQ-------------HHTLIVLLSFIAVATILAGNLLALLQNNIKRILAYSSI
NUON_NITMU       YFLMAGAHQ-------------SHSITFALSLIAVATILVGNLLALLQNNIKRILAYSSI
NUON2_ACICJ      FFALAGAHA-------------DASLRAGIAAVAILSMLAGNLLALLQTNVKRLLAYSSI
NUON_METCA       FFTAAHAER-------------SETFLCVLGLLAVVSILAGNLLALLQVSLKRLLAYSSI
NUON_PSYA2       FLIDTSLLA-------------LPSVQMLLMVMATLSILLGNLLAVRQTSLKRLLGYSSI
NUON_ACIB5       YLLASGAIM-------------VNSLVTVLTIIAVLSILVGNLLAVRQVNLKRILGYSSI
NUON_AERHH       FYLAVPAAA-------------DPMIHWLLAAMAVISIVIGNLLALLQTNIKRMMGYSSI
NUON_TOLAT       LFYTIPAT--------------DSFFYSLLGGLAFISIIIGNLLALLQSNLKRLLGFSST
NUON_CHRSD       LLQSSP-VQ-------------DAWLHSLLAVLAFVTMLVGNLLALTQNDLKRLLGYSSI
NUON_PSEMY       LYQISPATA-------------GGWLNELLTLIAIASILFGNLLALLQNNLKRLLGYSSI
NUON_HAMD5       FFLYVPTFN-------------VPGLNTALSFMAVASIFFGNLMALTQNNIKRLLGYSSI
NUON_ECOLI       LFLYAPVGD-------------SEAIRVVLAIIAFASIIFGNLMALSQTNIKRLLGYSSI
NUON_PROMH       LFLEAPAAD-------------SETLRMILGFMAIASILFGNIMALTQKNVKRLLGYSSV
NUON_BLOFL       FLLILPDQY-------------NELLHIFLSVSACCSMLFGSLMAIPQISIKRMLAYSSI
NUON_BLOPB       LLMVFPNQY-------------NTVFCIFLLGIACCSALFGNLMAIKQDNIKRVLAYSSI
NUON_BAUCH       LFFYAPFNT-------------HYEVKLLLCIIAICSMFIGNLMALSQNNLFRILGYSST
NUON_SHEWM       LFHLGNWQE-------------NQIVLTLIGVVAVASMLIGNLLALLQNSILRILAFSSI
NUON_RICBR       IENLIIKNY-------------HPISYNLIKIIALLSMIFGALGAIRQTSLKRLMAYSTI
NUON_ORITI       LLSELKFASD-----------AFFYIKTIIMVLACLSLIVGAFGALLQQSIQRFIAYSAI
NUON_ARCB4       VILDYISPII-------------DFWDTILSVVIILTLVFGTWLAVTQQIVKRMLAASSI
NUON_PELPD       ILGNAVLNP---------------EAVTVIALLSMLSMFYGNITAIHQTAFKKMLAYSSI
NUON_NEORI       LISNLEPIAYTGSTYSTELMENSQYLRNILFTSGILSIAFGTFSAFGQKNIKRFIGFASI
NUON_DESAP       ILYFVTEAAG-----------PVSPTLQVLGWMAAAGILFGSIMAIAQRDLWRMLAYSSV
NUON_CAMFF       LCFLYPGNN-------------IEILQGIFAILAILSMFAGNLLSLKETNVKKILIAAGI
NUON_SALTO       VVQHALPAQI---------------TGLVLALLAVLTMTVGNLVALRQRRTVRLLAWSSV
                                                                :    :       

NQO14_PARDE      AHMGFALVGLAAGTAIG--------------------------VQNMLLYMTIYAVMNIG
NUON_JANSC       SHMGFALMGLSAGTAQG--------------------------VEAMLIYMAIYVAMNIG
NUON_AZOC5       GHMGFALVGLAAGTEQG--------------------------VTGVLLYMAIYVVMTLG
NUON_BEII9       GHMGFALVGLAAGTETG--------------------------IQGVLAYMAIYLVMTLG
NUON_METNO       GNVGYALIGLAAGTEEG--------------------------VRGVVVYMAIYLAMTLG
NUON_PARL1       SHMGFAMVGLAAGTPEG--------------------------VRGVLIYLVIYVVMNAG
NUON_MAGSA       GHVGFVLVGIAAGSTLG--------------------------IQGVLIYLAIYLFMNVG
NUON_RHORT       GHVGYALIGIAAGTTEG--------------------------VRGVLVYLAIYLFMNVG
NUON_RHOCS       GHIGYALVGLAAGTEEG--------------------------VRGVLIYLAIYLAMNVG
NUON_BARBK       GHMGYALVGLAAGNILG--------------------------VKGILIYMTIYLGMTIG
NUON_RHIEC       GHMGYALVGLAAGNQTG--------------------------VSGVMLYMVIYMIMTLG
NUON_GLUDA       GHMGYALMGLCAGTAEG--------------------------MRGTLVYLTTYLLMNVG
NUON_GRABC       GHMGYALVGLAAGSQAG--------------------------IRGLLIYLVTYVFMNTG
NUON1_ACICJ      GHMGYALMGLAAGTAAG--------------------------VSGALIYLAIYLVMSLG
NUON_SPHWW       NNVGFALFGLAAGSADG--------------------------VAATMTYMAVYVAMTLG
NUON_SPHAL       NNVGFMLIGLAAGTQQG--------------------------VEGVLTYLLVYLVTTLG
NUON_ERYLH       NNVGFILIGLAASTVAG--------------------------LSAMLTYLAIYVVMALG
NUON_CAUSK       ANVGYALLGVATGGETG--------------------------LHSMLLFMTLYMVDVTG
NUON_MARMM       SNMGYALVAVAAASQTG--------------------------LWALLVFMVLYMVGAIG
NUON_HIRBI       ANVGYALMGVAAGEVNG--------------------------AASVLTYMTIYVITTLG
NUON_HYPNA       ANVGYALVAVAAGQVLG--------------------------APALLTFSTIYVISSLG
NUON_PELUB       GHMGYALAGLSTGSNEG--------------------------IQSSIVYMSIYLVMNLA
NUON_MAGMM       GHVGYALIGLAVGNQMG--------------------------YEAVLVYLTIYIFMNVG
NUON_AZOSB       SHMGFMLLGLLSGVVDGDPHYAL------------------DAYSAAMFYAISYVIMSLA
NUON_DECAR       SHMGFMLLGIVTGVVGGDARYAL------------------NAYSSSMFYVISYVLMSAG
NUON_NITEU       SHMGFVLLGFIAAGENG--------------------------YSSSMFYVIAYVLMTLG
NUON_THIDA       SHMGFMLLGVLAGSQNG--------------------------YGAAMFYVLVYTLMTLG
NUON_METGS       SHVGYLLYGFMSAGTNG--------------------------YVSAMFYIMAYVLMTLG
NUON2_NITOC      AHVGFLLLGILTGTGVG--------------------------YAAAMFYVIVYALMSLG
NUON_THISH       SHVGFILMGILAGTHEG--------------------------YAAALFYTLVYAIVAAG
NUON_ACIF2       GHVGFMLLGIVAGTEAG--------------------------LASAFFYTVVYTLMSLA
NUON_ALKEH       SHVGFILLGFIAGTAEG--------------------------YSTALFYAITYGIMSAG
NUON_HALHL       AHAGFIMVGFTAGTDAG--------------------------HAAALFYTIAYSIMAAG
NUON_LARHH       SHMGFMLIGILAATPAG--------------------------YSAAMFYAITYMLMALA
NUON_NEIG1       SHMGFILLAFMAGA-VG--------------------------FAAGLYYAITYALMAAA
NUON_HERAR       SQVGFILLGLLSGVVAGADGSTT------------------NGYGAAMFYVITYVLTTLG
NUON_POLNA       SQMGFLLLGLLAGVVNGNQLHTE------------------SAYGAAMFYALTYVLTTLA
NUON_BORA1       SHMGFVLLGLASGVVVGKAEAAS------------------AAYGASLFYMITYVLTTLA
NUON_PARP8       SNMGFVLLGLLAGVVDGKTGAAA------------------SAYGSAMFYSIVYLITTLG
NUON_CUPTR       SHMGFVLLGLLSGVVANKADGAA------------------DAYSSAMFYSVTYLLTTLG
NUON_POLNS       AQMGFVLLGMLSVFDD-------------------------HAFSASMFYAITYVLTTLG
NUON_RUTMC       SHVGFIMLGFVAGTPIG--------------------------YGAAAFYMLVYVLMSLA
NUON_HYDCU       GHIGFILLGIIAANPDG--------------------------YSAAMFYTIVYSITALA
NUON_COXBU       AHMGYMLLGVLCGTRNG--------------------------YAAAMFYTITYSLMSLG
NUON_LEGPL       SHIGYALFGVLAASSAG--------------------------YAAALYYILIYAVMSAA
NUON_XANC5       SHIGFLLMGVAGGGEEG--------------------------YAAAMFYAVSYTIMSTA
NUON_FRATF       SQIGFVLLATTLNPQGY-------------------------ALTAASFYVIVYLFTTLA
NUON_EHRCJ       GHIGYMLISLAINTTVSNAA--------------------------TIMYLLLYVVMNIG
NUON_WOLTR       GHIGFILASLSIFTRMGTDS--------------------------SLIYLVIYIITNIG
NUON_ANAPZ       GHIGYVLAGMSTGV-VTFKP--------------------------VLFYVVTYLLINVW
NUON_ANAMF       GQLGYVLPVVVLHG-TSSYA--------------------------IFHYVLTSWVINAW
NU2C_NOSP7       AQAGFVMIGLIAGTQ--------------------------AGYASMIFYLLVYLFMNLC
NU2C_SYNJB       GQAGFVMIGLVVGTE--------------------------AGYASLIFYLLVYLVMNLG
NU2C_GLOVI       AQAGYVMIGLAIGTQ--------------------------EGYSSMILYIGTYLFMNLG
NU2C_PROMA       GQAGFVMIGLVCGTE--------------------------EGYAAMILYMAAYLFMNLG
NU2C1_ARATH      GQIGYVIIGIIVGDSN-------------------------GGYASMITYMLFYIAMNLG
NU2C1_COFAR      GQIGYVIIGIIVGDSN-------------------------DGYASMITYMLFYISMNLG
NU2C_ADICA       SQIGYIMIGVLSADSG-------------------------NGYASMITYTFIYILMNLG
NU2C_CHAGL       SQAGYLMIGIISSTN--------------------------DGYASSLVYMLIYIFMNLG
NU2C_CHAVU       AQAGYLLIGIVAGRN--------------------------NGYASLLVYMIFYLFMNIG
NU2C_STAPU       SQAGYLLIAILVGNS--------------------------DGYASMITYLLIYTFMNLG
NU2C_CHLAT       SQAGFLMIGLIAGNP--------------------------NGYSSMLVYMLLYIFMNLG
NU2C_NEPOL       GQAGVMMIGMLTDSP--------------------------DGYASLIVYLLIYLFMNLG
NUON_ANADF       AHAGYTLMGLSAVS--------------------------DRGMQSVMIYMLVYLVMNVG
NUON2_SORC5      AHAGYMLLGFSVFS--------------------------GAGVAAIAFYIVTYCFMNLG
NUON_CHLCH       AHAGYALLGVIVMD--------------------------KLGTQATLFYLLSYLLMNFG
NUON2_CHLT3      AHAGYILLGVIVAD--------------------------DLGTQATLFYLAAYTIMNIG
NUON_CARHZ       AQAGYILVGFLATD--------------------------FTGFKAIMFYLSVYLIATIG
NUON_DESRM       AQAGYIMVGLVSAT--------------------------EAGIKGVMFYAFLYVFATIG
NUON_DESHD       AQAGYIIVGVIAVSIASSVSQWGVDP----------VSAFVDGIKGVLFYLMIYVFANLG
NUON_HELMI       AQAGYLLVGLMSTD--------------------------APGVKGILFYAMLYVVANMG
NUON_CLOB8       SQAGYFLLGIIANS--------------------------SLGIASILLYSLFYLFANMG
NUON_MOOTA       AQAGYLLLGIVSFS--------------------------VLGVGAVMYYAMLYVFGNMG
NUON2_SYMTH      AQAGYILVGVAASG-----------------------LQSVEGISSVLFYVMAYAVTNLG
NUON_DEHMB       AHAGYILVALAAVGNS---------------------PELADGRISLLFYLVAFAVSDLV
NUON_METI4       SHGGFLLMGLSA------------------------HNKIGCA--AVIYYFFAYMVAIFA
NUON1_OPITP      SHAGFLLIGIIA------------------------SHSVPSAVGAVLFYLFAYLLATFA
NUON_RUBXD       AHSGYILAAFAALQ----------------------GDAVSSGVQAVMIYSAAYAVMNLG
NUON_RHOP5       AHSGYIAMILASGAPG--------------------------TNEAVLFYLGIYAPALTA
NUON_RHOS5       GHAGYIAAALATGAAS--------------------------APAAALFYIVTYAPALLA
NQO14_THET8      AHAGYMALALYTGNA-----------------------------QALGFYLLTYVLATGL
NUON1_STRGG      SQVGYLLMAVAVAGRTPL------------------------AQPALLLYLAAYALTNIA
