CLUSTAL format seed alignment for MF_00446

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PAND_ECO57       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_ECOL6       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_SHIBS       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_SHIDS       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_SHIFL       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_SHISS       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_ECOLI       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_SHIF8       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_ECOUT       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_ECOK1       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_ECOL5       ----MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFS
PAND_SALCH       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFS
PAND_SALPA       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFS
PAND_SALTI       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFS
PAND_SALTY       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAIDIWNVTNGKRFS
PAND_YERPE       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFS
PAND_YERPA       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFS
PAND_YERPN       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFS
PAND_YERPP       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFS
PAND_YERPS       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFS
PAND_YERE8       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLEAAGILEYEAIDIYNVDNGQRFS
PAND_PECAS       ----MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFMDAAGILEYEAIDIYNVDNGQRFS
PAND_SODGM       ----MQRTMLRGKLHRVHVTQVDLHYEGSCAIDQDFLDAAGILEYEAIDIYNVDNGQRFS
PAND_PHOLL       ----MLRTMLQGKLHRVKVTQADLHYEGSCAMDQNFMDAAGILEYEAIDIYNVDNGERFS
PAND_ACIAD       ----MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFT
PAND_ACIBT       ----MLSRLLKCKIHRAVVTHAELHYEGSCAIDGVLMDLAGIREYEEIHVWNVTNGKRFT
PAND_PSYA2       ----MLLNMLKCKLHRARVTHAELHYEGSCGIDGDLLDLAGLRENESIDIYNVTNGKRFR
PAND_PSYCK       ----MLLNMLKCKLHRARVTHAELHYEGSCGIDGDLLDLAGLRENESIDIYNVTNGKRFR
PAND_PSEAE       ----MHAIMLKAKLHRAEVTHAVLDYEGSCAIDGDWLDLSGIREYEQIQIYNIDNGERFT
PAND_PSEAB       ----MHAIMLKAKLHRAEVTHAVLDYEGSCAIDGDWLDLSGIREYEQIQIYNVDNGERFT
PAND_PSEFL       ----MHAIMLKAKLHRAEVTHAVLDYEGSCAIDGEWLDLSGIREYEQIQIYNVDNGERFT
PAND_PSEU5       ----MHAIMLKAKLHRAQVTHSVLDYEGSCAIDGEWLDLAGIREYEQIQIYNVDNGERFT
PAND_CHRSD       ----MYTIMLKAKLHMARVTHAVLDYEGSCAIDGELLDLAGIRENEQIQIYDVENGNRFT
PAND_ALCBS       ----MQCTMLKAKLHQARVTHAELEYEGSCAIDGDLMDMAGILEYEQIQIYNIDNGERFE
PAND_METCA       ----MQTTMLKAKLHRARVTHSELEYEGSCAIDGSLLDCAGIREYEQIQIYNVNNGERFT
PAND_NITOC       ----MYLTLLKSKLHRACVTHIELEYEGSCAIDSVLLSTAGIQEYEQIHIYNLTNGERFV
PAND_HYDCU       ----MQITLLKSKLHRVTTTHSELDYEGSCAIDGHFLEVAGIREYEQIQIYNVNNGNRFT
PAND_SACD2       ----MQITLLKGKLHMAKVTQAELWYDGSCAIDEEFVKLAGLREFEQIEIYNVDNGERFS
PAND_ALKEH       ----MQLNMLKCKLHQACVTDTELDYEGSCAIDANLMDAAGIREFEQIHVYNLANGARFT
PAND_HALHL       ----MQLNMLKGKLHQARVTQTELEYEGSCAIDLDLLEAVGIHEYEQIHVYNIENGERFV
PAND_PSYIN       ----MKKTMLTGKLHQARVTHAELNYEGSCAIDQDLLEQAGILEYEQIEIYNIENGARFS
PAND_BURMA       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFS
PAND_BURPS       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFS
PAND_BURP1       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFS
PAND_BURP0       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNVNNGERFS
PAND_BURTA       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNINNGERFS
PAND_PARXL       ----MQRNMLKSKIHRVAVTHCELHYEGSCAIDEDLLEAANIVENERIDIWNINNGERFS
PAND_BURCA       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAAGLIENERIDIWNINNGERFS
PAND_BURCH       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAAGLIENERIDIWNINNGERFS
PAND_BURL3       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEASGIIENERIDIWNINNGERFS
PAND_BURCM       ----MQRHMLKSKIHRAAVTHCELHYEGSCAIDEDLLEAANLVENERIDIWNINNGERFS
PAND_ACISJ       ----MYRTLLKSKIHRVKTTHCELHYEGSCAIDEDLLEAANICENEQVHIWNVDNGERFV
PAND2_POLSJ      ----MFRTLLKSKIHRVAVTHCELHYEGSCAIDEDLLDAANIAENEQIHIWNINNGERFV
PAND_POLNA       ----MFRTLLKSKIHRAAVTHCELNYEGSCAIDEDLLDAANLGENEQIHIWNINNGERFI
PAND1_POLSJ      ----MFRTLLKSKIHRASVTHCELNYEGSCAIDEDLLDAANLGENEQVHIWNINNGERFI
PAND_RHOFT       ----MLRTLLKSKIHRATVTDCELHYEGSCAIDEDLLDAANLLENEQIHIWNINNGERFV
PAND_THIDA       ----MQRTMLKSKLHRATVTHSELHYEGSCAIDESLLEAANIHEYEQIQIYNVSNGERFT
PAND_METFK       ----MQRTMLKSKLHRVHVTHSELDYEGSCAIDEALLEAADIKEYQQIDIYNVNNGERFT
PAND_DECAR       ----MQRTMLKSKLHRVTATHADLHYEGSCAIDEDLLEAANIKEYEQIDIWNVNNGERFT
PAND_CHRVO       ----MQRNMLKSKLHRVTTTHAELHYIGSCAIDENLLEAADILEYEEVQIWNVTNGERFA
PAND_XANAC       ----MHLSLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFS
PAND_XANC5       ----MHLSLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFS
PAND_XANOR       ----MHLSLLKAKIHRATVTHAELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFS
PAND_XANOM       ----MHLSLLKAKIHRATVTHAELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFS
PAND_XANCP       ----MHLSLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFS
PAND_XANC8       ----MHLSLLKAKIHRATVTHSELNYEGSIAIDGLLLEATGIREFEQVHIWDVTNGARFS
PAND_XYLFA       ----MQLSLLKAKIHRATVSHSELNYEGSIAIDGLLLEAAGLYEFEKVHIWNVTNGARFT
PAND_XYLFT       ----MQLSLLKAKIHRATVSHSELNYEGSIAIDGLLLEAAGLYEFEKVHIWNVTNGARFT
PAND_RUTMC       ----MKRTFLSAKLHKVITTAVELDYEGSCEIDGVLLDAADIGAFEQIQIYNINNGNRFT
PAND_VESOH       ----MKRIFLSAKLHKVTTTAVELNYEGSCEIDGVLLDAAGIGAFEQIQIYNINNGNRFT
PAND_BORBR       ----MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFD
PAND_BORPA       ----MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFD
PAND_BORPE       ----MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFD
PAND_BORA1       ----MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFD
PAND_CUPNH       ----MQRIMLRAKLHRVTVTQADLNYEGSCGIDQDLLDAADMKEFEKIELYNVNNGERFS