NUON_MYCSJ       SQVGYLLVPITVAGASEL------------------------ALPSLLFYLGGYTVTNIA
NUON_DEIRA       AHTGFLAMTLLGDTAQ--------------------------GGAALGYYLLVYTLMTVG
NUON_GEOMG       AQMGYVALALLSGG---R------------------------GYEAAAFYAVAYGAMVLA
NUON_GEOUR       AQMGYLVLALLTGSS--E------------------------GFAAVILYVVVYTAMNLA
NUON_GEOBB       AHMGYLTLALLTGTR--E------------------------GYAALLLYGAIYTAMNLA
NUON_PELCD       VHMGYLVLAVLSNRS--A------------------------GMEAGLFYLLTYSAATVG
NUON1_DESMR      AQMGYILMAAMAVND--G------------------------GGEAALFYLAAFALMDLA
NUON_PARUW       SHAGFLMIPVVIGNQE--------------------------ALSALTFYLVIYAIATFG
NUON1_SYMTH      ANAGYLIMAIPGLGLD--------------------------GLSAAAYYLAAYGFATMG
NUON_CHLSY       AHAGFVLLGLLAWAAAQPF-------------------DREQGLIALLYYLIIYSLTNLG
NUON1_ROSCS      GHAGFLLLAVLLWASASPV-------------------DRTFGTAALIYYLIVYSLTNLG
NUON2_HERA2      AQAGFLMLGLVGTQRDSG--------------------------ISLLMYLIAYTVTNLS
NUON2_ACIC5      GHAGYLLLGLIAHTPQSL--------------------------AALLYYVFTYALAVLG
NUON1_KORVE      SHVGYMLLGLVASDGKNS----------------------STGIKGILVYLAVYTFMNLG
NUON2_SOLUE      SHAGYMLLGLVAGN--------------------------DTGIKGIAVYVMVYTFMNLG
NUON2_RHIME      AHAGFAIFGVVAGG--------------------------QDGIASVMLYLLIYTFMNLG
NUON_THERP       GHTGYMLAGLAAFTTGQAG---------------------DRSVGSVLFYLFAYTFMNIG
NUON_DESDA       AHAGYALLGLAACT--------------------------PEGLRATAAYLTIYLCMNIG
NUON2_KORVE      AHAGYMLVAFAAAKD--------------------------AGISAAIFYTATYAAMNVG
NUON1_ACIC5      AHAGYLLVAFTALSP--------------------------DGIAAASFYAVTYAAMNVG
NUON1_SOLUE      AHAGYVLVALTAHSE--------------------------TGVAAAMFYLAGYAFMNVG
NUON_ANAD2       GHAGYLLVGVVSAVVAG---------------------ARDKALAGLLFYLAAYTATVIG
NUON_MYXXD       AHAGYLLVGVAALFVTGPGEQFRLLGASALTGGTPLGLARAEALRGILYYLLAYTFSAVG
NUON1_SORC5      AHAGYLLVGVAATVRAS-----------------------EDAQASVMFYLLAYTVSTVG
NUON_CHLAD       GHAGYVMLGVMVAGE-------------------------QRGPEAFLFYMLVYALSNLG
NUON2_ROSCS      GHAGYILFGVIAAGAPG-------------------GIAGQRGVEGVLLYLIAYTFTNLG
NUON1_HERA2      AHAGYMLLGVLAASE--------------------------KGISAFTVYLLAYTLTNLG
NUON1_CHLT3      AHAGYMLIGIATGTD--------------------------SGYAGVLYYIFLYTLMNIG
NUON_GEOLS       AHAGYCLVGFASGTA--------------------------TGTSGILFYMLSYTFMNIG
NUON_SALRD       AHAGYLLVGLSAGTS--------------------------AGYAGALFYLLVYAVMNIG
NUON_GEMAT       AHAGYLLVSIIVGDA--------------------------AGTSALIFYVVSYTLATMG
NUON_BDEBA       AHSGYLMVGLITAGVSD---------------------NGAFGASGVIFYLLAYGLMTIG
NUON_ACIC1       AHAGFVLTAFAATT--------------------------RASESSVLFYLVAYGFMTIG
NUON_RHOOB       AHAGFILTGLVAAN--------------------------RAGLSSTMFYLLAYGFSTLG
NUON_FRASN       AHAGFLLVGMAGSN--------------------------IDGLRGAMFYLVTYGFTTIA
NUON_MYCA9       AHTGFLLTGVAAAN--------------------------ERGVSSTLFYLAAYGFSTVG
NUON_BEUC1       AHAGFLLVGVVAMS--------------------------PEGISSVFFYLLAYGLATIG
NUON3_STRGG      AHAGFILAGVIAAS--------------------------PEGISSVLFYLLAYSFVTVG
NUON_SACEN       AHAGFLLVGSIALT--------------------------ERGLAGTMFYLLAYGFTTIA
NUON_SALAI       ANAGYLLVGVLAPS--------------------------SEGVSGTMFYLVAYGFSVLA
NUON_NOCSJ       AHTGFLLTGVLGVQQA-----------------SELADGEVTSLQAVLFYLVTYGFAVVG
NUON_THEFY       VHAGFILTAVVAAN--------------------------ADGLTGAMFYLAAYGFTTVG
NUON_CUTAK       AHAGFVLVGVVGAWTTQ----------------TGMAEGQTGSVSSVLVYMTAYGLASIG
NUON_ANOFW       AHAGYVLVAFASLSMFM--------------------------FEAIWFYLLAYVFMTIG
NUON_GEOSW       AHAGYILVGFAAMSWVM--------------------------IDSIWFYLLAYLFMNLG
NUON_GEOKA       AHAGYLLAGFAAMSWAM--------------------------IDSLWMYLLVYTLMNIG
NUON_BACAN       AHAGYLLVPLVALSPFT--------------------------MDSMWFYMLAYMLMNIG
NUON_BREBN       AQAGYLLVPFVPPTSLF--------------------------FSEVIFYLFGYLLVSFG
NUON_PAESJ       ANAGYLLVPIAISVTIIHS----------------------NNFSEFVFYLVAYLLMNVG
NUON_DESPS       AHGGFILLGVLVFENMG--------------------------YRNAIFYTLAYVLMNIA
NUON2_OPITP      AHAGYVMVGFVAMDNFG--------------------------FASALYYIAGYMLMVLA
NUON1_SYNFM      AHAGYMMIGILTMSEHG--------------------------VASAIYYSAAYLVMNFA
NUON2_SYNFM      AHAGYVLIGVLSMNPAG--------------------------YSAAVFYAFALLVMKFT
NUON2_DESMR      AHAGYVMLGLAAGSAAG--------------------------MSAAAFYSLAYILMNLA
NUON_BACFR       SQAGYIMLGVIGGSEMGM--------------------------TALVYYVLVYLAANLG
NUON_BACV8       SQAGYIMLAVLAGTPQDM--------------------------ASLVYYIVVYIAANLA
NUON_AZOPC       SQAGYILLGIIAGTAQGM--------------------------TSTIFYTLVYLFSNLA
NUON1_THEYD      AHAGYIIIGVIVGTQSGF--------------------------NSVVAYMFIYTLMNIG
NUON2_THEYD      AHAGYMFMAFLLPEKELL--------------------------ISLIPYLIVYVFMNLS
NUON_FLAJ1       SHAGFMLMTFLTIATSAG--------------------------VLLY-YTAAYALAGIA
NUON_FLAPJ       SHAGFMVSTLLLTSNAAS--------------------------TLLY-YASAYAIAGIA
NUON_CYTH3       SQAGYMLMVFPILTISAK--------------------------TSLFVYLAGYAIANLI
NUON_LEPBA       SHAGYIVAGIACGAGLEA-----------------------------LYYLFSYSLLNLA
NUON_LEPIN       AHAGYVVAGISAGIKEEV-----------------------------LFYLIVYSFMSLG
NUON1_AQUAE      AHAGYFLTALTAVDKHLF--------------------------SALLFYVFVYALATVG
NUON2_HYDS0      GHAGYFLIGFSRYNPLSV--------------------------SSTIFYVIVYAFATAG
NUON2_AQUAE      AHSGYIMAGAAVAKVIGM--------------------------KAVIYFLVAYAVMSAG
NUON1_HYDS0      AHSGYILSVLSSNSSMGL--------------------------KAAIYFVFVYSIMGLG
NUON_PERMH       AHTGYILAAIAAPTGMGF--------------------------SALIFYSLIYIFMGIG
NUON_CAMC1       AHAGVVLCALVANSHEAN--------------------------VALFFYWIMFLFANLG
NUON_CAMHC       SHAGFVLCAVVIGTKSAN--------------------------IGLFLYWLMFSFANLG
NUON_SULDN       SHAGFVMAAILIGTTQSN--------------------------SALFLYWILFSFTNLG
NUON_WOLSU       SHAGFALAAIMINTTQST--------------------------SALFLYWILFLFTNLG
NUON_SULNB       SHAGFIIAALALDTTEGT--------------------------TAIFFYYGLFMFTNLG
NUON_HELAH       SHSGFALACVFIHTEESQ--------------------------KAMFVYWFMFAFTYIG
NUON_HELHP       SHSGFVLAAVLINTPQSH--------------------------SVIFFYWFLFLFANIG
NUON_CAMJR       VHSSLVLIACIPLLKEQN---------------------FDGILLAIFGYWTLFAFANYA
NUON_CAMLR       THSSFILAVIVSSMSVSSQGDGT---------------SYLLSIFALFVYWISFAFANYG
NUON_BUCAI       SQIGYLLIVLLVSHK-----------------------NYSFSLEASAIYLCGYLFSNIA
NUON_BUCAP       SQIGYLLIILLVSKD-----------------------EYFFSVQTGGIFLLNYLCTNIV
NUON_BUCBP       SQLGYLFIVLVISR------------------------NMQFSLEVTGIYLINYALSNIG
NUON_BUCCC       SNIGFLLIIIITQSY-----------------------SFVFLNKLFIIYLFIYIFGLIG
NUON1_NITOC      AHLGYLLVALLASG--------------------------NLGVEAVTFYWVAYFIMNLG
NUON_NITMU       AQLGYLLVGFLAFD--------------------------QLAIEAVAYFLTAYFVTMLG
NUON2_ACICJ      AHLGYLLVAFLAAP--------------------------ALGVDAAAYYLAAYAVTSLG
NUON_METCA       AHMGYLLTGFVAAGLLRR----------------------DLQTETIAFYLAAYTVTSLT
NUON_PSYA2       AHMGYVLIVIVSIGS--------------------------AADSISSMYMAIYAFTSIG
NUON_ACIB5       AHFGYLLIALISMTY--------------------------ASLGSVTVYVVTYVLTTIG
NUON_AERHH       SHFGYLLAVIV-ASRLG-----------------------QMPVEAAGVYLLMYLFTSLG
NUON_TOLAT       AHFGYLLVALI-ACRLG-----------------------SLSQEAVALYLVMYLLTSVG
NUON_CHRSD       AHFGYLLVALV-VND-------------------------GLAAETAALYLVTYVLTTLG
NUON_PSEMY       AHFGYLLVALI-ASQ-------------------------GLAVEAIGVYLATYVLTSLG
NUON_HAMD5       AHFGYLMIGLIALHQDP------------------------MVLERVAVYIVAYLFSSLG
NUON_ECOLI       SHLGYLLVALIALQTGE------------------------MSMEAVGVYLAGYLFSSLG
NUON_PROMH       SHLGYLLVALIVLQYSP-----------------------ILAQETAEIYLAGYLFASLG
NUON_BLOFL       TNAGYLLIALIALRMNNC----------------------AIIQESISVYLVSYLFANVG
NUON_BLOPB       AHTGYVLIGVIAILRVNH----------------------PMALETIGIYLISYVLTSIG
NUON_BAUCH       AHFGYLLVSWLVIQNV-------------------------LVLETVGLYLFGYLLANLG
NUON_SHEWM       SHFGYLLILLFLFNHNADLLD-----------------NPTFPLEALLFYLSAYLITLTG
NUON_RICBR       LNIGYVLIGVLLRTEDGN--------------------------KAAMLYMLIYAAASIG
NUON_ORITI       LNLGYAVLALVANSSNVI------------------------RAEISYFYIIIYAASMLG
NUON_ARCB4       VHTGYLLLAFIALGYKDGHLINI------------------DSAYAVMFYLIAYLLSALG
NUON_PELPD       SHAGYMMFALVDNTGART--------------------------EALLYYVAVYAVTTIT
NUON_NEORI       AHVGYMLLGVSNSASLSFG-------------------------NPGIAYALVYSFTNLG
NUON_DESAP       AQVGYIVLGLAVGNVLA--------------------------LYGALLHVLSHALVKGG
NUON_CAMFF       VHSGYIFINLSSVGASVS-------------------------IYPAIFYLSTYTIVVGF
NUON_SALTO       AQAGYILAPLGALALAAGRTGDA----------------RAAAYAAAVAYTVFFVVLELA
                  : .                                             .          

NQO14_PARDE      TFAFILSMERDG-------------VPVTDLAALNRFAWTDPVKALAMLVLMFSLAGVPP
NUON_JANSC       TFAFILTMERNG-------------RHVTEISSLSAFASKEPTKALAILVMMFSLAGVPP
NUON_AZOC5       SFTCVLAMRRDG-------------RSVETIEDLAGLARTKPLMALALAALMFSLAGIPP
NUON_BEII9       TFAAILSMRVNG-------------VNVEQISDLAGLARTRGSMAFFLAIMMFSLAGIPP
NUON_METNO       AFAVILGMRRGN-------------RMFETIEDLSGLSRTHPWLAFCLAMMMFSLAGIPP
NUON_PARL1       VFCCILAMQRKE-------------GYVENISDLAGLSRNQPMVAFMMAMLMFSLAGVPP
NUON_MAGSA       AFAVILSMRQKG-------------RMVEGIDDLAGLSKTHPMMAFVMAVLMFSMAGVPP
NUON_RHORT       TFTVILAMRQKG-------------RAVEGINDLAGLSKQHPMMAAAMAVFMFSMAGVPP
NUON_RHOCS       TFAVILSMRVNG-------------RMVENIDDLSGLSRSHPMMALAMAFFMFSLGGVPP
NUON_BARBK       SFAFILGMRFSN-------------RYVENIYDLAGLVKTNPFMAIVMTIQLFSLASIPP
NUON_RHIEC       TFAIIMSMRRKDG------------TVVEDVNDLAGLSATNPFMAVVLTALMFSLAGIPP
NUON_GLUDA       AFAVIIAMRRKG-------------REVTGIADLAGLGKTDPGLATAMAIFMFSMAGAPP
NUON_GRABC       TFACILAMRRRG-------------RQLEKVSDLAGAGRTDPALALLLAIFMFSMAGIPP
NUON1_ACICJ      TFGCIIAMSRGR-------------QPVERIADLAGMASDDPRFAFVLAVMMWSMAGIPP
NUON_SPHWW       SFICVLQMRGQDG------------QPVETIASLSGLSRSRPGLAAAFAIFMFSLAGIPP
NUON_SPHAL       AFLVVLQLRDEGG------------NQVESIPALAGLSQRRPGLAAAMSVFLFSLAGIPP
NUON_ERYLH       SFVALLMLKDEDG------------TPLETFDDIAGLSTTRPALAWCLLFLMFSLAGIPP
NUON_CAUSK       FFACLQALSRDG-------------KPMETIEDMAGLVKERPGIAVAMTAFSLSALGMPP
NUON_MARMM       SFATILSMRTRE-------------GMVEQISDLAGLAQRNPGLGWSMTALMFSIGGLPF
NUON_HIRBI       MFGIVLAMRRRD-------------GQVEEISDLNGLSTSRPGLAVAMTVLVFSVAGIPP
NUON_HYPNA       LFAGVLAMRRRG-------------GMVENIQELGGLARRQPVFAIAMTVLVLSVAGLPP
NUON_PELUB       FFSCLLMLKRND-------------AYYETIDDLSGLSKNHPILSLSLLAILFSLAGIPP
NUON_MAGMM       AFGLILVLNKEG--------------FGDQIEDYKGLSAKRPGLALLMAIFMFSMAGIPP
NUON_AZOSB       SFGMIILLSRAG-------------FEAENIDDFKGLNKRSPWFAAMMMFVMFSMAGIPF
NUON_DECAR       TFGMILMMSRAG-------------FEAEELDDYKGLNKRSPWFAGIMLMLMFSMAGVPF
NUON_NITEU       AFGIIMLVSREG-------------FEADKISDLKGLNQRNPWLAFMMLLVMFSMAGIPP
NUON_THIDA       GFGMILLLSRAG-------------FESDRLDDFKGLNRRSPWLAFVMLLLMFSMTGIPP
NUON_METGS       GFGIMLLLSRKG-------------FEADNLEDLKGLNQRSPWYAFLMLIIMFSMAGVPP
NUON2_NITOC      SFGMIIFLSRSN-------------FEADRLEDFKGLNERSPWFAFMMLILMFSLAGVPP
NUON_THISH       GFGMIILLSRRG-------------FEAENLDDFRGLNERSPWFAFIMLLIMFSMAGVPP
NUON_ACIF2       GFGMILLVSRAG-------------FEAERIDDFKGLAQRKPWYAFLMMIVMFSMAGVPP
NUON_ALKEH       AFGLIILLSHRG-------------FEAENISDFKGLNDRSPAMALMMLLLMFSMTGIPG
NUON_HALHL       AFGMITVLARSG-------------FEAEEIADLRGLNERHPVYAGVLLLVLVSMTGIPG
NUON_LARHH       GFGVLLALSRAG-------------FDCETLDDLKGLNRKNAWYALLVLLVMFSMAGIPP
NUON_NEIG1       GFGVLMVLSDGD-------------NECENISDLAGLNQHRVWLAFLMLLVMFSMAGIPP
NUON_HERAR       MFGVIMLLSRAG-------------FEADNIDDFKGLNQRSPWFAFVTLLLMFSLAGVPP
NUON_POLNA       AFGIILLLARAG-------------HESEEITDLSGLNQRSPLYAGVMAMSMFSLAGLPP
NUON_BORA1       SFGIVLLLSRQG-------------FECEQIDDLKGLNRRSPWHALIVLLLMFSLAGIPP
NUON_PARP8       SFGVVMLLARRE-------------FEAETLDDFKGLNQRSPVFAFVMMVMMFSLAGIPP
NUON_CUPTR       TFGIILLRTSKG-------------FEAETLEDLKGMSRRNPWFAFLMLVMMFSLAGIPP
NUON_POLNS       TFGLLMVLSRKG-------------YDCETLDGLKGLNKKHPWFAFISLVMMFSLAGIPP
NUON_RUTMC       AFGMIILLNKQG-------------FEIDQISDFKGLNKHAPWFALMMLIIILSMAGVPP
NUON_HYDCU       GFGMIVALARTN-------------NEFDLVADFKGMNKRNPWLALMMLFIMFSMAGIPP
NUON_COXBU       AFGMVVLMSRGG-------------FEAENINDFAGLNSRNPWLAFMMMLILFSLAGVPP
NUON_LEGPL       AFGLVVLMSNHG-------------MEIDSIDDLKGLNKRNPWLAFMMLLVMFSMAGVPP
NUON_XANC5       SFGAIIALSRNG-------------FEAENIDDFKGLNARNPWMAGLVLCIMASLAGIPP
NUON_FRATF       VFGVLTTISVGG-------------YEVQDLNDLKGFNTKDSWLAFILLIVLFSMAGIPP
NUON_EHRCJ       LFCILIQYDDDD----------------CNLLNLKGLHNKSPVIAFCIAVIMLSMAGIPP
NUON_WOLTR       LFSYFIQIDDDD----------------CSVANLSGIGKKRPVLAFHLSILLFSMAGIPP
NUON_ANAPZ       IFTVLLRYDDEG----------------FEITDVAGLAAKNPFLAFTFVAALLASAGLPP
NUON_ANAMF       IFSVLLRYDDEG----------------FELASLAGMHRSSPFVAFALVVSMVSAAGFPP
NU2C_NOSP7       GFTCIILFSLRTG--------------TDQIAEYSGLYQKDPLLTLGLSIALLSLGGIPP
NU2C_SYNJB       AFLCITLFSLKTG--------------TDEINEYSGLYQKDPFLTLCLSICLLSLGGLPP
NU2C_GLOVI       AFMAVVLFSLRTG--------------TDEITAYSGLYQKDPFLTLVLSLCLLSLAGIPP
NU2C_PROMA       AFACIILFSLRTG--------------SDRIADYAGLYQKDPLITLGLSLCLLSLGGIPP
NU2C1_ARATH      TFACIILFGLRTG--------------TDNIRDYAGLYTKDPFLALSLALCLLSLGGLPP
NU2C1_COFAR      TFACIVLFGLRTG--------------TDNIRDYAGLYTKDPFLALSLALCLLSLGGLPP
NU2C_ADICA       TFACITLFGLRTG--------------TDNIRDYAGLYMKDPVLTFSLVLCLLSLGGMPP
NU2C_CHAGL       AFGCVILFGLRTG--------------TDQIRDFSGLYLKDPWLASCLTIFLLSLGGIPP
NU2C_CHAVU       AFSCIILFGLRTG--------------TDQIRDYTGLYTKDPWLASCLSLCLLSLAGIPP
NU2C_STAPU       AFACTVIFGLRTG--------------TDQIRDYTGLYLKDPWLAFALSICLLSLAGMPP
NU2C_CHLAT       AFACIILFGLKAG--------------TDQIRDYAGLYRKDPFLVFCFSISLLSLGGIPP
NU2C_NEPOL       AFACVILFGLRTG--------------TDQIQDYSGLLARDPFLALCLSLCLLSLGGIPP
NUON_ANADF       AFLVVILVAESTG--------------SESILDYRGLSKRHPSAAVAFAIFLFSLTGLPP
NUON2_SORC5      AFMVVMAVAEESGG-------------DETFAAFRGLGRRAPLVAAAMAVFLVSLTGLPP
NUON_CHLCH       AFFVVVLIANRTG--------------SESLDDYRGLGKSMPLAGAALTVFLISLVGLPP
NUON2_CHLT3      AFFVIILISNEIG--------------SDDVNDYKGLGKKMPLAAASLTIFLVSLTGLPP
NUON_CARHZ       AFTVVTVYENVTG--------------KEEIRDFAGLSQRSPIMAAVLVVSLLSMAGIPP
NUON_DESRM       AFTVVAIVSNQTN--------------SDEIRDYAGLIQRAPLAASVMLICLLSMAGIPP
NUON_DESHD       AFAVITHVAQSQG--------------STEIKDYAGLAKRSPLAAAVLTLSVLSLAGIPP
NUON_HELMI       AFAVATAVGRAIG--------------SDEIADYAGLSQRQPLLASVMTISLLSLAGIPP
NUON_CLOB8       AFGVVIAVSKATG--------------NDQIKDYAYLAKRSPFLAAVMLISLLSLAGIPP
NUON_MOOTA       AFMAATAFYNNDG--------------SDEIKDYAGLARRSPLVAALMLFSLLSLAGIPP
NUON2_SYMTH      IFAVLTHMDQEGG--------------WVEVDNYAGLAKRNPLYAWALLLFFVSLIGIPP
NUON_DEHMB       AFVSIIAISRSTG--------------SDEIPSYEGLAKTNPVYASALTLALLSLTGFPP
NUON_METI4       AFLVVILLEKNQPS-------------GVSIKDFNGLYLKNSLMAWSMAFSMISLAGLPP
NUON1_OPITP      VFGVMAHLAGADDA-------------EQELDHYAGLAKEDPFLAAILAVALGSLAGIPP
NUON_RUBXD       AFLTIDLV-------------------GEEAKSFNGLFATRPMLAAAMAVFMAALVGIPP
NUON_RHOP5       TLCASAMLGPA-----------------PMLEDLRGLARKRPLEATSLSVGLLSLAGLPV
NUON_RHOS5       ALCVAALIGRA-----------------TRISDLRGIVWRRPLAGAAMAAALVSLAGLPV
NQO14_THET8      AFAVLSQISPDR----------------VPLEALRGLYRKDPLLGLAFLVAMLSLLGLPP
NUON1_STRGG      GFAVVATTHEH-----------------R-IDRYRGLFHRDPLLALALTVALLGLVGTPP
NUON_MYCSJ       AFAVTAALPGR-----------------RDLDSYRGLARTRPWLAAALVVALLGLVGTPP
NUON_DEIRA       ALAVVAALQRTE--------------EGLTINDMRGLYYRHPAYAVALAFCLASLAGLPP
NUON_GEOMG       AFGALASLEGETP-------------LEQ-VDDLRGLGYHRPFQGVVLAVAMLALAGIPP
NUON_GEOUR       AFGAVASLTESVG-------------MEN-VEDYRGVGYSRPFQAGILALALFALAGIPP
NUON_GEOBB       AFGAIASLSLEKE-------------RDQ-IADYSGLGFSAPLRGGVLALAMLALAGLPP
NUON_PELCD       TFGLLASMVDSGG-------------EPQDYAALEGLAGRSPWRAVLLTGLLLSLAGFPP
NUON1_DESMR      AFGAVGALSAQIG-------------DRDDIAAYRGLGYVHPWRAGVLAIGLASLAGLPP
NUON_PARUW       CFAVLAYLDQNQE--------------GVHFSDLHGLFSRSPWLASLLSICLLTLAGIPP
NUON1_SYMTH      VFAVVRILEADGV-------------DGSQLANLKGLFYRSPWVGVCLAVLFFGLIGVPP
NUON_CHLSY       AFGALALIGQQT--------------GGDDLDHLRGLSRRNLPLALLFTVCILSLAGIPP
NUON1_ROSCS      SFGVLAVLTNAL--------------GSDDLSAMQGLWRRNMSLTLMMTILILSLAGIPP
NUON2_HERA2      AFGILALVEDAV--------------GGTDFSNLNGLGRRAPGLALLLTVAILSLAGIPP
NUON2_ACIC5      AFGVLAILETN---------------GIDSLSSLAGLSRRSPALSACLLVFLLSLAGIPP
NUON1_KORVE      AFAVITSLRRRDI-------------IGDELDDLAGLFFKAPSEAVLLLVFLLSLAGIPP
NUON2_SOLUE      AFLVIIAMRRASI-------------IGEDLDDLAGLVHKSPGYAFLMLIFLLSLAGIPP
NUON2_RHIME      IFGAVIMMRNGDF-------------SGEVIEDYAGFAKFHPGLALLMLLYLFSLAGIPP
NUON_THERP       AFGVIAWLQERG--------------LGTTLDDIAGLAGRAPLAALTMAIFMLSLMGMPP
NUON_DESDA       AFAVIIYLSARSGRGR----MGEGPDAGEDLDDYRGLAARSPLLAAVMLVFLFSLTGIPP
NUON2_KORVE      AFAVVSHFANTG-------------EKYVTLEDYAGLGRRSPLLAAILTVFLLSLIGIPV
NUON1_ACIC5      IFAVISHVGGYD-------------DRLTLVEDYKGLAYRSPLLGGVMAFFLLSLIGIPF
NUON1_SOLUE      AFAAVSVLTGKG-------------ERYQNIDDFKGMGRKQPLAAAMFTIFLLSLLGVPL
NUON_ANAD2       AFAVVGALERRTRGD-------FEPADAWDLDRFAGLARRRPALAFAMAVFLFSLAGVPP
NUON_MYXXD       AFAIVSVLERRE--D-------EEKGTAWDLERFSGLAQRKPGWAFAMAAFMLSLGGIPP
NUON1_SORC5      AFGTLILCGSRG-------------AEAVSYEDLSGIGKRHPVAALAFSLFLLSLAGVPP
NUON_CHLAD       AFAVLIALEHQG-------------ENAWRLDDFAGLYQRQPLLAVAMAIFMFSLAGVPP
NUON2_ROSCS      AFGVLIALEHRG-------------EAAWDMSDLAGLWSRRPWLAVAMAVCMLSLAGVPP
NUON1_HERA2      AFAVLIALENRG-------------MPVFELSDLRGLGKRSPLLALAMTVFMFSLAGVPP
NUON1_CHLT3      AFGIIILVEQ-------------KHQFS-ELADYEGFFSRAPLLAFLMAMFMFSLAGIPP
NUON_GEOLS       AFAVIVLVGK-------------KGEPNGTVMDYAGLGHKRPLLALAMTVFMFSLAGMPP
NUON_SALRD       AFGVMSMLEWDG-----------KEGREQTLSSLAGIANDRPVLGSTMGVFMLSLIGFPP
NUON_GEMAT       AFGVLITING-------------GRDRAPTLDDIAGLWLVRPWLAIAMTVFLLAFMGMPV
NUON_BDEBA       AFAIAAMLEKSE-------------NHIVNIDDLAGFAKQRPMLALCLTVFLLSLAGIPP
NUON_ACIC1       AFAIVILVRDG-------------DGEANHLSRWVGLGRRSPLVAGIFALFLLAMAGLPP
NUON_RHOOB       AFAVVTLVRDS-------------RGEATDLSRWAGLGRRSPLVGGVFALFLLAFAGIPL
NUON_FRASN       AFAVVSLVRTG-------------DGEASDLSQWQGLGRTSPLLAGTFAFLLLALAGIPL
NUON_MYCA9       AFIIAGLVRSGNADDGADG-DYKDDDEVTDLRRWAGVGRRAPVLGIVFALFLLAFAGIPL
NUON_BEUC1       AFALVALVRERDAEG-------NVTAEASHLAQWAGLGRRSPVVATVFALYLLSFAGIPL
NUON3_STRGG      AFAVVTLVRD-------------AGGEATHLSKWAGLGRRSPLVAAVFAVFLLAFAGIPL
NUON_SACEN       IFGVISLVRTS-------------DGEATHLSDWAGLAKRSPVVAWVFTFLLLALAGIPM