PAND_RALSO       ----MQRNMLRAKLHRATVTQADLDYEGSCGIDEDLLDAADMREYEKIELYNVNNGERFS
PAND_METPP       ----MNRLMLRAKLHRATVTEADLHYEGSCGIDAALLEAADMREFEQIELYNVNNGERFS
PAND_HERAR       ----MQRIMLRAKIHRAKVTQADLHYEGSCGIDADLLEAADIKVGEKIELYNINNGERFS
PAND_AQUAE       ----MLREMLKSKIHRLTVTDADLHYEGSLSLDEYLMELADLKPFEKIDVYNINNGARFQ
PAND_DESPS       ----MLHQMMKAKLHRATISAADLNYEGSLTIDTDLLKASGIRPYERIYVYNVNNGERFE
PAND_SYNFM       ----MQRLMLKSKIHRARVTEANLHYEGSLTIDETLMKAADILPYEQIKVYNVFNGARFD
PAND_LEPIN       ----MQITVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNVNNGARFE
PAND_LEPIC       ----MQITVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNVNNGARFE
PAND_LEPBJ       ----MQITVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNINNGARFE
PAND_LEPBL       ----MQITVMKGKIHRATVTDADLNYEGSLTVDMDLVDAAGMRVYEKVSVVNINNGARFE
PAND_BRADU       ----MQITLMKGKIHRASVTEADLHYEGSISIDRTLLEAAGMVINERVEIYNVETGTRFA
PAND_ANADE       ----MRRTFFKAKIHRATVTHADLEYEGSVSIDEDLLEAAGIWEYEAVHVWNITRGTRLQ
PAND_MYXXD       ----MRRILFKSKIHRATVTQADLDYEGSVTIDRDLLRAADIVENEKVAVWNITQGTRLE
PAND_LEGPA       ---MAYRKMLKSKIHRACVTQADLDYEGSITISPELLKVANILPYEAVNVWNITAGTRFE
PAND_LEGPH       ---MAYRKMLKSKIHRACVTQADLDYEGSITISPELLKVANILPYEAVNVWNITAGTRFE
PAND_LEGPL       ---MAYRKMLKSKIHRACVTQADLDYEGSITISPELLKAANILPYEAVNVWNITAGTRFE
PAND_RHOBA       MVDTPYRKMLAAKIHRATVTGADVNYEGSLTVPPELLVAAKIHPYESLHVWNVTRGTRLE
PAND_CORGL       ----MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLE
PAND_CORGB       ----MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLE
PAND_COREF       ----MLRTILGSKIHRATVTQADLDYVGSITIDADLVNAAGLIEGEKVAVVDITNGARIE
PAND_STRAW       ----MLRTMFKSKIHRATVTQADLHYVGSVTIDADLLDAADLLPGELVHIVDITNGARLE
PAND_STRCO       ----MLRTLIKSKIHRATVTQADLHYVGSVTIDADLLDAADLLPGELVHIVDVTNGARLE
PAND_MYCBP       ----MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLV
PAND_MYCTA       ----MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLV
PAND_MYCBO       ----MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLV
PAND_MYCTU       ----MLRTMLKSKIHRATVTCADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLV
PAND_MYCPA       ----MLRTMLKSKIHRATVTQADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLV
PAND_MYCA1       ----MLRTMLKSKIHRATVTQADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLV
PAND_MYCUA       ----MLRTMLKSKIHRATVTQADLHYVGSVTIDADLMDAADLLEGEQVTIVDIDNGARLV
PAND_MYCSJ       ----MLRTMLKSKIHRATVTQSDLHYVGSVTIDADLMDAADLIEGEQVTIVDIDNGNRLV
PAND_MYCSK       ----MLRTMLKSKIHRATVTQSDLHYVGSVTIDADLMDAADLIEGEQVTIVDIDNGNRLV
PAND_MYCSS       ----MLRTMLKSKIHRATVTQSDLHYVGSVTIDADLMDAADLIEGEQVTIVDIDNGNRLV
PAND_MYCVP       ----MFRTMLKSKIHRATVTQADLHYVGSVTVDADLMDAADLIEGEQVTIVDIENGARLV
PAND_MYCLE       ----MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDINNGARLV
PAND_NOCFA       ----MLRTMMKSKIHRATVTHADLHYVGSVTVDQDLLDAADLLEGEQVCIVDIDNGARLE
PAND_RHOJR       ----MFRTMMKSKIHRATVTHADLHYVGSVTVDQDLMDAADLLEGEQVCIVDIDNGARLE
PAND_NOCSJ       ----MLRTMMKSKIHRATVTQADLHYVGSVTVDEDLLDAADLLPGELVHIVDIDNGARLE
PAND_SACEN       ----MFRTMLKSKIHRATVTQADLHYVGSVTVDADLMDAADLLEGEQVAIVDVTNGARLE
PAND2_PAEAT      ----MIRTMFKSKIHRATVTHADLHYVGSVTVDLDLLDAADILPGELVSIVDVTNGARLE
PAND_ARTS2       ----MNRTMFKSKIHRATVTHADLHYVGSVTVDLDLLEAADILPGELVAIVDVTNGARLE
PAND1_PAEAT      ----MKRTMFKSKIHRATVTHADLHYVGSVTVDLDLLDAANILPGEQVAIVDVTNGARLE
PAND_DEIRA       ----MERIMFRAKIHRATVTQADLDYVGSVTIDQDLLDAADILVNEKVDIWNITNGNRLH
PAND_DEIGD       ----MERIMFRAKIHRATVTQADLDYVGSVTIDQDLLDAADILVNERVDIYNITNGNRLS
PAND_THET2       ----MKRVMFHAKIHRATVTQADLHYVGSVTVDQDLLDAAGILPFEQVDIYDITNGARLT
PAND_THET8       ----MKRVMFHAKIHRATVTQADLHYVGSVTVDQDLLDAAGILPFEQVDIYDITNGARLT
PAND2_FRACC      ----MLRTMLTAKIHRATVTQADLHYVGSVTIDADLLAAADLLPGEQVTIVDINNGARLE
PAND_FRAAA       ----MLRTMLTAKIHRATVTQADLHYVGSVTIDADLLEAADLLPGEQVTIVDINNGARLE
PAND_ACIC1       ----MLRTMLHAKIHRATVTRADLHYVGSITLDLDLMEAADILPGELVAVADINNGNRLE
PAND_THEFY       ----MLRTMLNGKIHRATVTHADLHYVGSITIDADLMDAANLVDGEQVHVVNITNGHRLV
PAND_MYCS2       ----MQRVLLASKIHRATVTQADLHYVGSITIDAELMAAADIVEGEQVHVVDITSGARLV
PAND_CORJK       ----MLRTMLKSKIHRATVTQADLHYVGSCTIDADLMEAADILEGEQIDIVDIDNGNRLT
PAND1_FRACC      ---MIYREMLKSKIHRAVVRQADLHYVGSITIDATLMAAAGLWPGEKVDVLDITNGARLS
PAND_DEHM1       --------MLKSKIHRATITDACIDYEGSITIDKNLMQAANLLPYEQVHVVNVNNGTRLE
PAND_DEHMC       --------MLKSKIHRATITDACIDYEGSITIDKNLMQAANLLPYEQVHVVNVNNGTRLE
PAND_PELCD       ----MKRKMLKSKIHRATVTGADLHYEGSITIDSELMKQADILPYEAVDIWNVTYGTRFQ
PAND_PELPD       ----MERIMLKSKIHRATITGADLEYEGSITIDRDLMDAADIVSYEKVAVWDVTNGSRLE
PAND_SYNAS       ----MQRLMLKSKIHRATVTDADLHYEGSISIDEALMEAADLLPYEKVAIYDVNNGERFT
PAND_BACAN       ----MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLE
PAND_BACHK       ----MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLE
PAND_BACCZ       ----MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLE
PAND_BACAH       ----MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLE
PAND_BACC1       ----MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLE
PAND_BACCR       ----MFRTMMRAKLHRATVTEANLNYVGSITIDEDLMDAVNIVENEKVQIVNNNNGARLE
PAND_BACSK       ----MYRTMMKAKLHRARVTESNLNYVGSITIDEDLMDAVDLLENEKVQIVNNNNGERFE
PAND_BACHD       ----MFRTMMKAKLHRARVTESNLNYVGSITIDEDIMDAVDIVENEKVQIVNNNNGARFE
PAND_BACLD       ----MYRTLMSAKLHRARVTEANLNYVGSVTIDEDLLDAVGMMANEKVQIVNNNNGARLE
PAND_BACSU       ----MYRTMMSGKLHRATVTEANLNYVGSITIDEDLIDAVGMLPNEKVQIVNNNNGARLE
PAND_GEOKA       ----MFRTLMNAKIHRARVTEANLDYVGSITIDEDILDAVGIVANEKVQVVNNHNGARFE
PAND_GEOTN       ----MFRTLMNAKIHRARVTEANLDYVGSITIDEDILDAVGMVANEKVQIVNNNNGARFE
PAND_LISIN       ----MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIE
PAND_LISMF       ----MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIE
PAND_LISMO       ----MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIE
PAND_LISW6       ----MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIE
PAND_STAAC       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAAR       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAAM       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAAN       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAA3       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAA8       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAAS       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAAW       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAAB       ----MIRTMMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFE
PAND_STAES       ----MIRTFMNSKIHRARVTESNLNYVGSITIDANILDAVDILPNEKVAIVNNNNGARFE
PAND_STAEQ       ----MIRTFMNSKIHRARVTESNLNYVGSITIDANILDAVDILPNEKVAIVNNNNGARFE
PAND_STAHJ       ----MIRTMMNGKIHRARVTESNLNYVGSITIDADILDAVDILPNEKVAIVNNNNGARFE
PAND_OCEIH       ----MYRTMMKSKIHRAVVTEANLNYVGSITIDEAILNQVDILPNEKVQIVNNNNGARLE
PAND_NEIMA       ----MFRTMLGGKIHRATVTEADLNYVGSITVDQDLLDAAGIYPNEKVAIVNNNNGERFE
PAND_NEIMB       ----MFRTMLGGKIHRATVTEADLNYVGSITVDQDLLDAAGIYPNEKVAIVNNNNGERFE
PAND_NEIMF       ----MFRTMLGGKIHRATVTEADLNYVGSITVDQDLLDAAGIYPNEKVAIVNNNNGERFE
PAND_NEIG1       ----MFRTILGGKIHRATVTEADLNYVGSITVDQDLLDAAGICPNEKVAIVNNNNGERFE
PAND_SYNWW       ----MLRHMLKSKIHRAVVTDANLNYVGSITIDRDLMDAADILENEKVTIVNNNNGARFD
PAND_BACFR       ----MMIEVLKSKIHCARVTEANLNYMGSITIDENLLDAANMIAGEKVYIADNNNGERFE
PAND_BACFN       ----MMIEVLKSKIHCARVTEANLNYMGSITIDENLLDAANMIAGEKVYIADNNNGERFE
PAND_BACTN       ----MMIEVLKSKIHCARVTEANLNYMGSITIDEDLLDAANMIPGEKVYIADNNNGERFE
PAND_BACV8       ----MMIEVLKSKLHCVRVTEANLNYMGSITIDEDLMDAANMIAGEKVHIVDNNNGERFE
PAND_PARD8       ----MFIEVVKSKIHRVTVTEANLNYIGSITIDEDLLDAANLIANEKVSIVNNNNGERFE
PAND_PORGI       ----MYVEVLKSKIHRVTITEANLNYVGSITIDEDLMDAANIIAGEKVQIVDNNNGARLE
PAND_FLAPJ       ----MQIEVVKSKIHRVTVTGADLNYIGSITIDEVLLEASNIIEGEKVNIVNINNGERFE
PAND_GRAFK       ----MQIHVVKSKIHRVKVTGADLDYIGSITIDEDLMEAASIIEGEKVQIVNNNNGERLE
PAND_CYTH3       ----MNIEVLKSKIHRVKVTQAELHYVGSITIDEALMEASNIIENEKVQIVNINNGERFE
PAND_CARHZ       ----MFLTMMKGKIHRATVTEANLNYVGSITIDEELLDASGILPNEKVQVVNINNGARLE
PAND_DESHY       ----MFRTMMKSKIHRATVTEANLKYVGSITIDEELLEVADILPNEKVQVVNNNNGARLE
PAND_HUNT2       ----MFITLMKSKIHRATVTEANLDYVGSITIDEDLMEAADIMENEKVQVVDNNNGNRFE
PAND_MOOTA       ----MWRIMMKSKLHRATVTAADLNYIGSITIDSDLMAAADILPNEKVQVVDNNNGARLE
PAND_CAMJR       ----MNITLLKSKIHRANVTEARLDYVGSISIDEKLLQASGILEYEKVQVVNVNNGARFE
PAND_CAMJJ       ----MNITLLKSKIHRANVTEARLDYVGSISIDEKLLQASGILEYEKVQVVNVNNGARFE
PAND_CAMJE       ----MNITLLKSKIHRASVTEARLDYIGSISIDEKLLQASGILEYEKVQVVNVNNGARFE
PAND_LACPL       ----MLIDMLKGKIHRATVTQADLEYVGSITIDETLMEASGILEYEKVQIADVNNGARFE
PAND_ENTFA       ----MKVTMLKGKIHRAKVEQAELDYVGSITVDMDLLEAAGIYEYEKVQIVDVNNGNRFE
PAND_CLOAB       ----MHLNMLKSKIHRATVVQADLNYVGSITIDRNLMDKANILEYEKVEIANINNGARFE
PAND_CLONN       ----MELNMLKSKIHRVTVTQAELSYVGSITIDKALMKAANILEYEKVQIVDIDNGARFE
PAND_HELPY       ----MTFEMLYSKIHRATITDANLNYIGSITIDEDLAKLAKLREGMKVEIVDVNNGERFS
PAND_HELPH       ----MTFEMLYSKIHRATITDANLNYIGSITIDEDLAKLAKLREGMKVEIVDVNNGERFS
PAND_HELPJ       ----MTFEMLYSKIHRATITDANLNYIGSITIDEDLAKLAKLREGMKVEIVDVNNGERFS
PAND_HELAH       ----MTFEMLYSKIHRATITDANLNYVGSITIDENLAKLAKLREGMKVEIVNINNGERFS
PAND_HELHP       ----MQFEMLYSKIHRAKVSDANLNYVGSITIDKTLAQSANLLAGMKVEIVNINNGERFS
PAND_CAMFF       ----MEIEMLYSKIHRATVTDANLNYVGSITIDERLMKAANLLEFQKVEILDINNGERFQ
PAND_SULDN       ----MTIEMLYSKIHRATVTDANLNYVGSITVDEELLEASMLRVGQKVEILNINNGERFS
PAND_WOLSU       ----MKFDMLWSKIHRATVTDANLNYVGSITIDEELMEAAELLVGQKVEILDVNNGERFS
PAND_BDEBA       ----MNISLLRTKIHRATVTGADLNYEGSVSICPDLIKASGLLMNERVDIYNCNNGARFS
PAND_NOSS1       ----MQRTLLLAKIHNCTLTGANINYVGSISIDQILLDKSGILPYEQVQVVNNANGQRFI
PAND_TRIV2       ----MQRTLLLAKIHNCTLTGANINYVGSISIDQILLDKSGILPYEQVQVVNNANGQRFI
PAND1_GLOVI      ----MLRTVLLSKIHRATVTGACLEYMGSISLDAQLLAAAHILAFEQVHVVNLNNGARLI
PAND2_GLOVI      ----MLRTVLLGKIHRATVTGACLEYVGSISVDSRLLAAAGILPHEQVHVVNLNNGARLV
PAND_CAUVC       ----MLLTMLKAKLHRATVTQADLDYEGSIAIDRDLLDASGILPNEQVDVLNITNGARFT
PAND_HYPNA       ----MILSMLKAKLHGATVTQCDLHYEGSVSIDQDLLDASGILPHEKVDIWNVTNGARIQ
PAND_MARMM       ----MRLTMMKCKLHRATVTQADLHYEGSISIDRDYLEAAGILPHEQVDVLNINNGERFT
PAND_SALRD       ----MDLSMLRAKLHRLRVTEADLYYEGSITIDEELLDAAGLLPYEKVQVVNVNNGSRLE
PAND_CHLCH       ----MYLHLLKSKIHNAIVTSGDLEYEGSITIDSELLDLAGMIPNEKVLVVNNNNGERFE
PAND_CHLTE       ----MKLHMLKSKIHNAIVTSGDLEYEGSITIDKELLDMADMIANEKVLVVNNNNGERFE
PAND_PELLD       ----MKVHLLKSKIHNAIVTSGDLEYEGSITIDCELLEKADMIPNEKVLVVNNNNGERFE
PAND_CHLPD       ----MKLHLLKSKIHNARVTSGDLEYEGSITIDQELLLLAEMIPNEKVLVVNNNNGERFE
PAND_FRATH       ----MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLE
PAND_FRATO       ----MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLE
PAND_FRATT       ----MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLE
PAND_FRAT1       ----MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLE
PAND_FRATW       ----MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGERLE
PAND_FRATN       ----MLISVLKSKISYATVTGKDLFYVGSITIDSEIMKQANIIENEKVQVVNLNNGARLE
PAND_COXBU       ----MLISVLKSKISYATITQKELFYIGSITIDEAIMERAQLTINEQVQIVNLNNGERLE
PAND_THEMA       ----MLNIYLKSKIHMATITRKEVYYEGSIEIDEELMGKAGISEGELVLVVNVNNAERFV
PAND_HALWD       ----MRRWLLKSKLHRARVTGTEKDYEGSISIDAALLSEADIAVGEQVQVVNVTNGERFE
PAND_SYNY3       ---MGSIRLMHAKLHRVCVTEANVNYVGSITIDPVMLERVGLLPLEEVDIINLSNGNRFS
PAND_TRIEI       ---MTTIKLMHAKLHRVRVTDAKPDYVGSVTIDSDLLEKVGILPLEEVQIVNLNNGQRWL
PAND_AGRFC       -----MIRIVRAELHGITVTGADLDYHGSITLDPEHCDLAGIRPLEFVDIWNKQSGARIS
PAND_MAGSA       -----MMKIIRAKLHGIRVTNADLNYHGSITLDPEQCEMAGIYPMEFVDIWNKNSAARIS
PAND1_RHILO      -----MRKLVAGKLHGIHVTEANLNYHGSITLDPDHCEAAGILPMEFVEIWNKNSGARIS
PAND2_RHILO      -----MRKIVAGKLHGIHVTEANLDYHGSITLDPDHCEEAGILPMEFVEIWNKNSGARIS
PAND_PYRIL       -----MPVLLRAKAHGLVVTGKNLHYEGSLTLGRDIIEAAGFYPLEKVEVYNVTNGARFT
                          .  :            * **  :         :     : : :   . *  