NUON_SALAI       AFAVVTLVRDG-------------DGEATHLSRWAGLGQRSPFYAGLFTFILLAFAGIPL
NUON_NOCSJ       AFAVVTLVR-------------DAGGEAGQFVRWRGIGRRSPLVAGVFAFFLLSMAGIPL
NUON_THEFY       AFAIVTLVRNP-----------DNGAEAGDLTQWAGLGRTSPFLAASLGLFLLAFAGIPL
NUON_CUTAK       FWLLILMVRRA-------------GGESTEIASWAGIGRSHPWIGVLVVIFVLSFAGIPL
NUON_ANOFW       AFAILQVVSQHPD--------------DEDISIFAGLYRRSPLMAIAMTIFLLSLAGIPG
NUON_GEOSW       AFAILQRISDEAD--------------SDDLSHFAGLYQRNPLLAVAMGIFLLSLAGIPG
NUON_GEOKA       AFAIIAHIVNETG--------------SDDLDGLAGLYRHRPFLAAALGLFLLSLAGIPG
NUON_BACAN       AFAIIHGLILQSN--------------KENITIFTGLYKRSPFTAIVMTIFILSLAGIPG
NUON_BREBN       AFAVIMVVSREQE--------------TEDLKGFAGLYHRSPVMAIAMSIFLLSLAGIPI
NUON_PAESJ       AFAVVTVIARAAG--------------HEELKGFSGLYYRAPWTAAAMLIFILSFSGLPV
NUON_DESPS       CFFVVSLISEGNK--------------NLQVTDLTGLYKRSPLLAITFITGLFALAGIPP
NUON2_OPITP      CFVVVCQVSRDGA--------------NVAITELAGLHKRSPLLAVTLIVGVFALAGVPP
NUON1_SYNFM      CFMVIMKVADDGR--------------NLQIKELAGLHKRSPLLAMTLMLGLFGLAGIPP
NUON2_SYNFM      AFLVLVEVASDGG--------------NLRVEELAGLHRRSPILALALMVSLFSLAGIPP
NUON2_DESMR      AFYVVCAIAKNDE--------------NPSLDDLDGLYKRAPALAMILAVAAFSLVGLPP
NUON_BACFR       VFAVISIVEQRSN--------------KVEIDDYNGLYKTNPKLAFIMTLALFSLAGIPP
NUON_BACV8       VFGVISTIEQHTHG-------------KIEREDYNGLYKTNPKLTMVMTLALFSLAGIPP
NUON_AZOPC       AFGVIASVEYQTNG-------------DTRIVSFNGLYRSNPGLAFVMMLAVFSLGGIPP
NUON1_THEYD      AFAMVIAFNE------------------ESIENYKGLHKFHPALAIAMLIFMFSLTGVPP
NUON2_THEYD      AFAFIMNIKNG-----------------ESIQNYLGVGRKNPLLSFCIIVIMFSLTGVPP
NUON_FLAJ1       AFSVILYVCKNQD--------------NEDITNFHGLGKTNPLLAAILTGSLLSMGGIPI
NUON_FLAPJ       FFAVVMYVTKDKE--------------NETINSFNGLGKTHPLLAGILTAALLSMAGIPV
NUON_CYTH3       AIYIVQVVEKSKG--------------DARVENFSGLGKSNPFLAFVLSLSLISLAGIPP
NUON_LEPBA       AFAIISYLE--------------QGKHEVTVNGISHLSGEHPFTALALSLVFLSFAGFPP
NUON_LEPIN       AFAILAYLE--------------EGTRQVTFFSVQSLSGVKPLTAIAINIFFMSLAGVPP
NUON1_AQUAE      AFTVLAILE-------------KKEGWTHHFLDFKGLKEENPVLASMLALFLFALIGIPP
NUON2_HYDS0      AFLVLSILE-------------KNQSWTHDMSNYRALYKRSPFLATALALFLFALIGIPP
NUON2_AQUAE      AFLVLALME-------------KNPEWQNYMENFYGLRFNAPYIAFAFFVYMVALLGVPP
NUON1_HYDS0      AFLVLSVLE-------------QSDEWNNQLSEIGGLYRNTGFLSISFAVFIFALLGIPP
NUON_PERMH       GFILLSALE-------------KNHNWSNHIDDFKGLAKRSPMMALFMLIFMFSMLGIPP
NUON_CAMC1       AFSMLWVARCDDVVC-------WDKRFKHPYEKFSGLIKILPSYAVIMGIFMIALAGIPP
NUON_CAMHC       AFSVLWFTR-NKQNI-------WHERFDHPFEKFNGLVKFLPYTSFLMALFMISLAGIPP
NUON_SULDN       SFSMLWISR-QKNLP-------AHQQSDHSYDKFAGMVKTSPVAASIMALFMLSLAGIPP
NUON_WOLSU       AFTMLWVSR-SKINH-------WNHRYDHPYERFSGMARIMPVGAILMGIFMLSLAGVPP
NUON_SULNB       AFAMLWMSR-HKNRR-------FNARFDHPYEKFAGFIKIMPMGAVIMAIFMLSLAGVPP
NUON_HELAH       AFGLLWLLK-SREKT-------WDERYDHPYSKFDGLIKTHPLVAILGAIFVFGLAGIPP
NUON_HELHP       AFGILWLSV-DCKKN-------YQTQISHPFEKFSGMIKTNPTLAILLTLFMFALAGIPP
NUON_CAMJR       VFMILSNYE------------------NNSYESLNGLLVKKPLIAFCLSISVLSLAGIPP
NUON_CAMLR       IFLILSLFQ------------------KSSFESFSGLFDQRPVLSIMLAIFILCIAGIPP
NUON_BUCAI       CLGIVNLISTSHI-----------NNNASSINSYRGLFWSHPLLSSVLTLVLISSAGIPM
NUON_BUCAP       YFGVINLFSNSC------------DYDIDSIHLYKGLFWVQPLLASIVTIVLLSLGGIPI
NUON_BUCBP       MFGIMSVLSSLYK-----------NFNVDSIFSYRSLFWSSPILSGVMTVVMLSLSGIPM
NUON_BUCCC       FFSIKSIIDINFIER---------KNNLLKENSLIGLFWYNPILGILMSIILLSLSGFPI
NUON1_NITOC      AFGVVTVLSSPTQ-----------EKEN--LEDYRGLFWHRPGLAGIFTFMLLSLAGIPL
NUON_NITMU       AFGVVTVLSEGFNGGSAGEFHDAGEKDSDRLADYAGLFWHRPWLAGVFTAMLLSLAGIPL
NUON2_ACICJ      AFGIVALLSAPGA-----------GRDADRIEDYRGLFRTRPFLAASLALMLLSLAGMPP
NUON_METCA       AFGAISALSDDDR-------------ESDRLSDYAGLFWRSPWLAAVLTLSLLSLAGIPL
NUON_PSYA2       AFGVVTLMSSPYRL----------SGEADELTHYQGLFWRRPVLTAVMTIMMLSLAGIPL
NUON_ACIB5       AFGAVALMSSPYNN----------VDEAQSLADYRGLFWRRPVLTATLTVMMLSLAGIPL
NUON_AERHH       AFGVISMMSSPYRG-----------KDADSLHSYRGLFWRRPYLTAVLTVMMLSLAGIPM
NUON_TOLAT       SFGVVSLMSSPYQE-----------RDADELPAYRGLFWRRPILTSAMTIMFLSLAGIPM
NUON_CHRSD       AFGVVTLLSSPYSG-----------ADASQLHHYRGLFWRRPYLTAVLTVMMLSLAGIPF
NUON_PSEMY       AFGVITLMSTPYSG-----------RDADALYEYRGLFWRRPYLTAVLTVMMLSLAGIPL
NUON_HAMD5       VLGVVSLMSSPYKG-----------ADAEALFSYRGLFWHRPILAAVMTIMLLSLAGIPM
NUON_ECOLI       AFGVVSLMSSPYRG-----------PDADSLFSYRGLFWHRPILAAVMTVMMLSLAGIPM
NUON_PROMH       AFGAIAVASSPYNK-----------GELESLEDYRGLFWRRPVAAVVMSLMMLSLAGVPI
NUON_BLOFL       VWGIVNIVSTAYIQK--------EKNDADTIYLYHGLFWREPMLSVIFVIAILSLAGIPM
NUON_BLOPB       AFGIINIVSFFYAH---------EDTDVDSLFVYRGLFWHQPMLSVLFTIIILSLAGIPM
NUON_BAUCH       VFGVISIMSNVSKK------------DTDLIGYYRGLFWYQPMLSVVMTVMMLSLAGIPM
NUON_SHEWM       AFSILMKLE-----------------GGKSLEALTGLFWSKPLHAASLSIVMLSLAGIPL
NUON_RICBR       FFTCLIMLLGNQT-------------DKANFESIQGIAENHKAIAAAICIIMFSMIGIPP
NUON_ORITI       FIAIIINNFTNRA-------------NYLKISHLSGLSNVKKLSSILIAIQMFSLVGIPP
NUON_ARCB4       AFGLASHIISETN-------------VKVTFDDFKGLAKQRPFLAAMMTIFLLSLAGIPS
NUON_PELPD       ACACFSILSGED----------------DNLDNLNGIFRKKPVAAILLSLCVLSLAGIPP
NUON_NEORI       ILSVVLMLKDKH------------------ITSLKKLRCSNNLVALAFVLLLFSSAGVPP
NUON_DESAP       LFFIAGGVSWETG--------------VRRVSDFVGIAKKMPLTMGAFVAAALSMIGLPP
NUON_CAMFF       LFAILNGLFGDRE---------------IKISDLNGLYKVRPTEAFAFTVICLSFIGFPY
NUON_SALTO       AFAAVVALRPAGA-------------DGGTLDELRGAARRRPWAAVGLALALVGLAGLPP
                                                                         . * 

NQO14_PARDE      TLG--FFAKFGVLTAAVDAG-------MGWLAVLGVIASVIGAFYYLRIVYYMYFGGESE
NUON_JANSC       LLG--FFGKYAVLVAAVDAG-------LVWLAIAGVIASVIGAFYYIRIVYLMYFGEADE
NUON_AZOC5       LAG--FVAKYYVFLAAIQAG-------LYGLAVIGVVASVVGAYYYLRVVKIMYFDEPAE
NUON_BEII9       LAG--FFAKWYVFNAAIQAH-------LYPLAVIGVLCSTVGAYYYLRIVKVMYFDDPAP
NUON_METNO       LAG--FFAKFYVFAAAIKAG-------LNVLAVIGVVTSVVGAYYYVRIVKIMYFDDAQA
NUON_PARL1       LAG--FFGKFYVFMAAVEAG-------LYPLAVIGVLASVVGAFYYLRIVKIMYFDEAAE
NUON_MAGSA       LAG--FWGKFYVFMAAIESG-------LYTLSILGVLSSVVSTYYYLRIVKVMYFDEPVE
NUON_RHORT       LAG--FFGKFYVFMAAVNSG-------LFALAVIGVLSSVVAAFYYLRIIKLMYFDEATE
NUON_RHOCS       MAG--FFGKLYVFMAAIEAQ-------LYVLAVIGVLTSVISLFYYLRIVKVMWFDDLME
NUON_BARBK       MAG--FFGKWYTFSAAVRAG-------LVPLAIVGMVLSVIGAFYYLRIIKIMWFDDAKD
NUON_RHIEC       LAG--FFAKYFVFVAAIEAK-------LYALAIIGVLASVVGAYYYLRVIKLMWFDEATG
NUON_GLUDA       LAG--FFGKMMVFYAAINAH-------LFGLAAIGVVSSVIGGYYYVRIVKVMFFDDAA-
NUON_GRABC       MSG--FFGKLYVFLAAVQAGE----PLLWGLAVIGVLTSVIGAYYYLRVVKVMYFDDASE
NUON1_ACICJ      LAG--FFGKFYVFAAAINAG-------LGPLAVLGIITSVIAAFYYLRVIKVMYFDAGE-
NUON_SPHWW       LFG--FWPKFLVFDALVRAG-------FWPLAMVGIATSVIGAFYYLKIVKTIYFDDPAP
NUON_SPHAL       LFG--FWPKYLVFEAAVNAN-------LVPLAVAGIVASVIGAFYYIAIIKTMYFDDKSD
NUON_ERYLH       LLG--FWGKFVVFQAAVQAD-------MVLLAALGIAASVIGAFYYIKFVKVMFFDD-AV
NUON_CAUSK       FSG--FWAKFYVFGAAMGSGD----VLLQWAAVLGLVGSVVAAFYYLRLIKAMWFDAP-A
NUON_MARMM       MVG--FFGKFFVIYAAVQAD-------LMILAVLAVLFSVVGAAYYLRIVKVIWFDSS-E
NUON_HIRBI       MAG--FLGKWVVFEAALKSE-------LYWLVAVGVIGSVVSLGYYLRLIWAMWAKTSDE
NUON_HYPNA       FGG--FFGKYEVLRAGVEAE-------LVPLAIILVIASVVSLGYYLRLLKVMWFDEP-K
NUON_PELUB       LAG--FFAKFYIFKAVIEQS-------MYFLAIVGLLSTVIAAFYYLKIIKVIYFDKEKE
NUON_MAGMM       LAG--FMAKLQIFMAAIDAH-------MYTVAILGVLFSAVSAFYYLKVIKTMYFDEAER
NUON_AZOSB       FIG--FFAKLAVLQAVVAAG-------YIWVAVVAVLMSVIGAFYYLRLVKVMYFDEPAD
NUON_DECAR       FIG--FFAKFSVLQAVVAAGP----G-YMWLAIVAVLFSLIGAFYYLRVVKLMYFDAPAD
NUON_NITEU       MIG--FYAKLSVLQAVLEAG-------YIWLVVVAVMLSLIGAFYYLRIIKFMYFDAPEQ
NUON_THIDA       TVG--FYAKLAVLQAVVEIG-------YVWLAVAAVLFSLVGAFYYLRIVKLMYFDTPQD
NUON_METGS       TLG--FYAKFAVLQAALQAG-------FVGLVIFAVVMAAIGGFYYLRVVKLMYFDEPLD
NUON2_NITOC      TVG--FYAKWAVIMAIIDKE-------LLWLAVVAVLFSVIGAFYYLRVIKFMYFDSPTE
NUON_THISH       TVG--FYAKLAVLQAVVQVE-------MIWLAIFAVIFSIVGAFYYLRAVKIMYFDKPED
NUON_ACIF2       TVG--FYAKLAVFQAVVAAG-------YVWLAVVGVLLAVIGAFYYLRVVKVMYFDKPAP
NUON_ALKEH       TVG--FYAKWLVIKSVVDVG-------LVWLAVFAVVFAVIGAFYYLRVLKFVYFDKPET
NUON_HALHL       TVG--FYAKYLVLQAAVEAG-------HIPLAIFAVVAAVVGAFYYLRVLKVVYFDRPEA
NUON_LARHH       LVG--FYAKFAVLEAAVNVG-------LTWLAVVGVVMSLIGAFYYLRVVKAVYFDEATG
NUON_NEIG1       LMG--FYAKFGVIMALLKQG-------YVWLSVFAVVMSLVGAFYYLRVVKVMYFDE-SG
NUON_HERAR       VVG--FYAKLAVLQAVLSTGQ-------IWLAVVAVLFSLIGAFYYLRVVKVMYFDEPA-
NUON_POLNA       LVG--FYAKLGVLQALISSGQ----TSYLVLAVFAVFMSLIGAFYYLRVIKVMYFDAPHS
NUON_BORA1       LVG--FYAKLAILQAVIESGH-------VALAVVAVLFSLIGAFYYLRVVKVVYFDEPVA
NUON_PARP8       AVG--FYAKLAVLEATMNAGL-------TWLAVLAVITSLFGAFYYLRIVKLMYFDDPVD
NUON_CUPTR       TVG--FYAKLAVLDAVVQAGM-------TWLAVVAVLFSLIGAFYYLRIVKLMYFDAPVG
NUON_POLNS       TVG--FVAKLGVLEALVDAEH-------SFIAVIAVIASLIGAFYYLRVIKVMYFDEPEH
NUON_RUTMC       LVG--FYSKFFILQQVVSAG-------FITIAVIVVIFAVISAYYYLQIIKSMYFDETDK
NUON_HYDCU       FVG--FYAKVVVIEEVVQAG-------FTWLAVLAVVMAVISAFYYLRVVKVMYFDEPED
NUON_COXBU       LVG--FIAKVGVLDALIQVH-------LVWLAVLAVLFAIVGAYYYIRVVKVMYFESAPP
NUON_LEGPL       TVG--FFTKLLVLKALVDVH-------MTWLAVVGLLFTVIGAYYYLRIVKIMYFDQ-PE
NUON_XANC5       FLG--FWTKLAVLGAAVKGD-------MLWLALVGVICAVIGAYYYLRVIKVMYFDEPVG
NUON_FRATF       FGG--FIAKLFVVMGLINDGN-------YFLACFVLFMAVIASFYYVRVIKTMYFDDPDN
NUON_EHRCJ       LAG--FFAKYDVLSSLVENGFI--KIA-----VTFALVSAVSCYYYLKIIKVMYFDLSDS
NUON_WOLTR       LAG--FFAKLFIFKSLVNSGFI--GMS-----LIFIVASVISCYYYLSIIKAMYFDKP--
NUON_ANAPZ       FSG--FFAKYTLLKAIGGVDAF--GVPTLVCVVFLCLTSIIPCFYCFRIAKVVYFDVPT-
NUON_ANAMF       FLG--CWPKYFFLKSIVMSDIP--TVVAFPYVLLVCAVGIVPCFYCFRIARVVYFDQPAM
NU2C_NOSP7       LAG--FFGKIYLFWAGWQ-------AGLYWLVLLGLVTTVVSIYYYIRVVKMMVVKEPHE
NU2C_SYNJB       LAG--FFGKLYLFWAGWQ-------AGAYTLVLVGLVTSVISIYYYVRVVKTIVVKEPQE
NU2C_GLOVI       LAG--FFGKLYLFWAAVQ-------SQAYTLVFFGLVTSVASIYYYVRVVKLMLVKEP--
NU2C_PROMA       MLG--FFGKIYLFFAGWS-------DGQYLLVIVGLVTSVVSIYYYISVIKMMVVKEPQE
NU2C1_ARATH      LAG--FFGKLYLFWCGWQ-------AGLYFLVSIGLLTSVLSIYYYLKIIKLLMTGRNQE
NU2C1_COFAR      LAG--FFGKLYLFWCGWQ-------AGLYFLVLIGLLTSVVSIYYYLKIIKLLMTGRNQE
NU2C_ADICA       LSG--FFGKLYLFWHGWK-------AGLYSLVLVALVTSVISIYYYLKIIKLMFTGKSGR
NU2C_CHAGL       FAG--FFGKIYLFWSGWQ-------AGLYILTFVGLLTSVISIYYYLRIIKIMFVREAKE
NU2C_CHAVU       LTG--FFGKILLFWSAWQ-------SGFYFLVMTGIFTSIVSIYYYIRIVKFLVVAKEKD
NU2C_STAPU       LAG--FFGKLYLFWCGWQ-------SHLYLLVYTGLITSVISLYYYLRVVKAMMTKEVKE
NU2C_CHLAT       LAG--FFGKLYLFWSGWQ-------SGFYILVFIGLFTSVISIYYYLRVIKVMIVTEPQE
NU2C_NEPOL       LAG--FFGKMYLFLAAWD-------AGQYSLVWVGLITSVVSIYYYLSVVKIMLVPATQE
NUON_ANADF       FAG--FVGKWYLFYAVFERIDGPGGAWYAWLALIGALNTAIALYYYVRVIRAMFIDAP--
NUON2_SORC5      TAG--FIGKFYLFSALL----AAGGAWSWVIAVVGVLNSVISLFYYARLLRTMYLDRS--
NUON_CHLCH       TIG--FIGKLMVFSALI-----AKGSIFMWLALIGILTSVISLYYYMLIPLNMYLREPVQ
NUON2_CHLT3      TVG--FIGKLMIFSALL-----AKGPVFVWLAVIGVLTSVVSLYFYFKIPLNMYLRES--
NUON_CARHZ       LAG--FAGKFYLFYPII--------KNWGWLALLALIMSMVSVYYYLRVVLVVYRDE---
NUON_DESRM       LAG--FVGKFYLFKTVV--------ENHMWLVYLGLIMSMVSVYYYLRVALVMFRDE---
NUON_DESHD       LAG--FVGKFYLFSAVIN-------QGHVWIAVIGFVMSMISVYYYLSIVKIMYLGD---
NUON_HELMI       LAG--FVGKLYLFSAIMD-------KGVLWPAFLGFVMSMVSVYYYLNVSLYMWRDD---
NUON_CLOB8       LAG--FIGKFYLFLSIIE-------KGQIWLAFLSIGMSVISVYYYLKVVKVMYFGES--
NUON_MOOTA       MAG--FVGKFYLFMSIIS-------RQYIWLAILGILMSMVSVYYYLLVAKAMYLGNP--
NUON2_SYMTH      TVG--FLGKFFLFRAAAA-------SGYLWLAVLMAVNSVISVGYYYRVVKVMFLDQS--
NUON_DEHMB       LAG--FLAKYYIFSAAVQ-------ADLLWLMIVAAVNTVISAVFYFNVIRVMWLRQPR-
NUON_METI4       LMG--FFGKLMVFFAAWDSG-------QHLLVIVGALCAAAGLYYYIGVVRAMFWTE---
NUON1_OPITP      LAG--FMGKLFVFIAAFKAG-------FYGLLAVAIVGVVISIYYYFGWIKAAFFETWTP
NUON_RUBXD       LSG--FFGKAWVIYAGAGSGS----ALVYVAVAALVVNSVLSVPYYFGIIRNMFQEE---
NUON_RHOP5       AGG--FVAKLYLFKALVQS-------ESWILLAIAMVGAALGFYYYIRFFTAPFFGHGG-
NUON_RHOS5       SAG--FFGKYVIFTALIEG-------RAWALLALAIAGSALGAYYYLRFVALIFRRAPD-
NQO14_THET8      LAG--FWGKYLAFAEAARA-------GAWGVLVLALVTSAVSAYYYLGLGLAVFARPEE-
NUON1_STRGG      TAV--FVGKLEIFTAAMDG-------GLAWLVVIAALNTLASLFYYLRWITPAF-RPAED
NUON_MYCSJ       TAV--FIGKVTTAAAAWDG-------RYAWLAVVVFVNTLVSLFYYLRWIIPAFGRPHET
NUON_DEIRA       FAG--FFAKYLAIQVAFQA-------GYLLISVLAVLSSVAALVYYLRPAMLMFMPDRTP
NUON_GEOMG       TVG--FVGKFAIFFAALKG-------GEAPLAVIGILTAAASAYYYLRVVVNLYMKPA--
NUON_GEOUR       TAG--FIGKFFIFYAAFRG-------GEIPLAIVGILAAAVSAYYYLRVVVNLYMHAG--
NUON_GEOBB       TGG--FIGKFFIFYSAIKG-------GETALAIVGIISAAVSSFFYLKVVASLYMHRS--
NUON_PELCD       LAG--FMGKFVLFGAALQS-------GYVGLVVLALLSSLISCYYYLRPVLYLFRVRQ--
NUON1_DESMR      TAG--FVGKFLVFGAALSA-------GYVGLAAFGIITAVVGVFYALRLLAALYMRESLI
NUON_PARUW       TAG--FLAKFYVFKVAFQA-------GYYGLVIVGLLTTILSSYYYLRIIGILFSESKND
NUON1_SYMTH      TGG--FVGKFLLAIAAVRG-------GAWIVLTGLILSTGISAYVYLKVIGTAFTRTKVA
NUON_CHLSY       LGG--FFAKFYIFMAGWQS-------GATWLVVIAVVMTIVSLYYYLRLLKAMFIEP-AR
NUON1_ROSCS      LAG--FWAKFFVFMAGYQA-------GAVPLVTIAVIMTVVSLYYYLRFLKAMWILP-AP
NUON2_HERA2      LSG--FFVKFYVFIAAWQE-------GAKWLVIFAVSNTVISLYYYLRFLKAVYFAP-AE
NUON2_ACIC5      LVG--FFAKFWLFAAALQAAP---AFGLLWLVILAILMSVVALFYYLRVLRQVYVVPMAE
NUON1_KORVE      LAG--FWGKYYIFLSLMETG-------HYTLAVVAVLFAVLGMYYYLRIANAAFMREAV-
NUON2_SOLUE      TAG--FLGKYYIFLALIQTG-------HTGLAIVATLYVAVAIYYYFKIVRSMFIREEM-
NUON2_RHIME      TAG--FFAKFYVLVALVERG-------FVALAVIAVLLSVVSAYFYIRIVMVIYMREP--
NUON_THERP       LLG--FYAKYYVILALIEAG-------QLWLAVAIVVMSAVSAFFYLRVVTRMYFEEP--
NUON_DESDA       TAG--FMGKFMLFRAAFAAG-------YQITVVVAVVCSTISAWYYLGVAKRMYMQDSQD
NUON2_KORVE      TGG--FFAKFYVFTSALQSH-------LVWLTIIGVINSAVGAYYYLRIIVYMYMRDERE
NUON1_ACIC5      TGG--FFGKFYVFSAAIHSG-------MIWLAIIGLINSGIAVFYYLRLLTATYSKPAES
NUON1_SOLUE      TGG--FFGKFYIFKAALDSH-------LIWLTVLGLLNSAVGAYYYLRILVVMYMYEPGE
NUON_ANAD2       TAG--FIGKFYIFKAAMGAG-------LYGLAVLGVLTSVLGAYYYLRVVLYMYFL-PSK
NUON_MYXXD       TIG--FMSKLLIFQAAVDAG-------LIGLTIVGVLSSAVGIYYYLRVVVYMFMR-PVP
NUON1_SORC5      TAG--FFGKLYIVKAAMGAE-------LYTLSVALLLNSVLSAYYYLRVLVYMYMREPAP
NUON_CHLAD       MAG--FMAKFYALTAAWEGG-------LPWLALVGVVTSAIAAFFYLRVIIRMFMT-EPE
NUON2_ROSCS      TGG--FWGKFYVFTAAWLSG-------MGWITVIGVIVAAIAAFYYLRIVAQMFMA-EPA
NUON1_HERA2      TAG--FASKFGIFRAAWDAN-------LDYLAIIGVVTSVISAFFYLRVIVTMWMR-DTE
NUON1_CHLT3      FGG--FIAKYNVFSAAVQAD-------MTWLAVAGVIASAVSVSYYLRVVIAMFMKDTKK
NUON_GEOLS       TAG--FIGKFYLFSGAVQAG-------YIWLAIIGVLNSAASVYYYLRVIVYMYFKPGEE
NUON_SALRD       LGG--FIGKYLVFAPAVDAG-------LTWLVVIGVLMSALSAYYYLRVVYVFWMQSADE
NUON_GEMAT       LGGMGFFAKWYILQAALQAPA-----PQTILAVVLVIASAVSAAYYLAVVSAMFMRPRPE
NUON_BDEBA       TLG--FFGKFYMFNAAIGEG-------LLWLAIWGMLNSVIGVYYYLRPIVVMYMKEGNA
NUON_ACIC1       TSG--LWAKVAVFTAAYQGG-------AGPLVIVGVLASAVTAYYYLRIIVLMFAQEPA-
NUON_RHOOB       TSG--FVSKFAVFQAALEGG-------AVPLVLVGVVSSAIAAFFYVRVIVLMFFSEPQ-
NUON_FRASN       TSG--FTGKFAVFQAAIAGD-------ATPLVVVALVCSAIAAFFYVRVIVLMFFSEPL-
NUON_MYCA9       TSG--FVSKFAVFEAAAAGG-------AMPLVVVGVMCSAIAAYFYVRVIVVMFFADPV-
NUON_BEUC1       TSG--FVGKFVAFAAAIDGG-------AWPLVVVGVLASAAAAFFYVRIIVLMFFTSPAE
NUON3_STRGG      TSG--FSGKFAVFKAAAEGG-------AGALVVVGVLSSAVAAFFYIRVIVLMFFSEPK-
NUON_SACEN       TSG--FVGKFVVFEAALADG-------MAPLVVVALVASAVAAFFYLRVIVLMHFSEPA-
NUON_SALAI       TSG--FTSKFAVFSAAFDGG-------QGWLVVAGVLTSMVLAFPYLRVVVLMWLSEPG-
NUON_NOCSJ       TAG--FVGKWAVFTVALAAG-------AWPVVIAAVLCSIIAVFFYVRVILLMFFEDDDV
NUON_THEFY       TSG--FIGKFAVFEAAVAAG-------ATPLVVVGVLSSAVTAFFYVRIIVLMFFAE---
NUON_CUTAK       TAG--FTGKLVVFLAGWRGG-------YAWLVLIGVLFSLVAAAFYLRIIVVVFFRSAK-
NUON_ANOFW       TAG--FIGKMNIFLGAFVVEP-----AHYVLASIMVITTIISYVYYFGIFVQMFFRP---
NUON_GEOSW       TAG--FIGKLNIFLGALMTEP-----GHYVLAAVMIATTVVSYVYYFGIFVQIFFRP---
NUON_GEOKA       TAG--FIAKLHIFIGLVVTEP-----GHYVLAAVMAITTVISYVYYFNLIVQLFFRP---
NUON_BACAN       TAG--FIGKINIFLGALHVEP-----AHYVLASIMMGTTVISFVYYFRILQQMFFRT---
NUON_BREBN       TVG--FFGKFYLFMGTLVVE-------NYWLAAIMIITSVISYYYYFGIIRQMYMRP---
NUON_PAESJ       TAG--FFGKLFILLGAASVK-------AYWLVAIMVVSTVISYYFYFGIIRQMFMRSN--
NUON_DESPS       FIG--FTGKFMLLAGALKAG-------HLITVILATFNTALALYYYLNLVRVTFCTDE--
NUON2_OPITP      FVG--FMAKLNLLTSAWQAG-------HTALVVLTVINSAIAIYYYLQIVRAAFFAES--
NUON1_SYNFM      TVG--FTGKFLVFAAALRKG-------YLILVIIGMINATISLYYYLIVIKAAYLLEP--
NUON2_SYNFM      TVG--FTGKFLVFVAAMGEG-------HFTLVLIAMINVVISLYYYLLVIKAAYLLEP--
NUON2_DESMR      TAG--FAGKLFLLSAAWDQG-------YHWLVIVAVLNTAISIYYYLSMVRHAYTGES--
NUON_BACFR       FAG--FFSKFFIFMAAFNSGF----HLLVFIA---LINTVVSLYYYLLIVKAMYINP-N-
NUON_BACV8       FAG--FFSKFFVFMAAFHSGY----YLIVFIA---LVNTIISLYYYLLIVKAMFITP-N-
NUON_AZOPC       FAG--FFSKFFIFMAAAEQKQ----YILVFIA---LLNTVMSLYYYLLIVKAMFIEKRG-
NUON1_THEYD      TAG--FIVKFNIFLQAVKAGF----TWLVVIA---VIFTVISAYYYLRIVMYMYMKE---
NUON2_THEYD      TAG--FIVKFNLFKNLLSYGY----GSLVFFA---LLMSIFSAFYYLRPVFYLYKDS---
NUON_FLAJ1       FSG--FFAKLFLFNQALHAGY----VAIVIAA---VINSIISVGYYFKLILAMYSKE---
NUON_FLAPJ       LSG--FFAKFFLLNQLVYTDW----LIVVFVA---IISSIISVGYYFKIIIAMYTKE---
NUON_CYTH3       AAG--FFGKFYLFTEVIHAGN----IYLVLIA---ILGSLISVYYYFKTIIAMYSGE---
NUON_LEPBA       LIG--FWTKLFLLQKMAESDL----FFHRVLLFGAVANSCIAFYYYMKITIQSYMKQET-
NUON_LEPIN       FGG--FWAKLFLFQKLAESET----LMNRILLIGGVTNSALALYYYLRIGIATFMSSDE-
NUON1_AQUAE      AAV--FLGKLGIFFGLVKTDM----FALGILF---AIASLISAGYYLKVIVYMFLYSGE-
NUON2_HYDS0      FAT--FVGKLGIFLGLVNSNA----WFFAILF---VIGSIIAAGYYLKLIVYMFFKEPA-
NUON2_AQUAE      TVG--FVGKALVFMALSFDKL----WWLAFIM---ILSAAISTGYYIRLVVVMYMHERE-
NUON1_HYDS0      TIG--FVGKALVFLGLAIKNI----YWLGFVL---ILATAISTGYYVRIVVLMFMKDVE-
NUON_PERMH       TVG--FMGKLGVFLALIGSDI----WWLAVTL---VVMSIVSAGYYLRVVIYMYMYEPV-
NUON_CAMC1       FSV--FWGKMVLISSLIKSDY----VVLSLII---MINSAIAIYYYLKLIVFMFLKEPI-
NUON_CAMHC       FSV--FWGKMYLMGSAISSGF----IFMAVIM---AINSAIAVYYYLRIIVCMFLKEPL-
NUON_SULDN       FAL--FWGKMYLMSSAITGGY----TVLALIM---ALNSAIAGYYYLKLIVYMFMKDPV-
NUON_WOLSU       FAV--FWGKMYLMSSALNSGF----IVLALIM---AVNSAISAYYYLKLIIYMFLKEPQ-
NUON_SULNB       FSI--FWGKIYVMQAAVNSGY----VWLAIVM---GLNSAIAAYYYLKLVVYMFLKDPV-
NUON_HELAH       FSV--FWGKFLAVESALESNH----ILLAAVM---LANSAVAVFYYFRWLVAMFFNKPL-
NUON_HELHP       FCV--FWGKMYLMQSAISANY----TILALIM---AINSIIAGFYYLKLVIYIFAKEPY-
NUON_CAMJR       FGV--FWGKFMILNTVILNGY----WYLALFV---ALSSVIMLYAYLKILIHVLFMKND-
NUON_CAMLR       FGI--FWGKILILASILNSGY----YALVFAV---ALSSMIMLYAYLKILIYVFFKKAQ-
NUON_BUCAI       TLG--FIGKFYILSIVMIEHL-------WLIGFAFLIGSLLGLYCYLRIILNLYLHPSKL
NUON_BUCAP       TLG--FFGKFCIFSIIIKNHL-------WTIGASFLIGTILGLYGYLRLIVNMYLNPSEQ
NUON_BUCBP       TVG--FLGKFYLMSLVVKEHM-------WLFICLFIISTIIGFCAYLKIISCLFVAPSDS
NUON_BUCCC       TLG--FWGKFFIFKHLIQKKF-------FITTLLIMLSNIVGMQNYLYIIRSLYIKPIKF
NUON1_NITOC      TVG--FIGKFYIFAAGVEATL-------WLLLFTFVMGSILGLFYYLRIIIALYQ-T-PT
NUON_NITMU       TMG--FIGKFYIVTAGVEASL-------WMPVITLVIGSIIGLFYYMRIIAVMYGWG-PE
NUON2_ACICJ      TMG--FIAKFYLVVAGVGTAL-------FWPVAALLLGSVIGLYYYLRILVAMAL----P
NUON_METCA       TVG--FVGKFYVFAVGVQAET-------WPLVATVVIGSGIGIYYYLRVVLTMIQ---PA
NUON_PSYA2       TAG--FITKLFAILAAVQGTN-------WFLAAMIILGSAIGLFYYLRVLLTLFKRP---
NUON_ACIB5       TAG--FIGKFLVVMAAVTTQH-------WFLAAMIIVGSGIGLYYYLRVMVVMYMTP---
NUON_AERHH       TLG--FIGKFYLIGVTVDAKL-------WWLSGAIVLGSALGLYYYLRVMVTLYLRE---
NUON_TOLAT       TLG--FIGKFYILAVGIQFHL-------WWLTGAVVFGSAVGLYYYLRVISILYLKT---
NUON_CHRSD       TAG--FIGKFYIVAVGVEASR-------WWLVGGVVAGSAIGLYYYLRVMVTLFLPE---
NUON_PSEMY       TAG--FIGKFYVIAAGVEAQL-------WWLLGAMVLGSAIGVFYYLRVMVTLFMRE---