PAND_ECO57       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_ECOL6       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_SHIBS       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_SHIDS       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_SHIFL       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_SHISS       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_ECOLI       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_SHIF8       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_ECOUT       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_ECOK1       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDE---EARTWRPNVAYFEGDN-
PAND_ECOL5       TYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVNMPDE---EARTWRPNVAYFEGDN-
PAND_SALCH       TYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDE---EARTWRPKVAYFEGDN-
PAND_SALPA       TYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDE---EARTWRPKVAYFEGDN-
PAND_SALTI       TYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDE---EARTWRPKVAYFEGDN-
PAND_SALTY       TYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDE---EARTWRPKVAYFEGDN-
PAND_YERPE       TYAIAAERGSRIISVNGAAARCACVGDKLIICSYVQMSYA---AARLHHPKVAYFEGEN-
PAND_YERPA       TYAIAAERGSRIISVNGAAARCACVGDKLIICSYVQMSYA---AARLHHPKVAYFEGEN-
PAND_YERPN       TYAIAAERGSRIISVNGAAARCACVGDKLIICSYVQMSYA---AARLHHPKVAYFEGEN-
PAND_YERPP       TYAIAAERGSRIISVNGAAARCACVGDKLIICSYVQMSYA---AARLHHPKVAYFEGEN-
PAND_YERPS       TYAIAAERGSRIISVNGAAARCACVGDKLIICSYVQMSDA---AARLHHPKVAYFEGEN-
PAND_YERE8       TYAIAAERGSRIISVNGAAARCACVGDKLIICSYVQMSDA---DARLHHPKVAYFEGEN-
PAND_PECAS       TYAIAGERGSRIISVNGAAARCACVGDKLIICSYVQMSDE---QARSHSPKVAYFSGEN-
PAND_SODGM       TYAIAAERGSRIISVNGAAARCACVGDLLIICAYVQMPDE---EARHHAPRVAYFDQHN-
PAND_PHOLL       TYAIAAERGSRIISVNGAAARRAAVGDKLIICSYVQIPNE---DARHHKPNIAYFDGDN-
PAND_ACIAD       TYAIRGEDHSGIISVNGGAAHQAEVGDLVIIATFGDFTEV---EANAHKPRLVYANPDN-
PAND_ACIBT       TYAIRGEDNSGIISVNGGAAHQADVGDLVIIATFGDFTEA---EANAHKPRLVYANPDN-
PAND_PSYA2       TYAIRAEAGSGIISLNGAAAHMADLGDIVIICAYAHFDEV---EASTYQPRLVYCNEDN-
PAND_PSYCK       TYAIRAEAGSGIISLNGAAAHMADLGDIVIICAYAHFDEV---EASTYQPRLVYCNEDN-
PAND_PSEAE       TYAIRAENGSKMISVNGAAAHKAKVGDRVIICAYAHYSEA---ELASHKPRMLYMAPGN-
PAND_PSEAB       TYAIRAENGSKMISVNGAAAHKAKVGDRVIICAYAHYSEA---ELASHKPRMLYMAPGN-
PAND_PSEFL       TYAIRGEEGSRMISVNGAAAHKAKVGDRVIICAYAHYSEA---ELVNFKPRMLYMAPGN-
PAND_PSEU5       TYAIRGEEGSRIISVNGAAAHKAGVGHRLIICAYAHYSEA---ELANFKPHVLYMGADG-
PAND_CHRSD       TYAIRGEAGSRLISINGAAAHQAQVGDRVIICSYAHYAEH---ELATHQPALVYLQDGN-
PAND_ALCBS       TYAIRGEAGSKIISVNGAAAHKAQPGDRVIICAYANYTSA---ELINFKPSLIYMAEGN-
PAND_METCA       TYAIRAADGSGTISVNGAAARLAAVGDIVIICAYVGLNQA---ELAAYRPNLVYVDENN-
PAND_NITOC       TYAIRAEDNSGIISVNGAAAHKACPGDRLIICTYAVFERS---EMDSFKPLLIYLDDRN-
PAND_HYDCU       TYAIRAEENTGIISVNGAAAHKAAPGDLLIIATYASMDEK---EAEEFKPIMVYFDEKN-
PAND_SACD2       TYVILAEAGSRTISMNGAAARKVQVGDRVIIAAYSQMSEA---EADSFKPRLVYLDKDN-
PAND_ALKEH       TYAIRGEAGSRMISMNGAAAHLCSEGDRIIICCYANVDES---ELDRHEPALVYCDGDN-
PAND_HALHL       TYAIIGERGSRMISMNGAAAHKCNEGDRVIICAYAGVPES---ELGEFQPRLAYLDADN-
PAND_PSYIN       TYAITGERGSKMISVNGAAARLAAVGDRVIICTYASLNAA---EIVNHKPSLVYLDAQN-
PAND_BURMA       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMIDEQE--LKAGWKPDLVFVDEDN-
PAND_BURPS       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMIDEQE--LKAGWKPDLVFVDEDN-
PAND_BURP1       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMIDEQE--LKAGWKPDLVFVDEDN-
PAND_BURP0       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMIDEQE--LKAGWKPDLVFVDEDN-
PAND_BURTA       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMIDEEE--LKAGWKPDLVFVDEGN-
PAND_PARXL       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAVVDEAE--LKAGWKPDLVFVDDNN-
PAND_BURCA       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMVDEAE--LQAGWKPKLVFIDDGN-
PAND_BURCH       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMVDEAE--LQAGWKPKLVFIDDGN-
PAND_BURL3       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMVDEAE--LQAGWKPKLVFMDDGN-
PAND_BURCM       TYAIKGERGSGMISLNGSAARRAQLGDLVIIAAFAMVDEAE--LQAGWKPKLVFIDEGN-
PAND_ACISJ       TYAIKGQRGSGMISVNGSAARRACVGDLLIIAAFAQVAEA---DVAAHQPQLVFVNDQN-
PAND2_POLSJ      TYAIKGERGSGMISVNGSAARRAAAGDLIIIAAFAQVHND---QVSAHEPQLVFVDDKN-
PAND_POLNA       TYAIRAERGSRIISVNGSAARRAAVGDLVIIAAFAQVEEK---EVAGFSPKLVFVNPDN-
PAND1_POLSJ      TYAIRAERGSRIISVNGSAARRAAVGDLVIIAAFAQVHEE---YVAGFRPKLVFVDPDN-
PAND_RHOFT       TYAIRGERGTGIISVNGSAARRAAVGDLIIIAAFAQVPEA---QLDGFKPQLVFVDANN-
PAND_THIDA       TYAIRAARGSGVISVNGAAAHKANPGDLVIIATYATYNEL---EMARYAPELVYVDAAN-
PAND_METFK       TYAIRAERNSGIISVNGAAARKASPGDLLIIATYASYTEA---ELAQFKPQLVYVDADN-
PAND_DECAR       TYAIRAERGSGVISVNGSAARRAAPGDILIIATFAVYNEV---ELAKHEPDLIYVDTQN-
PAND_CHRVO       TYAIKAERGSGVISVNGSAARRAAPGDLLIIASFAQYEDA---ELKGHSPKLVFVDGDN-
PAND_XANAC       TYAIRAEDGSGIMSLNGGAARHVQVGDLIIVAAFASMSED---EAKTFKPNLVYVNAHN-
PAND_XANC5       TYAIRAEEGSGIMSLNGGAARHVQVGDLIIVAAFASMSED---EAKTFKPNLVYVNAHN-
PAND_XANOR       TYAIRAEDGSGIMSLNGGAARHVQVGDLIIVAAFASMSED---EAKTFKPNLVYVNARN-
PAND_XANOM       TYAIRAEDGSGIMSLNGGAARHVQVGDLIIVAAFASMSED---EAKTFKPNLVYVNARN-
PAND_XANCP       TYAIRAEQGSGIISLNGGAARHVQVGDLIIVAAFASMSED---QAKTFKPNLVYVDAHN-
PAND_XANC8       TYAIRAEQGSGIISLNGGAARHVQVGDLIIVAAFASMSED---QAKTFKPNLVYVDAHN-
PAND_XYLFA       TYAIRAEHGSGIISVNGGAARYVQVGDLVIVAAFAQMSED---EAAVFSPNLVYVDAAN-
PAND_XYLFT       TYAIRAEHGSGIISVNGGAARYVQVGDLVIVAAFAQMSED---EAAVFRPNLVYVNAAN-
PAND_RUTMC       TYTIRGKDNSGVISVNGAAAHKVNVGDMLIIAAYGVYSEK---ELESYTPRLCYVNDQN-
PAND_VESOH       TYTILGKDNSGIISVNGAAARKVNVGDVLIIAAYALYSEE---ELEGYAPRLCYVNNKN-
PAND_BORBR       TYIIKAARGSGAISLNGAAARRAQVGDLLIICTYGPMSEE---QSATHKPQVVLVDDAN-
PAND_BORPA       TYIIKAARGSGAISLNGAAARRAQVGDLLIICTYGPMSEE---QSATHKPQVVLVDDAN-
PAND_BORPE       TYIIKAARGSGAISLNGAAARRAQVGDLLIICTYGPMSEE---QSAAHKPQVVLVDDAN-
PAND_BORA1       TYIIKAARGSGAISLNGAAARRAQVGDLMIICTYGPMSEE---ESATHKPKVVLVDDAN-
PAND_CUPNH       TYIIKGERGSGEISLNGAAARRAHLGDQLIICTYAPMSDE---EIAAYKPKVILVNEKN-
PAND_RALSO       TYIIKGKRGSGEISLNGAAARRAHVGDKLIICTYAPMNEE---EVANYKPKIVLLGDGN-
PAND_METPP       TYVIPAPPGSGVISLNGAAARKAHVGDLLIICTYAPMNDA---EVATHKPKVVLLGPGN-
PAND_HERAR       TYAIQGARGSGEISLNGAAARCAHLGDLMIICTYGPMTDE---EIATYTPKIVFVDEDN-
PAND_AQUAE       TYVIPAPRYSGEVKLNGAAARLGHKGDLIIIASYAQYTEE---ELENYAPKLIFVNEKN-
PAND_DESPS       TYAIEGEAGSGAIQLNGAAARKGMIGDFLIIVTYALCSDD---EVDEHRPNVVLLNPDN-
PAND_SYNFM       TYAIAGPAGSGVFCLNGAAARMGAAGDLIIIATYAQYDEA---EIARHQPKVVLLDGDNR
PAND_LEPIN       TYIIEGKRGSGEICLNGAAARLGMKGDKIIIITYAQVEEQE--LASDYTPKVVHVDEKN-
PAND_LEPIC       TYIIEGKRGSGEICLNGAAARLGMKGDKIIIITYAQVEEKE--LASDYTPKVVHVDEKN-
PAND_LEPBJ       TYIIEGKRGSGEICLNGAAARLGMKGDKIIVITYAQVEENE--LPIDYIPKVVHVDENN-
PAND_LEPBL       TYIIEGKRGSGEICLNGAAARLGMKGDKIIVITYAQVEENE--LPIDYIPKVVHVDENN-
PAND_BRADU       TYVIEAPPMSGTMSLNGAAARLVMPGDKIIIVAYASFDEAE---AKKFKPHVVRVDRDN-
PAND_ANADE       TYAIKGERGSGIICINGAAAHLNRPGDMVILATFAELEEA---EARDFKPTVVLVDRQNK
PAND_MYXXD       TYALEGEAGSGVICINGAAAHLNKPGDLVILATFAEVEEA---EVANWKPTVVFVDKDNR
PAND_LEGPA       TYAITGEKGSTDICVNGAAAHLVTPGDLVIIASFTQILEE---DCAAHEPTVVFVDQFNR
PAND_LEGPH       TYAITGEKGSTDICVNGAAAHLVTPGDLVIIASFTQILEE---DCAAHEPTVVFVDQFNR
PAND_LEGPL       TYAITGEKGSTDICVNGAAAHLVTPGDLVIIASFTQILEE---DCAAHEPTVVFVDQFNR
PAND_RHOBA       TYAIEGLPNSNDVCANGAAAHLIRPGDHVILAAYAMVPEA---DAATHKPRLIFVDDNNQ
PAND_CORGL       TYVIVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDA---EAKAYEPKIVHVDADNR
PAND_CORGB       TYVIVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDA---EAKAYEPKIVHVDADNR
PAND_COREF       TYVITGDAGTGSICINGAAAHLINPGDLVIIMSYLQATDA---EARAYQPNIVHVDADNR
PAND_STRAW       TYVIEGERGSGVVGINGAAAHLVHPGDLVIIISYAQVSDA---EARALRPRVVHVDRDNR
PAND_STRCO       TYVIEGERGSGVIGINGAAAHLVHPGDLVILISYAQVTDA---EARSLRPRVVHVDGDNR
PAND_MYCBP       TYAITGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDA---RARTYQPRIVFVDAYNK
PAND_MYCTA       TYAITGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDA---RARTYQPRIVFVDAYNK
PAND_MYCBO       TYAITGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDA---RARTYQPRIVFVDAYNK
PAND_MYCTU       TYAITGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDA---RARTYQPRIVFVDAYNK
PAND_MYCPA       TYAITGERGSGVIGINGAAAHLVHPGDLVILIAYGTMEEA---EARAYQPRIVFVDADNK
PAND_MYCA1       TYAITGERGSGVIGINGAAAHLVHPGDLVILIAYGTMEEA---EARAYQPRIVFVDADNK
PAND_MYCUA       TYAITGERGSGVIGINGAAAHLVHPGDLVILIAYGTMQDA---EARAYQPRIVFVDADNK
PAND_MYCSJ       TYAITGARGSGVIGINGAAAHLVHPGDLVILIAYGTMEDA---EARAYQPRVVFVDADNR
PAND_MYCSK       TYAITGARGSGVIGINGAAAHLVHPGDLVILIAYGTMEDA---EARAYQPRVVFVDADNR
PAND_MYCSS       TYAITGARGSGVIGINGAAAHLVHPGDLVILIAYGTMEDA---EARAYQPRVVFVDADNR
PAND_MYCVP       TYVITGERGSGVIGINGAAAHLVHPGDLVILIAYGTMEDA---EARAYRPRVVFVDADNR
PAND_MYCLE       TYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDA---EAHAYQPRIVFVDADNK
PAND_NOCFA       TYVIAGERGSGVIGINGAAAHLVHPGDLVILIAYGMMNEQ---EIAEYDPKVVFVDERNR
PAND_RHOJR       TYVIAGERGSGVIGINGAAAHLVKPGDLVILIAYGVMNEQ---EVRDYEPRVVFVDAANS
PAND_NOCSJ       TYTIAGERGSGVIGINGAAARLVHPGDLVILIAYGQMEDV---EAKGFEPHVVFVDADNR
PAND_SACEN       TYVITGERGSGVIGINGAAAHLIEPGDLVILISYGVMDEL---EARSVRPKVIFVDADNR
PAND2_PAEAT      TYTIAGERGSGVIGINGAAAHLVHVDDTVILITYAEMTTE---EARTYEPRVVHVGKDNK
PAND_ARTS2       TYTIAGERGSGVIGINGAAAHLMHENDIVILITYAEMTTE---EAKAYTPKVVHVDKDNK
PAND1_PAEAT      TYTIAGERGSGVIGINGPAAHLVHENDTVILITYAQMTHE---EARAHEPRVVHVNQDNR
PAND_DEIRA       TYALSGPRGSGVIGINGAAAHLMRPGDMVIIAAFGNFSEE---EARTLEPKVVLVDAKNR
PAND_DEIGD       TYALSGPRGSGVIGINGAAAHLVQPGDLVIIAAYGNFSEE---EARTLEPRVVLVDAQNR
PAND_THET2       TYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEE---EARNLKPTVVLVDERNR
PAND_THET8       TYALPGERGSGVIGINGAAAHLVKPGDLVILVAYGVFDEE---EARNLKPTVVLVDERNR
PAND2_FRACC      TYAIAGPAGSGIIGINGAAARLVQPGDLVIIIAYGLMDDA---EARRHVPKVLFVDAANR
PAND_FRAAA       TYAIAGPAGSGVIGINGAAARLVQPGDLVIIIAYGMMDDA---EARRHVPRVLFVDAENR
PAND_ACIC1       TYVIAGERGSGVVGINGAAARLVHPGDLVIIMSYVQLPDA---EARRHHPRVVFVDAENR
PAND_THEFY       TYVLTGERGSGVIGINGAAARLVAPGDLVIIISYVQLTEA---ERATHRPHVVHVDANNR
PAND_MYCS2       TYAITGTPGSGVIGINGAAAHLISPGNLVIIMSFVHLDEA---ERADHRANVVHVDADNH
PAND_CORJK       TYAITGDRGTGVIGINGAAARLISPGDLVIIIGYAQYSEE---DLKNYASRVVFVDGNNK
PAND1_FRACC      TYVIEGEADSGTIGINGAAAHLISPGDLVIIVGYALMAEE---DARSYQPNVVFVNGDNQ
PAND_DEHM1       TYVIEGPAGSGQICLNGAAARMGMKGDKVIILGYSLITEE---DTLTHQPNLVYVDSLNR
PAND_DEHMC       TYVIEGSAGSGQICLNGAAARMGMKGDKIIILGYSLITEE---DTLIHQPNLVYVDALNR
PAND_PELCD       TYAIEGQPGSGVICINGAAARMVSKGDMVIIASWIDIDAD---KAAAYEPKLVFVDDKNV
PAND_PELPD       TYAIEGERGSGVICLNGAAARLVAPKDVVIIASFVNMSNQ---AAIKHEPKLVFVDGKNR
PAND_SYNAS       TYVITGKRGSGVICLNGAAARKVAKGDLVIIASYVIVDGE---EAKGWKPTCVFVDPEN-
PAND_BACAN       TYVIKGERGSGVVCLNGAAARLVQPGDKVIIICYGLVAEE---NIHKQEPKIAVLDDDNQ
PAND_BACHK       TYVIKGERGSGVVCLNGAAARLVQPGDKVIIICYGLVAEE---NIHKQEPKIAVLDDDNQ
PAND_BACCZ       TYVIKGERGSGVVCLNGAAARLVQPGDKVIIICYGLVAEE---NIHKQEPKIAVLDDDNQ
PAND_BACAH       TYVIKGERGSGVVCLNGAAARLVQPGDKVIIICYGLVAEE---NIHKQEPKIAVLDDDNQ
PAND_BACC1       TYVIKGERGSGVVCLNGAAARLVQPGDKVIIICYGLVAEE---NIHKQEPKIAVLDDNNQ
PAND_BACCR       TYVIKGERGSGVVCLNGAAARLVQPGDKVIIICYGLVTEE---EIHTQEPKIAVLDDNNQ
PAND_BACSK       TYVIKGPRGEGGICLNGAAARKVQPGDVVIILSYAMMENA---EALAHQPKVAILDENNR
PAND_BACHD       TYVIKGPRGSGVFCLNGAAARLVQEGDVIIVISYALVAEE---NVKEHQPKVAVLNESNQ
PAND_BACLD       TYIIPGERGSGVVCLNGAAARLVQVGDVVIIVSYAMMSEE---EAKTHKPKVAVLNERNE
PAND_BACSU       TYIIPGKRGSGVICLNGAAARLVQEGDKVIIISYKMMSDQ---EAASHEPKVAVLNDQNK
PAND_GEOKA       TYVIPGERGSGVFCLNGAAARLVQKGDVIIVISYVLVPEE---KIAAHRPKIAIMDENNR
PAND_GEOTN       TYIIPGERGSGVFCLNGAAARLVQKGDIIIVISYALVPEE---KIAMHRPKVAIMDENNR
PAND_LISIN       TYIIPGEPGSGVICLNGAAARHVQVGDVVIIMSYGMFTSE---EAKTHEPKIVVLDEKNH
PAND_LISMF       TYIIPGEPGSGVICLNGAAARHVQVGDVVIIMSYGMFTAE---EAKTHEPKIVVLDEKNH
PAND_LISMO       TYIIPGEPGSGVICLNGAAARHVQVGDVVIIMSYGMFTDE---EAKTHEPKIVVLDEKNH
PAND_LISW6       TYIIPGEPGSGVICLNGAAARHVQVGDVVIIMSYGMFTTE---EANKHEPKIVVLDEKNH
PAND_STAAC       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIKNHAPKVAVMNEDNV
PAND_STAAR       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIKNHAPKVAVMNEDNV
PAND_STAAM       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIKNHAPKVAVMNEDNV
PAND_STAAN       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIKNHAPKVAVMNEDNV
PAND_STAA3       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIKNHAPKVAVMNEDNV
PAND_STAA8       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIKNHAPKVAVMNEDNV
PAND_STAAS       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIQNHAPKVAVMNEDNV
PAND_STAAW       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIQNHAPKVAVMNEDNV
PAND_STAAB       TYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEE---EIKHHAPKVAVMNEDNV
PAND_STAES       TYVIAGERGSGKMCLNGAASRLVEVGDVIIIMTYAQLNED---EMVDHSPKVAVLNENNE
PAND_STAEQ       TYVIAGERGSGKMCLNGAASRLVEVGDVIIIMTYAQLNED---EMVDHSPKVAVLNENNE
PAND_STAHJ       TYVIAGERGSGKICLNGAASRLVEVDDVVIIMTYVQLDER---ELVDHAPKVAVMNEKNE
PAND_OCEIH       TYVIAGERNSGTICLNGAAARLVQPGDTVIIIAYALLSQE---ELQSFHPKVAIMDESNR
PAND_NEIMA       TYTIAGKRGSGVICLNGAAARLVQKSDIVIIMSYVQLSEP---EIAAHEPKVVLVDGNNK
PAND_NEIMB       TYTIAGKRGSGVICLNGAAARLVQKGDIVIIMSYVQLSEP---EIAAHEPKVVLVDGNNK
PAND_NEIMF       TYTISGKRGSGVVCLNGAAARLVQKGDIVIIMSYVQLSEP---EIAAHEPKVVLVDGNNK
PAND_NEIG1       TYTIAGKRGSGVICLNGAAARLVQKGDIVIIMSYIQLSEP---EIAAHEPKVVLVDGNNK
PAND_SYNWW       TYVIEGERGSKVICLNGAASRLVQKGDVVIILTYTVLQDE---ECHNHKPRLVFMDGNNN
PAND_BACFR       TYIIKGERGSGKICLNGAAARKVQPDDIVIIMSYALMDFE---EAKSFKPTVIFPDPATN
PAND_BACFN       TYIIKGERGSGKICLNGAAARKVQPDDIVIIMSYALMDFE---EAKSFKPTVIFPDPATN
PAND_BACTN       TYIIKGERGSGKICLNGAAARKVQPDDIVIIMSYALMDFE---EAKSFKPTVIFPDPATN
PAND_BACV8       TYIIKGERGSGCICLNGAAARKVQVGDIVIIMSYAMMDFE---EAKSFKPTVVFPDSAMN
PAND_PARD8       TYIIKGERGSGVVCLNGAAARKAQPGDIIIVMSYAMMDFE---EAKTFKPSVVFPDTATN
PAND_PORGI       TYTIPGKRGSGVICLNGAAARIVHPGDIIIIMAYAWMPME---EAKVFKPAVVFPDTATN
PAND_FLAPJ       TYAIKGAKNSGEITLNGPAARKVHKGDIIIIMSYARMDFE---KAKTFKPWLVFPNEKDN
PAND_GRAFK       TYVIPGLRNTGEITLNGAAARKVAKGDILIIIAYGIMELE---EARNFKPSLVFPDEETN
PAND_CYTH3       TYVIKGEKNTGVICLNGPAARKVAVGDIVIVIAYASMDFE---EAKKWKPTLIFPDANNR
PAND_CARHZ       TYTIPGPRGSGIISLNGAAARLCQIGDKVIIIAYALMEEK---EAKQWQPKVVFVDEYNK
PAND_DESHY       TYVIPGKRGERTVCLNGAAARLVQVGDEVIIIAYGIFTDE---AARTYEPKVIFVDEGNN
PAND_HUNT2       TYVIKGERGSGMICLNGAAARLVHPGDLIIIISYGIFDRE---EAKTFNPKVVFVDEKNK
PAND_MOOTA       TYAIPGPAGSGVICANGAAARLVQPGDIIIIIAYGIFDDR---EARTYQPRVIFLDARNK
PAND_CAMJR       TYTIATQ-EEGVVCLNGAAARLAEVGDKVIIMSYADFNEE---EAKTFKPKVVFVDENNT
PAND_CAMJJ       TYTIATQ-EEGVVCLNGAAARLAEVGDKVIIMSYADFNEE---EAKTFKPKVVFVDENNT
PAND_CAMJE       TYTIATQ-EEGVVCLNGAAARLAEVGDKVIIMSYADFNEE---EAKTFKPKVVFVDENNT
PAND_LACPL       TYVIAGPRDSGVICLNGATARCASVGDKVIIMNYAQFEPE---EAKHAKPYVVLVDDENR
PAND_ENTFA       TYTIAGERGTGMICLNGAAARCVSTGDKIILMAYCELNEN---EVKDHRPKVVFVDDNNK
PAND_CLOAB       TYVIAGEAGSGIICLNGAAARCAQAGDKVIIMCYCSLTPE---EASEHRPKVVFVNDDNS
PAND_CLONN       TYVIPGEENSKVICLNGAAARCVQVGDKVIIMCYCSMDEQ---EAKDYKPIVVFANEDNT
PAND_HELPY       TYVILGKK-RGEICVNGAAARKVAIGDVVIILAYASMNED---EINAHKPSIVLVDEKNE
PAND_HELPH       TYVILGKK-RGEICVNGAAARKVAIGDVVIILAYASMNED---EINAHKPCIVLVDEKNE
PAND_HELPJ       TYVILGKK-RGKICVNGAAARKVAIGDVVIILAYASMNED---EINTHKPSIVLVDEKNE
PAND_HELAH       TYVILGKK-RGEICVNGAAARKVAIGDVVIILAYASMNED---EMNVHKPCIVLVNEKNE
PAND_HELHP       TYVIYGDK-KGEICLNGAAARKVQIGDIIIIIAYATYTHN---ELEHYKPTIVQVNESNQ
PAND_CAMFF       TYVIKGEK-KGEICLNGAAARKVCIGDIIIIVSYASMKRK---KAKNFSPTIVHVNEKNE
PAND_SULDN       TYIILGERGKRDICLNGAAARKVHKGDKIIIVAYATYDEK---ELQNYKPRVVLVNDNND
PAND_WOLSU       TYVIRGERGSREICLNGAAARKVAIGDKIIIVAYAQYDRS---ELSSYKPTVVLVDEKND
PAND_BDEBA       TYVIKGKK--GEICLNGAAARHVQKGDLVIICSYCGLSMD---EAKKHEPTVVFVNAKNK
PAND_NOSS1       TYAIPAPAHSGIIELNGAAARLGIIGDRVIIMTYGQFTSE---ELKSYTPTVVIVDEKNR
PAND_TRIV2       TYAIPAPAHSGIIELNGAAARLGIIGDRVIIMTYGQFTSE---ELKSYTPTVVIVDEKNR
PAND1_GLOVI      TYAIEATAGSGAVVLNGAAARLAAPGDRVIVLAYGQGTTE---ELENHQPRVVHVDTGNR
PAND2_GLOVI      TYAIEASEGSGAVVLNGAAARLAAAGDQVIVLAYGQGTAV---ELEHHQPQVVYVDAQNR
PAND_CAUVC       TYAIEAPRGSKVIGVNGAAARLVQKNDLVIVVTYCQMPAE---EARNYAPTVVLLDEGNL
PAND_HYPNA       TYALEAPRGSRTIGVNGAAARHFAVGDTVIIAAFCGVEAE---KARQHAPTVVLLGEGNE
PAND_MARMM       TYAIEAPRGSRTFGINGAAARLAQVGDRIIVVAYAEMEAA---EAEQHDPVVVLLDEHNK
PAND_SALRD       TYTIPGEAGERTVCLNGPAARLAAPGDEVIVIAYAELTPS---EAREHHPRVVHVDENND
PAND_CHLCH       TYIIKGDHGSREIQLNGAAARCALPGDEIIIMTFAVMEEA---EARNYKPMVLIVDRHNN
PAND_CHLTE       TYIIEGTRGLREIQLNGAAARCALPGDEIIIMTFAEMEPE---EARNWKPMIVIVDRMNN
PAND_PELLD       TYIINGVRGSRVIQLNGAAARCALPGDEIIIMTFCEIDAE---ESREFKPMVLIVDRNNN
PAND_CHLPD       TYIINGEPGSRVIQLNGAAARCALPGDEIIIMTFAVMDEK---KARTFQPMVLIVDHLNN
PAND_FRATH       TYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYAQVD-------PTRENIKPKLVDLK-
PAND_FRATO       TYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYAQVD-------PTRENIKPKLVDLK-
PAND_FRATT       TYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVD-------PTRENIKPKLVDLK-
PAND_FRAT1       TYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVD-------PTRENIKPKLVDLK-
PAND_FRATW       TYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYTQVD-------PTRENIKPKLVDLK-
PAND_FRATN       TYVIKGEPNSKTIALNGPAARRCEIGDQLFIISYAQVD-------PTRENIKPKLVDLK-
PAND_COXBU       TYVIPGKRNSNIIALNGPAARKGEIGDQLFILSYALID-------PTQEKLDPVLVDLK-
PAND_THEMA       TYVIKGKRGSREINLYGAAARLGEEGDRVIIMAFTFSD-------KPVKAKTIVLNEKNE
PAND_HALWD       TYTIEGE--SRQMELNGAAARLAETGDVIIVISYGLYVKD-----EQPEPTVLLLDEENR
PAND_SYNY3       TYVLPGQAHSKEICPNGGAALLCQPGDRLIIFAYELCDRRE-VLQKGHQAKVLVTNESNE
PAND_TRIEI       TYVLPGQAGSGMVCPNGGAALLCKKDDILIIWANEQCDRAE-VLENGHKAKIFVADENNH
PAND_AGRFC       TYVIFGEAGSKCCILNGAAARTCQRGDQVIICSSSYVEETA---LYDTAPMVLTFTPKND
PAND_MAGSA       TYVIFGEPGSRCCVLNGAAARTCQKGDELIIAASADISGPEK--LYDIKPRILTFLPDNH
PAND1_RHILO      TYVILGERGSRCCILNGAAARTCQPDDPIIVCNSIYLDEAH---ITSLKPRIVTFDQDNH
PAND2_RHILO      TYVILGERGSRCCILNGAAARTCQPGDQIIVCNSIYLDEAH---ITSLKPRIVTFDQDNN
PAND_PYRIL       TYVIPGRPGE--VVLNGAAARLGEVGDVIIVAAYECVANPA-----SHIATIAIFE-GNK
                 ** :            * ::      . :::                             

PAND_ECO57       EMKRTAKAIPVQVA----------------------------------------------