NUON_HAMD5       TLG--FIAKFFLLLTAVNTHL-------WVLTATVVIGSAIALYYYLRITVSLFLSP---
NUON_ECOLI       TLG--FIGKFYVLAVGVQAHL-------WWLVGAVVVGSAIGLYYYLRVAVSLYLHA---
NUON_PROMH       TLG--FIGKLYVILAGIDSSL-------WWLTGMVVLGSAIGLFYYLRAAAIVFLRK---
NUON_BLOFL       TFG--FIGKFYLLFIGISNQL-------WFLTVMMIISSIISMFYYLKIITNLFNSNFVN
NUON_BLOPB       TLG--FIGKFYLFVLGIDSKL-------WWFTIFIAMSSVISIFYYLRIIINLYLSP-IN
NUON_BAUCH       TLG--FIGKFYIITLGINNNL-------KLLTILLLISTMISMLYYLRIVVSLYLYP-AE
NUON_SHEWM       TLG--FMGKFYLVTASVSYQV-------TWPLPFLVIASVIGLFFYLRVIMVMLSAT---
NUON_RICBR       LAG--FLGKYYLFYQAITQEE-------FLLAYFGIFTSVIAAFYYLKIIKTMYFAEKP-
NUON_ORITI       FAG--FISKYIIFTSILKSGM-------YELIIMGIAAVVIGSYCYLNIVKVMYFLPATV
NUON_ARCB4       TIG--FIGKIYVFTEAIASGY-------TLLTVIAILATIVSVYYYFRLIAVMYFYPAPD
NUON_PELPD       LPG--FLAKFFVFKTVIASGH-------LTVAVLAFVASYIGTFFYLGVVLRMFRSDAET
NUON_NEORI       FIG--FWSKAYVVKTLVETNH-------IPTAIFSMLAGVISAFYYARIAKETYFTNMAE
NUON_DESAP       TLG--FFSKWYLVLGCLEAGA-------WVFVAVLVVSSLLTAVYFFRVIENAYLKGLPQ
NUON_CAMFF       SVG--FLGKLFIFSSAVESGK-------TYLAIFGIINTIFSVYYYLKIIISIYFSENK-
NUON_SALTO       GLAG-LFAKVTVVRSLLDGGA-------AGLALVVAVNAVLGLAYYLRVVAALWSTDRPA
                         *                                                   

NQO14_PARDE      G-M---------------------------TSRMGAVQYLALMVPALAMLVGAISMFGVD
NUON_JANSC       GAL---------------------------DGKMGLVPYVGLIAMALVIGLGWVPGVNL-
NUON_AZOC5       AF----------------------------DGMPGELKAVLAVSGLFTTFFFLAPTPLI-
NUON_BEII9       AF----------------------------DRPTPTLAAVLIVTGLAVLLLCVYPGSFV-
NUON_METNO       AY----------------------------EPLAPGLRIVLAASSVVVVLFWIVPAPLV-
NUON_PARL1       PFI---------------------------QPMPGELTAVLGISGVFTLFFFVYPAPLI-
NUON_MAGSA       AFD---------------------------KPVGTSMTLVMAVSTIVILAFTLIPAPLV-
NUON_RHORT       PLD---------------------------ALSGTTMKVILIGTAAVVALFFLAPSVVV-
NUON_RHOCS       TIE---------------------------RPARASALVIGGTALFVFPVFYVFSEGIL-
NUON_BARBK       SF----------------------------VILSNEIKLCLCLSALFVLFYVFFGFWFS-
NUON_RHIEC       EF----------------------------ARVSSALRLVFGLSGLFVTAYVLIGGPIG-
NUON_GLUDA       APL---------------------------DRRPLSLSFVSVGMGIATTGFLLVLGPVS-
NUON_GRABC       GPF---------------------------EAWPTSVSVVAVGSAIFTALFFLFPAPIL-
NUON1_ACICJ      PGL---------------------------DRRSAGVSLVMGAAAAFTVLFVFHPSTLT-
NUON_SPHWW       AEF---------------------------APAASKLEGGLITLAALAVSPLGYLAIPL-
NUON_SPHAL       VEV---------------------------TGGGNAVEGTIVAASALWLLAVGYLFIPA-
NUON_ERYLH       DRV---------------------------KGTSDTAHWVLLILAAVVVSPLGYLLTGW-
NUON_CAUSK       GAV---------------------------DKPQPTARAVGFAAALFSFPVVMVALIWLD
NUON_MARMM       IEF------------------------------VPSAVSTYWIARIAGLATVLLLPVLGW
NUON_HIRBI       EAL---------------------------EPADGMVSVSIYGATILAFPVLVIWIGWM-
NUON_HYPNA       ETF---------------------------ERVDVTVLGTVVACAVIAGVVFMIFIGELG
NUON_PELUB       SYD---------------------------TDHNIWLKGSLTFSTLLILLYFIFPSKLL-
NUON_MAGMM       AFD---------------------------MPMDFLSRAIVGVSGILVVLWGILPGSLM-
NUON_AZOSB       AT--------------------------PIQAPAEL-RVFLSANGLAIAAIGLAPQGVM-
NUON_DECAR       ET--------------------------PLSAPMDM-RILISANGLAVALLGIFPQVIM-
NUON_NITEU       TQ--------------------------PIMFKPDV-KVLVSINGLAIILLGMFPQMLM-
NUON_THIDA       TA--------------------------PIAPGIDA-RLLMSANGLAVLALGILPQPLM-
NUON_METGS       NT--------------------------PIKAPIDM-KVLLSLNALLLLALGMFPQRLM-
NUON2_NITOC      EI--------------------------SLSKRADF-RWCMSANGLAMLGLGIFPGALM-
NUON_THISH       ES--------------------------PLPKALDM-NVVLSINGLLVIVLGIFPGLLM-
NUON_ACIF2       DA--------------------------GLIVRDDLASMALSINSLALLVLGILPGPLM-
NUON_ALKEH       DA--------------------------PPQTGSPAMRGLLVANGIAVLLLGIFPDSLI-
NUON_HALHL       EVDAD---------------------TLPAPGASSAIRSLVVVNGVAVLVLGIFPERLI-
NUON_LARHH       SAG-------------------------DALTVGGDMKLVLGVNGLVLLGLGILPNGLY-
NUON_NEIG1       RAR-------------------------PAAGGNNAAKSLLSVNALLLVLWGIMPQTVI-
NUON_HERAR       -D-------------------------KAKIVASKDVTVTLSINGAALLALGLVPGPLM-
NUON_POLNA       HN-------------------------AQPISAPADAQIVLAINGALLLVLGIAPSSLM-
NUON_BORA1       -E-------------------------DAPLSATCVQRGLLSVNGALILILGILPGGLM-
NUON_PARP8       ---------------------------TTPIVGDACKRTLLALNGVAVLVLGIVPGPLM-
NUON_CUPTR       ---------------------------EEQLEATFGLRSMLSVNGAAVILLGLFPAALM-
NUON_POLNS       ---------------------------EVTVSGSGFAKGVLSLNSILVLAIGIVPAGLM-
NUON_RUTMC       KI--------------------------TIY-ASIDIQLVLSINAILILAVGLFPDFWM-
NUON_HYDCU       NT--------------------------KIEPVSSQLNWAVSFVSIALLLLGLMPSSLI-
NUON_COXBU       QL--------------------------KPIRCSLEMKIAISLNGLAVLFIGIFPGWLY-
NUON_LEGPL       NE--------------------------AIVKIGTGNTIVYSLNCLSLLYLGIFPGALI-
NUON_XANC5       EP--------------------------LPANNDRVLGTVLGVNALALLALGLAWSPIM-
NUON_FRATF       DE---------------------------TVKPPLTSLIALSINGLVLLFLGIMPMLLL-
NUON_EHRCJ       SCDV--------------------------SISNKKLCFVLLLTVVVNLVFFVFVGHVRN
NUON_WOLTR       SDSK--------------------------VIYSKSLFIVTSVASLINIVLFMCVEDLYS
NUON_ANAPZ       -GEH--------------------------SATSRNVGLSIMAFVAVTLSLVVVLLRERI
NUON_ANAMF       GAGH--------------------------PALPHHLGLTVIAVVCMLLSVIALFLAQYF
NU2C_NOSP7       MSDAVK-------------NYPQVRWDLPGL---RPLQVGLVITLIATSLAGILSNPLFT
NU2C_SYNJB       MSVSVQ-------------NYPETNWQAEGM---PALRVGMVLTLVATIFAGILSNPLFT
NU2C_GLOVI       -SPQVL-------------AYSEAG-DQDGI---QTLKAGMLITTVATVVLGILFPPLIS
NU2C_PROMA       ASELVK-------------AYPLIQWNSIGM---PTLRFALLTCVFATAIGGVLSNPLFK
NU2C1_ARATH      ITPHMR-------------NYRISPLR-----SNNSIELSMIVCVIASTILGISMNPIIA
NU2C1_COFAR      ITPHVR-------------NYRRSPLR-----SNNSIELSMIVCVIASTIPGISMNPIIA
NU2C_ADICA       SDTPLN-------------SRQNSLVSLSISISKNSLEIAMIICALASTLSGIFIDPIIE
NU2C_CHAGL       FSSYVK-------------NYVIP-VNSLLP--QSSVETAMIVCMIASSVMGIAINPIIQ
NU2C_CHAVU       ISYYVK-------------KYSTYKSNSLMK--QNPIELNIYLCTFISGFVGIFMNPVIY
NU2C_STAPU       MSTYVR-------------EYVTP-SMSIFS--SSSIELGLTLCVLASSILGFFMNPLID
NU2C_CHLAT       MSIYVQ-------------RYTQR-RWSITQ--LQPIELGIGLCVLGSVLAGVLVNPIIN
NU2C_NEPOL       MSLAVR-------------EYPRR-AWSLEP--IQPLEVGIFVCVLGSILVGVAGNSMVN
NUON_ANADF       YVAEAP-------------PVRLR----------VGYQVMLGAFSVAILVFGIWWTPMVR
NUON2_SORC5      DRTEPT-------------PVRPL----------LGGTAC--ALAIPTVLLGVYWGPVYD
NUON_CHLCH       HASSNT-------------GTQPR----------LVAQLFMGALMLLTIYFGLFFAPLSD
NUON2_CHLT3      EDGSET-------------EFNVG----------MLSNALVAFLMILTVVFGLYFTPLSV
NUON_CARHZ       -PEDQT-------------PITLP----------NSIYFTLLITMAVTIVLGVYPTPLAK
NUON_DESRM       -PKESA-------------PIHVG----------GAATITLVITMVATIILGIYPGPLAE
NUON_DESHD       -GEGLP-------------EVPVH----------GAAKFGMIFSMIVTIVLGIYPTPLAQ
NUON_HELMI       -PKDDR-------------PIPVS----------GPMKLTVIFSMVVTVILGIYPGPLAE
NUON_CLOB8       -PTKLE-------------SIPVS----------ISTKLALTISMTVLVILGIYPSQVVN
NUON_MOOTA       -PEGSK-------------PLRVA----------PGLQVAMVVSLLILFILGIYPTPLTN
NUON2_SYMTH      ---DYP-------------ALTPS----------TGISATVLLSLLGVVALTIFANPFVQ
NUON_DEHMB       ---EEV-------------RVLAS----------WPLKLALGISGLAVLIFGIIPETLLN
NUON_METI4       -----P-------------DNVQRIDLS------PATKLLLWILSVGSILLGFYAEPVIK
NUON1_OPITP      PADAVN-------------PRPARTPVG------AAAGVALATLALCSILFGVYQGPLGA
NUON_RUBXD       ---PVS-------------AGGPAKKGD------GGVAFTVYAMALLTALFFLGVGPLAA
NUON_RHOP5       --IE-------------------PAPR------HRFDRLLLIFCFGLIMLFGFEPLVLIT
NUON_RHOS5       --PA-------------------DPAV------RWPERTLLGAATAIILLLGIRPDLLLD
NQO14_THET8      --TP-------------------FRPG------PPWARAAVVAAGVLLLALGLLPGLVLP
NUON1_STRGG      DSAA-------------------VTPP------SRWARAVALTTAALTLLLGIGSGIVLN
NUON_MYCSJ       GDAD-------------------QSAV------QHWPARVAVLAAALSLLLGIIAGPVWQ
NUON_DEIRA       AREY-------------------AHGQ------RPATNVAVALSLIGIVVLGLLPNLWYG
NUON_GEOMG       DETG-------------------SGQRP-----TVAEALSLGIAALAIFILGIWPGPLFD
NUON_GEOUR       DAPE-------------------SRKSA-----SMTESIALSAAALVILAVGIYPSPLLR
NUON_GEOBB       SSP--------------------APRAA-----AAADAVALCCAAAFILLLGVFPAPLLR
NUON_PELCD       GAP--------------------TVPAF-----NNCERLIFVLCAGVTLVAGLYPGPFFR
NUON1_DESMR      AHPA-------------------AVYAA-----GPAGTLALGVMAAGLVGLGLFPQTLLG
NUON_PARUW       EK-----------------------LPY-----SMPAAIVGTTSFIAIIILSFYPAPFLK
NUON1_SYMTH      PQPEE---------------GEEPHPPT-----RTAAQVVLAIATAGTLVLGVLPGPVSE
NUON_CHLSY       DEAP---------------------VSM-----PRGIGAALTIAVIGVLVLGIFPNLILS
NUON1_ROSCS      AITP---------------------FKT-----PPVANAAIILSTVLVVLLGLLPNLIWG
NUON2_HERA2      TDEP---------------------IKV-----GFGPGIVMTAITLLIFGLGIVPTWLYG
NUON2_ACIC5      DATP---------------------LSS-----PTLARITLLVMAALTLLLGCAPNLLMR
NUON1_KORVE      --------------------DAEP-VKI-----SPSLGAALWISALGTLGIGLFPEVFLR
NUON2_SOLUE      --------------------EKTPMLAT-----SFGLRCALALTGIATLAIGIYPEPFLR
NUON2_RHIME      --------------------ERAFEPAL-----TPLVSATLAFTAAGTIGIGLFPAWFLR
NUON_THERP       --------------------AGALQPAR-----TPVLGLGLALTTLATLVLGLVSSPILD
NUON_DESDA       DAP-----------------ATSCAITG-----ETGLQAVLAVCLAGAVLWGIFPQSLLF
NUON2_KORVE      E---------------------VPVARM-----PFGLALALAMCLMFTIYLGVLPTQFIN
NUON1_ACIC5      ALV-------------------LTTGRP-----SFALLLALFLTVATTLLLGIFPGSVLA
NUON1_SOLUE      A-A-------------------DAAEPL-----APSLAFALILPALGTLALGIFPGWVLE
NUON_ANAD2       DEA-------------------GEVVLS-----APSLTIALAAAVAVVVLLGVVADPMVR
NUON_MYXXD       -EG-------------------AQALEK-----SWSTELALVLSTAAVVILGIIPGPIMG