PAND_ECOL6       EMKRTAKAIPVQVA----------------------------------------------
PAND_SHIBS       EMKRTAKAIPVQVA----------------------------------------------
PAND_SHIDS       EMKRTAKAIPVQVA----------------------------------------------
PAND_SHIFL       EMKRTAKAIPVQVA----------------------------------------------
PAND_SHISS       EMKRTAKAIPVQVA----------------------------------------------
PAND_ECOLI       EMKRTAKAIPVQVA----------------------------------------------
PAND_SHIF8       EMKRTAKAIPVQVA----------------------------------------------
PAND_ECOUT       EMKRTAKAIPVQVA----------------------------------------------
PAND_ECOK1       EMKRTAKAIPVQVA----------------------------------------------
PAND_ECOL5       EMKRTAKAIPVQVA----------------------------------------------
PAND_SALCH       EMKRTAKAIPVQVA----------------------------------------------
PAND_SALPA       EMKRTAKAIPVQVA----------------------------------------------
PAND_SALTI       EMKRTAKAIPVQVA----------------------------------------------
PAND_SALTY       EMKRTAKAIPVQVA----------------------------------------------
PAND_YERPE       QLQRKAKAVPVQVA----------------------------------------------
PAND_YERPA       QLQRKAKAVPVQVA----------------------------------------------
PAND_YERPN       QLQRKAKAVPVQVA----------------------------------------------
PAND_YERPP       QLQRKAKAVPVQVA----------------------------------------------
PAND_YERPS       QLQRKAKAVPVQVA----------------------------------------------
PAND_YERE8       QLQRKAKAVPVQVA----------------------------------------------
PAND_PECAS       ELQRQAKAIPVQVA----------------------------------------------
PAND_SODGM       QLQRTAKALPVQMA----------------------------------------------
PAND_PHOLL       IMRRIAKAVPVQVA----------------------------------------------
PAND_ACIAD       TVNHTANCIPVQVA----------------------------------------------
PAND_ACIBT       TVNHTANCIPVQVA----------------------------------------------
PAND_PSYA2       TVKDTANIIPVQVA----------------------------------------------
PAND_PSYCK       TVKDTANIIPVQVA----------------------------------------------
PAND_PSEAE       QLSHTSEAIPIQVA----------------------------------------------
PAND_PSEAB       QLSHTSEAIPIQVA----------------------------------------------
PAND_PSEFL       ELSRASNAIPVQLA----------------------------------------------
PAND_PSEU5       ELSHTSNAIPVQVA----------------------------------------------
PAND_CHRSD       QISHTSHAIPVQFA----------------------------------------------
PAND_ALCBS       EVKGTSNAIPVQVA----------------------------------------------
PAND_METCA       QITRTSHAIPVQAA----------------------------------------------
PAND_NITOC       FITHTGNAIPVQVA----------------------------------------------
PAND_HYDCU       QITHTRNTIPKQMQQLA-------------------------------------------
PAND_SACD2       AVERTTNTIPVQAA----------------------------------------------
PAND_ALKEH       RITHQRNGIPLQVA----------------------------------------------
PAND_HALHL       RITQRRGSIPLQVA----------------------------------------------
PAND_PSYIN       NIVRTSKDVPVQVA----------------------------------------------
PAND_BURMA       KIKGSRDHVPTQNWT---------------------------------------------
PAND_BURPS       KIKGSRDHVPTQNWT---------------------------------------------
PAND_BURP1       KIKGSRDHVPTQNWT---------------------------------------------
PAND_BURP0       KIKGSRDHVPTQNWT---------------------------------------------
PAND_BURTA       KIKGSRDHVPTQNWT---------------------------------------------
PAND_PARXL       RIKGSRDHVPTQNWT---------------------------------------------
PAND_BURCA       KIKGHRDHVPTQNWT---------------------------------------------
PAND_BURCH       KIKGHRDHVPTQNWT---------------------------------------------
PAND_BURL3       KIKGHRDHVPTQNWT---------------------------------------------
PAND_BURCM       KIKGHRDHVPTQNWT---------------------------------------------
PAND_ACISJ       RQVELRHHVPTQAL----------------------------------------------
PAND2_POLSJ      RQTELRHKVPTQRM----------------------------------------------
PAND_POLNA       RIKEERSTIPVQMAD---------------------------------------------
PAND1_POLSJ      RIKEERSTIPVQMP----------------------------------------------
PAND_RHOFT       RVQHQRSHIPVQAAAHPQEGRPS-------------------------------------
PAND_THIDA       AIVDTRQTIPVQAA----------------------------------------------
PAND_METFK       RIKNQRQHIPVQAA----------------------------------------------
PAND_DECAR       RIVRRGHKIPVQAAA---------------------------------------------
PAND_CHRVO       RLTEVKGATPTQPA----------------------------------------------
PAND_XANAC       AISHTNHSIPTQAA----------------------------------------------
PAND_XANC5       AISHTNHSIPTQAA----------------------------------------------
PAND_XANOR       AISHTNHSIPTQAA----------------------------------------------
PAND_XANOM       AISHTNHSIPTQAA----------------------------------------------
PAND_XANCP       AISHTNHSIPTQAA----------------------------------------------
PAND_XANC8       AISHTNHSIPTQAA----------------------------------------------
PAND_XYLFA       AMTHTNHSIPTQVA----------------------------------------------
PAND_XYLFT       AMTHTNHSIPTQVA----------------------------------------------
PAND_RUTMC       ILTKISS-----------------------------------------------------
PAND_VESOH       ILTKISTGSKKSSLY---------------------------------------------
PAND_BORBR       RVKEIRKFPA--------------------------------------------------
PAND_BORPA       RVKEIRKFPA--------------------------------------------------
PAND_BORPE       RVKEIRKFPA--------------------------------------------------
PAND_BORA1       RVKEIRKFPA--------------------------------------------------
PAND_CUPNH       GIKEIKKF----------------------------------------------------
PAND_RALSO       RIKEIKAV----------------------------------------------------
PAND_METPP       RIESVRKF----------------------------------------------------