NUON1_SORC5      GAP-------------------IARPMR-----SGYVNAALVVSAVLVMVLGIWPTTSLG
NUON_CHLAD       GE---------------------PTPTL-----NRGLTVDIALAAIGTIAIGLIPAPVFA
NUON2_ROSCS      RE---------------------VPLPM-----DRALRAGLALATLGVLILGFLPTPAID
NUON1_HERA2      ATE-------------------PQPTYA-----TASLSLGVIVAVIGIIAVGILPNIFTD
NUON1_CHLT3      ---------------------QKLNPDP-----TATATIALVAFLV--LLFGIYPSLLIE
NUON_GEOLS       ---------------------EFDWFNV-----TAPVALALVVSAAGSLIPGIIPSMILQ
NUON_SALRD       VAATDP-------------VRAAAFPRA-----TVAATGTLVVCAVALVVLGVFFGGVLE
NUON_GEMAT       ---------------------GQPVPST-----TPLNQSLIATAAVALLVFGLYPTPIME
NUON_BDEBA       EIA----------------------GHS-----LNATTVTAVVMALAIVLMGFVSGPIFS
NUON_ACIC1       -------------------VEGPTVAVP-----GALASAAIALGVIVTVVLGIVPQPVLD
NUON_RHOOB       -------------------SDAPTIVVP-----SMFTAAAIAVGVVVTVVLGILPQGALD
NUON_FRASN       -------------------ADGPVVVTR-----PTLTFATVGIGALMTLLLGVAPQPLLD
NUON_MYCA9       -------------------EDSGVLRIP-----GPAVTVSIAVSALITVLLGVAPQPLLD
NUON_BEUC1       EAG----------------APSTTVVRS-----QGFTAVAVALTAAATLVLGVWPTPVLD
NUON3_STRGG      -------------------ADGPTVAVP-----SPLTMTTIAVGVAVTLVLGLAPQYFLD
NUON_SACEN       -------------------EDGPTVSVP-----GAFTTAAITLGVVVTLLLGVLPSLALD
NUON_SALAI       -------------------ESTPAVVMP-----GWLTSAALTIGVVATLVLGVVPQPLLD
NUON_NOCSJ       SAQ----------------GEVASVTKP-----SVLTSATIFVGVAATLVLGVVPGPVLD
NUON_THEFY       -PA----------------ENAPRVLKP-----GILTGTTVGLGVAATLLLGILPGPVLE
NUON_CUTAK       -EG----------------DDPVEVAEP-----SIAGWITLIVCAVFTIVMGVAPQPIID
NUON_ANOFW       ------------------------VEHTHRLEWPPGVIAVVVICVIGTVLLGVFPNIAYD
NUON_GEOSW       ------------------------ADETTSLRMPIGLAMVVVLCALGTLLFGVVPGLAYH
NUON_GEOKA       ------------------------TFTAPLGRLPAGLSTAVVLCALGTLAIGWAPGLAYD
NUON_BACAN       ------------------------GEVEEKIRLPLNIKIVMSFCAISIVILGIVPMIGYN
NUON_BREBN       ------------------------GTTEAPMVVPKGIWTFILIMAIATVFFGAFPGLVTD
NUON_PAESJ       ------------------------GEEEDRIHVPAVTGTVIWICAAATVALGVLPGPLMK
NUON_DESPS       ------------------------EKEQAPIQLGVCDRATCILLIASMTLLGIFPTTILT
NUON2_OPITP      ------------------------DAQPAPIALTPSMSALCVLLIVAITLLGVAPAFTID
NUON1_SYNFM      ------------------------ERPYPDVRVDTWTRALSYGLIVLMIYLGVFPDQFVA
NUON2_SYNFM      ------------------------RQELPALRVSPPLKLLSGVLVIAMVAAGFFPNQIIR
NUON2_DESMR      ------------------------D--APAIVWPRGYLIFGGALAVLVLLLGILPAPLYD
NUON_BACFR       ------------------------EEPIPTFRSDNYTKVSLVLCTLGIIALGIASCIYQG
NUON_BACV8       ------------------------EDPIGNFRTATPMRISLLVCVAGIFVLGIISGVYQL
NUON_AZOPC       ------------------------EVVLEKIGIDNYNRISMVICTIGIFVIGFLSAIYEY
NUON1_THEYD      ------------------------PVKLPEPIYSRELEVAILICTIGVTFLGILPLFLI-
NUON2_THEYD      ------------------------LVI--DIYNHPLNNSMALSGALLLIFLGLFPNLLLI
NUON_FLAJ1       ------------------------PNEERTGKPF-LIYAVAIISIGLNIALGLFPSLVLD
NUON_FLAPJ       ------------------------SEQTLPNVPV-MYQIVAVVALILNIALGLFPNVVLK
NUON_CYTH3       ------------------------EVSTLTNPAFGFTSVILAIMSALVVLIGLFPDILLQ
NUON_LEPBA       ------------------------GVVAGARDLPSLPTLGFLIFLLCVFFTAGWIFFQPG
NUON_LEPIN       ------------------------GEISRNHAAPYSVGVTGVVLFCLLMVSVGWFLLVPG
NUON1_AQUAE      ------------------------VRHGQT-TVSAGEAFTVLGTAFLVIFFGLFPHVVLD
NUON2_HYDS0      ------------------------TKDNMSLSLNLFDTIGISAFLIIVFFFGIFPNILFD
NUON2_AQUAE      ------------------------KEIRSAPSHLG-EKFSLFALTLASVLLGVLPSLVWF
NUON1_HYDS0      ------------------------IHFKPHYDIL--ENVSIGLLVFLTFALGMLPFVLWN
NUON_PERMH       ------------------------SKARLNFAMT--EMFTVAFMAVFVLILGIYPTVFWG
NUON_CAMC1       ------------------------VK-DKNIYISN-VSMALKVIVGVAVAGTVFAFLFSG
NUON_CAMHC       ------------------------ENAEATLYKQN-SSNAIKFIITFSAILCILAPFMVK
NUON_SULDN       ------------------------VENNGHVYSAN-ATLPLKTIIGIAAIGTIFAFVAVN
NUON_WOLSU       ------------------------KSNERDVFMKN-ATMPLRTIIGLSASVVILSVFFVD
NUON_SULNB       ------------------------K--DVDTVYYN-LSKPLMAVVGFAAVATIAAIFYVQ
NUON_HELAH       ------------------------QTQSYAESDIY-TQNATMPIYAVIIAMALVCLFSVF
NUON_HELHP       ------------------------EIKDSQSSLEL-SSKFALSITAFV---SVACLFMVQ
NUON_CAMJR       ------------------------R-----VYNIK-FSFIQNFILAFCVCVSIFAILLML
NUON_CAMLR       ------------------------I-----VESAN-LDVKQKIILCLCLIGSVSCVFLLL
NUON_BUCAI       -FKR-------------------DLNIPLNWVYTPSGI-VICISGIILLALGIYPNPLIG
NUON_BUCAP       SFIN-------------------DIKKSNFWLCSPSGI-LIFISGIMLLILGIYPNPLIN
NUON_BUCBP       YCHK-------------------NIIISSQNINNKFLIGLLTTISIFVLFLGIFPQITIH
NUON_BUCCC       SNTS-------------------LVNNLYISILQKFLL---ISIGFLFVILGFFPYIF--
NUON1_NITOC      IEKE-------------------ALAS-PSSLPLMGSL-TLALLTLLLIWWGVYPDPLMR
NUON_NITMU       AAGE-------------------AIMLRAASPSFAESA-TLAALALLLIWLGIFPAQLIG
NUON2_ACICJ      APGD-------------------EEARHPNAVPPLGNA-VIGALLVLLVVLGAYPAPALA
NUON_METCA       GVGQ-------------------RVTLHPAAGTALAAA-ALVILAAGLFPQPLIDAAANV
NUON_PSYA2       KQFI-------------------EFDVSKQWGLRTGGI-MVIAVTAIIVFFGVLPNSMIE
NUON_ACIB5       PETP-------------------RIDADAHWGQKVGGL-MVLAAAALVIILGVYPDPMIN
NUON_AERHH       PGMQ-------------------LRDAKGDWAITSGGL-VVLLSAALVVALGLYPQPVIS
NUON_TOLAT       PGMP-------------------SRDATNDWALTTGGF-MVLTSAILVVLLGIYPQPLLD
NUON_CHRSD       PGMQ-------------------RRDATTDWAQRAGGV-VVLGLAALVVVLGVYPAPMID
NUON_PSEMY       PNLH-------------------RHDAPFDWGQRAGGI-MLLVVALLAFFLGVYPQPLLE
NUON_HAMD5       PETL-------------------QRDTPKDWAFTAGGI-VVWISALLVLVFGIYPQPLIS
NUON_ECOLI       PEQP-------------------GRDAPSNWQYSAGGI-VVLISALLVLVLGVWPQPLIS
NUON_PROMH       PDND-------------------NAPAVTTTSQNMATL-ITLVCAIIVIVLGVWPQPLIE
NUON_BLOFL       NTNI-------------------NYDILKKWMIKPEGF-MVIIVAIIILFFGVYPQFIVN
NUON_BLOPB       RLNI-------------------NSDFLSSWSVTPDKI-IVIIVSFSILFLGLYPKPLIY
NUON_BAUCH       KLHT-------------------NTYIQYNWALTSRGI-MVLISSLLVLLLGLYPQPLIN
NUON_SHEWM       ------------------------QSPHSSPSTSGEVA-SLWFIILLIMGLGTFPALFAD
NUON_RICBR       ------------------------------NPTKIPISYGLLLINFVVIGFLLFGSFIIS
NUON_ORITI       RFQN----------------------------SSVNFELSLVSIASTIIVISLMIICMLF
NUON_ARCB4       NCETEE-------------FDDKRVSTYAIMFVAILTVLGGIGSAIVFFIPAMNIDTLIN
NUON_PELPD       VEQP--------------------ANATCLCWTWGGALLGTLALALFMLLPNIFHWVMTG
NUON_NEORI       ENIE----------------------------ASLRHNTLLTSIVVLCALFSTFGFVLLI
NUON_DESAP       PGARAE-------------RPVPPGARRFRLELPASMLVPILVLGIGVVVLGLFNEQIIS
NUON_CAMFF       ----------------------------TALSCADSKKFGLKLLALSSILFIILEGSGIF
NUON_SALTO       VIPTDPTAVPTDPAAAATGPAVGSIDPSVALVRAKPVAVVLAAATVVALVVGFAPQLVLD
                                                                             

NQO14_PARDE      SAAGRAAETLVGPVAAIEQPAEAAQAEPVQGE---------------
NUON_JANSC       --------------FGIEAPAETAAAMLIR-----------------
NUON_AZOC5       ------------------AAAGAAARALF------------------
NUON_BEII9       ------------------EATTVAARSLF------------------
NUON_METNO       ------------------AAAGTAARSLF------------------
NUON_PARL1       ------------------LASQAAVRALLP-----------------
NUON_MAGSA       ------------------TSAKAAAQVLFPAAG--------------
NUON_RHORT       ------------------DGAQAAAEALTFASAR-------------
NUON_RHOCS       ------------------NGAAAAASTLFLR----------------
NUON_BARBK       ------------------EFAEKAATSLFQ-----------------
NUON_RHIEC       ------------------GAAELAAATLF------------------
NUON_GLUDA       ------------------SAAQAAAQALFR-----------------
NUON_GRABC       ------------------AAADLAAKALLR-----------------
NUON1_ACICJ      ------------------TLSTMAAHALMTSQGF-------------
NUON_SPHWW       ----------------LDATSMAAARSLF------------------
NUON_SPHAL       ----------------LAVASAHAASVLF------------------
NUON_ERYLH       ----------------LGGLTDSAASALFIAS---------------
NUON_CAUSK       ----------------PAARAAAAAFGHA------------------
NUON_MARMM       ----------------LVFRAYSVGLALL------------------
NUON_HIRBI       ----------------TGIIGTAAAAG--------------------
NUON_HYPNA       ----------------TGGWASYAASGLLP-----------------
NUON_PELUB       --------------------EIVSRINII------------------
NUON_MAGMM       ------------------ASVAETIKSLM------------------
NUON_AZOSB       ------------------TLCTFVLLASTQP----------------
NUON_DECAR       ------------------SLCAYALLRSL------------------
NUON_NITEU       ------------------GLSLSAIQHSM------------------
NUON_THIDA       ------------------AVCVQAIGTSF------------------
NUON_METGS       ------------------DICAYAITHSFQ-----------------
NUON2_NITOC      ------------------GLCVAVLG---------------------
NUON_THISH       ------------------SLATGAISW--------------------
NUON_ACIF2       ------------------AFCFYAMRGVI------------------
NUON_ALKEH       ------------------SACMAAFGVSYG-----------------
NUON_HALHL       ------------------ALCQAALGL--------------------
NUON_LARHH       ------------------TLCLEAVRQSLGTL---------------
NUON_NEIG1       ------------------DWCAKALENTL------------------
NUON_HERAR       ------------------TACAAAIIKTLAS----------------
NUON_POLNA       ------------------TLCAQSINSIVNSLGV-------------
NUON_BORA1       ------------------ALCVQVIKTSFAGL---------------
NUON_PARP8       ------------------SICLNAISHTLPL----------------
NUON_CUPTR       ------------------NLCYQAIRSTLGS----------------
NUON_POLNS       ------------------SLCLDAMRRTLLGS---------------
NUON_RUTMC       ------------------KLALSLF----------------------
NUON_HYDCU       ------------------TLCYNSL----------------------
NUON_COXBU       ------------------ALSHLAF----------------------
NUON_LEGPL       ------------------AACINAFAN--------------------
NUON_XANC5       ------------------VWCQRAFAGLA------------------
NUON_FRATF       ------------------GVLTQVTNVI-------------------
NUON_EHRCJ       ------------------IISYFLHFNFFNG----------------
NUON_WOLTR       ------------------LIHLVTKSL--------------------
NUON_ANAPZ       ------------------I----------------------------
NUON_ANAMF       ------------------DILFQGLVWVFGGRT--------------
NU2C_NOSP7       LANNSISNTPFLQATINSHVEAQNLLLLPKLDSVSQSQPSVDSTAKI
NU2C_SYNJB       LSIQAVEQSPFLGFPTAQAPIPESASLQVAVDGSLGSLTQPSQG---
NU2C_GLOVI       LADTSLRATPSLQQVRTATPVSRV---------STGAQAPADHGR--
NU2C_PROMA       WANSAVAGTPLLQEALTLAAEKGAIG---------------------
NU2C1_ARATH      IAQDTLFSF--------------------------------------
NU2C1_COFAR      IAQDSLF----------------------------------------
NU2C_ADICA       ITRNTFF----------------------------------------
NU2C_CHAGL       VAQKTILSTIPFI----------------------------------
NU2C_CHAVU       FAQQSILK---------------------------------------
NU2C_STAPU       VTKQSMLVNNFLVF---------------------------------
NU2C_CHLAT       IAQQTVLYTPLLQQSEELMRTLTF-----------------------
NU2C_NEPOL       LMTITMSQAPSLGV---------------------------------
NUON_ANADF       WTEASLQLFRG------------------------------------
NUON2_SORC5      FVARSVSMLR-------------------------------------
NUON_CHLCH       FARYSASIFGLQLQ---------------------------------
NUON2_CHLT3      LAEESVKIIGAVVMN--------------------------------
NUON_CARHZ       IAQQAAMIFMK------------------------------------
NUON_DESRM       VANMAAQSFLLK-----------------------------------
NUON_DESHD       MALTAASSLVK------------------------------------
NUON_HELMI       VATVAAKSLF-------------------------------------
NUON_CLOB8       VVLSVSKAFLS------------------------------------
NUON_MOOTA       YAMNSAVTFFMP-----------------------------------
NUON2_SYMTH      WTAQSAALLH-------------------------------------
NUON_DEHMB       LIEKATELIIH------------------------------------
NUON_METI4       LVGSVLS----------------------------------------
NUON1_OPITP      WLLAR------------------------------------------
NUON_RUBXD       LAAGSGLL---------------------------------------
NUON_RHOP5       AVNSALAVR--------------------------------------
NUON_RHOS5       QIRAALP----------------------------------------
NQO14_THET8      ALAAGG-----------------------------------------
NUON1_STRGG      ALGASG-----------------------------------------
NUON_MYCSJ       LVT--------------------------------------------
NUON_DEIRA       WVASPEIWRLLAGT---------------------------------
NUON_GEOMG       LAAAILR----------------------------------------
NUON_GEOUR       LIDSILR----------------------------------------
NUON_GEOBB       LVDAALQ----------------------------------------
NUON_PELCD       WFGAMLP----------------------------------------
NUON1_DESMR      AIAALFGGA--------------------------------------
NUON_PARUW       VLSHLSN----------------------------------------
NUON1_SYMTH      LLRVALAGM--------------------------------------
NUON_CHLSY       VLERV------------------------------------------
NUON1_ROSCS      TISSAASVAAR------------------------------------
NUON2_HERA2      VLEQATIRIAAQ-----------------------------------
NUON2_ACIC5      WLR--------------------------------------------
NUON1_KORVE      IVNWSLALSGDARVIGLLR----------------------------
NUON2_SOLUE      LAQTSLFR---------------------------------------
NUON2_RHIME      LAQQSAFGG--------------------------------------
NUON_THERP       LVQRWSAALA-------------------------------------
NUON_DESDA       WINVYF-----------------------------------------
NUON2_KORVE      YALKSAQDLVR------------------------------------
NUON1_ACIC5      RAQEGAYTFYRAPLVILGTHAGVFADPATAKSITSPTP---------
NUON1_SOLUE      FATKSAANLK-------------------------------------
NUON_ANAD2       LAQAASAIIL-------------------------------------
NUON_MYXXD       WLEQASSIFGQ------------------------------------
NUON1_SORC5      IAVRAVLASR-------------------------------------
NUON_CHLAD       LVERSLVVLGG------------------------------------
NUON2_ROSCS      LVQR--VVLGG------------------------------------
NUON1_HERA2      LAKALVLTVAP------------------------------------
NUON1_CHLT3      YTQHALAFAMK------------------------------------
NUON_GEOLS       FAQQAVKLI--------------------------------------
NUON_SALRD       TTLGFFETTAMATAP--------------------------------
NUON_GEMAT       LARRATTTTSPTSNPAAPRGEVRLQTASVPR----------------
NUON_BDEBA       AVEKSLL----------------------------------------
NUON_ACIC1       LAD---------------KAVP--FLR--------------------
NUON_RHOOB       LAD---------------QAAV--FFR--------------------
NUON_FRASN       LAT---------------TAATSGFVR--------------------
NUON_MYCA9       LVE---------------NLAD--FVT--------------------
NUON_BEUC1       LLA---------------QATK--FVV--------------------
NUON3_STRGG      LAS---------------QAGV--FVR--------------------
NUON_SACEN       WA----------------NLGG--FVS--------------------
NUON_SALAI       LAA---------------GAAE--FVR--------------------
NUON_NOCSJ       L-----------------AANAGQFVR--------------------
NUON_THEFY       HVIPQPAAETSEAVAAEHTAADSLFAR--------------------
NUON_CUTAK       LFN---------------QAST--FLR--------------------
NUON_ANOFW       FL-APFQHFSDFLQ---------------------------------
NUON_GEOSW       FL-E-------------------------------------------
NUON_GEOKA       ML-AQFGHFGDFLP---------------------------------
NUON_BACAN       FFYEYFPLMKDFFFLGNVVQ---------------------------
NUON_BREBN       YIQIHFNPSFDFGNMLSPSSQ--------------------------
NUON_PAESJ       WIDAVFTIQADLFVR--------------------------------
NUON_DESPS       IIESALTTL--------------------------------------
NUON2_OPITP      AITNSLATISTVSS---------------------------------
NUON1_SYNFM      LTEAAARSLP-------------------------------------
NUON2_SYNFM      VAESAAKALL-------------------------------------
NUON2_DESMR      LAAQAAGQLHP------------------------------------
NUON_BACFR       IDKFSFGMGM-------------------------------------
NUON_BACV8       LSDTAIL----------------------------------------
NUON_AZOPC       IETISFGVLQK------------------------------------
NUON1_THEYD      -----------------------------------------------
NUON2_THEYD      F----------------------------------------------
NUON_FLAJ1       LLN--------------------------------------------
NUON_FLAPJ       LL---------------------------------------------
NUON_CYTH3       IGMNI------------------------------------------
NUON_LEPBA       SLL--------------------------------------------
NUON_LEPIN       NLLALGELWLSSSIFR-------------------------------
NUON1_AQUAE      FILRALS----------------------------------------
NUON2_HYDS0      IILKDMFHG--------------------------------------
NUON2_AQUAE      LIKQSAENLFTG-----------------------------------
NUON1_HYDS0      GISNISEFLFKIANLR-------------------------------
NUON_PERMH       ISTTLSSLLIAGIGR--------------------------------
NUON_CAMC1       AILEFIEHFVFASGF--------------------------------
NUON_CAMHC       FWTDFVLKFI-------------------------------------
NUON_SULDN       QLIEFVTLFVYNSGY--------------------------------
NUON_WOLSU       RLLDFILKYVEYSGF--------------------------------
NUON_SULNB       PLVSYIYYMISASGY--------------------------------
NUON_HELAH       MMRGLLEFVA-------------------------------------
NUON_HELHP       NLLEIIEKYILK-----------------------------------
NUON_CAMJR       -----------------------------------------------
NUON_CAMLR       -----------------------------------------------
NUON_BUCAI       LIKCTI-----------------------------------------
NUON_BUCAP       LINSVQ-----------------------------------------
NUON_BUCBP       LVKYFWIQW--------------------------------------
NUON_BUCCC       -----------------------------------------------
NUON1_NITOC      IIQAVAMALI-------------------------------------
NUON_NITMU       VLEGAGGGLT-------------------------------------
NUON2_ACICJ      LIRMTIGHG--------------------------------------
NUON_METCA       PQPPPTADSPQRLTATGGLP---------------------------
NUON_PSYA2       WASLARIW---------------------------------------
NUON_ACIB5       LALKAEILSPLHFMLSQQQ----------------------------
NUON_AERHH       LVQGFQNVVLH------------------------------------
NUON_TOLAT       LLPLAQLATP-------------------------------------
NUON_CHRSD       WVRFMVAG---------------------------------------
NUON_PSEMY       LVHNAALVALAQ-----------------------------------
NUON_HAMD5       FIKGFNALS--------------------------------------
NUON_ECOLI       IVRLAMPLM--------------------------------------
NUON_PROMH       LTRFAIIAPAIN-----------------------------------
NUON_BLOFL       LIQQFVI----------------------------------------
NUON_BLOPB       FMHLIYPPVL-------------------------------------
NUON_BAUCH       IVQWAQIINPR------------------------------------
NUON_SHEWM       TIKSVVG----------------------------------------
NUON_RICBR       S----------------------------------------------
NUON_ORITI       GEGLNVIV---------------------------------------
NUON_ARCB4       FSQVAVQSLFIR-----------------------------------
NUON_PELPD       I----------------------------------------------
NUON_NEORI       Y----------------------------------------------
NUON_DESAP       NVIQYALPWRLP-----------------------------------
NUON_CAMFF       SIISFLNLFIR------------------------------------
NUON_SALTO       LAAR-------------------------------------------