PAND_HERAR       HFAGMKK-----------------------------------------------------
PAND_AQUAE       QPVEVKESTEVK------------------------------------------------
PAND_DESPS       TIKEIVK-----------------------------------------------------
PAND_SYNFM       PLSQGLKACLS-------------------------------------------------
PAND_LEPIN       RKR---------------------------------------------------------
PAND_LEPIC       RKR---------------------------------------------------------
PAND_LEPBJ       RKR---------------------------------------------------------
PAND_LEPBL       RKR---------------------------------------------------------
PAND_BRADU       RILAS-------------------------------------------------------
PAND_ANADE       IVAKDAVEVPGPA------RRVTA------------------------------------
PAND_MYXXD       VVPGQTKEIPGPQ------RRSA-------------------------------------
PAND_LEGPA       LKEIRP-ERIGVK------SRIPYPA----------------------------------
PAND_LEGPH       LKEIRP-ERIGVK------SRIPNPA----------------------------------
PAND_LEGPL       LKEIRP-ERIGVK------NKIPCSA----------------------------------
PAND_RHOBA       LSHVGP-EIAGPN------LRSDSDDTHLVRSTEMTPDGQPLAEGC--------------
PAND_CORGL       IVALGNDLAEALP-----GSGLLTS-RSI-------------------------------
PAND_CORGB       IVALGNDLAEALP-----GSGLLTS-RSI-------------------------------
PAND_COREF       IVALGNDAGEPIP-----GSSLLSS-RSL-------------------------------
PAND_STRAW       VVALGADPAEPVP-----GSDQARSPQAVTA-----------------------------
PAND_STRCO       IVGLGADASEPVP-----GSDQERSPQAVSA-----------------------------
PAND_MYCBP       PIDMGHDPAFVPE----NAGELLDPRLGVG------------------------------
PAND_MYCTA       PIDMGHDPAFVPE----NAGELLDPRLGVG------------------------------
PAND_MYCBO       PIDMGHDPAFVPE----NAGELLDPRLGVG------------------------------
PAND_MYCTU       PIDMGHDPAFVPE----NAGELLDPRLGVG------------------------------
PAND_MYCPA       PVDLGHDPAFVPDFEIAGAAELLDPRIVAR------------------------------
PAND_MYCA1       PVDLGHDPAFVPDFEIAGAAELLDPRIVAR------------------------------
PAND_MYCUA       QIDVGHDPAFVPAFDIPGAEELLNPRIGAR------------------------------
PAND_MYCSJ       QVHLGADPAMVPD----TAVDLMSPR----------------------------------
PAND_MYCSK       QVHLGADPAMVPD----TAVDLMSPR----------------------------------
PAND_MYCSS       QVHLGADPAMVPD----TAVDLMSPR----------------------------------
PAND_MYCVP       PIDLGVDPAYVPP----DAGELLSPR----------------------------------
PAND_MYCLE       PIDLGHDPGSVPL-DISVAAELFDPRIGAR------------------------------
PAND_NOCFA       PVELGSDPAHAPE-----GSGLTSPRSLTFA-----------------------------
PAND_RHOJR       PIELGADPAHAPE-----GSGLITPRMLSTLDAERESSLV--------------------
PAND_NOCSJ       VVSTGSDPADAPA-----GSGLLRGDRPAGR-----------------------------
PAND_SACEN       IVERGQDPGHAPA-----GSGLAGTAASVTSAITEAAAETDDAAKLDALLQQPEH-----
PAND2_PAEAT      ILQLGNDPAEGHT------PGLMRPPHALSNAAHLS------------------------
PAND_ARTS2       IVQIGNDPAEGHT------RGLMRPPFALNNSALN-------------------------
PAND1_PAEAT      VIQLGNDPAQGII------PGLLRPPFALNNPAL--------------------------
PAND_DEIRA       LLELQPV-----------------------------------------------------
PAND_DEIGD       ILDLQPA-----------------------------------------------------
PAND_THET2       ILEVRKG-----------------------------------------------------
PAND_THET8       ILEVRKG-----------------------------------------------------
PAND2_FRACC      IIGHGDDPAEPLP----GDPSSLRGDIPV-DIPVDIPV---------PTAAAAVRSAMAT
PAND_FRAAA       IIGRGHDPAEALP----DDPSSLRGDLAVPGNPVTAAARRGTPTHQAPVALPASRTVVAP
PAND_ACIC1       IIGTGTDPAEPLP----GS-GLLSGHHT--------------------------------
PAND_THEFY       IVALGDDLAEPVP----GS-DQKSGALLP-------------------------------
PAND_MYCS2       IVTIGSDPAQPVP----GAADQLVGRV---------------------------------
PAND_CORJK       QVELGGDPAQVPD-----GSGLK----NPRHPEA--------------------------
PAND1_FRACC      LVRMGTDPAEAYD-----GVGLVRGDTNSPQPSLSEQAGDPRRAQ---------------
PAND_DEHM1       ITKVKNGVASRNLEV---------------------------------------------
PAND_DEHMC       ITKVKNGVANQGLEV---------------------------------------------
PAND_PELCD       PTTQKSENPGQGSLRNAI------------------------------------------
PAND_PELPD       MLPTRAEEAGQARVRCVH------------------------------------------
PAND_SYNAS       ------------QIKH--------------------------------------------
PAND_BACAN       IIEMLGAEKAGTIL----------------------------------------------
PAND_BACHK       IIEMLGAEKAGTIL----------------------------------------------
PAND_BACCZ       IIEMLGAEKAGTIL----------------------------------------------
PAND_BACAH       IIEMLGAEKAGTIL----------------------------------------------
PAND_BACC1       IIEMLGAEKAGTIL----------------------------------------------
PAND_BACCR       IIEMLGAEKAGTIL----------------------------------------------
PAND_BACSK       IVEMLGTEPASTVR----------------------------------------------
PAND_BACHD       IVEMLGTEPASTVL----------------------------------------------
PAND_BACLD       IEEMLGQEPARTIL----------------------------------------------
PAND_BACSU       IEQMLGNEPARTIL----------------------------------------------
PAND_GEOKA       IVQLIAEEPAHTVL----------------------------------------------
PAND_GEOTN       IAQLIAEEPAHTIL----------------------------------------------
PAND_LISIN       IEMILPEEKAHTTL----------------------------------------------
PAND_LISMF       IEMILPEEKAHTTL----------------------------------------------
PAND_LISMO       IEMILPEEKAHTTL----------------------------------------------
PAND_LISW6       IEMILPEEKTHTTL----------------------------------------------
PAND_STAAC       IIEMIHEKENTIVL----------------------------------------------
PAND_STAAR       IIEMIHEKENTIVL----------------------------------------------
PAND_STAAM       IIEMIHEKENTIVL----------------------------------------------
PAND_STAAN       IIEMIHEKENTIVL----------------------------------------------
PAND_STAA3       IIEMIHEKENTIVL----------------------------------------------
PAND_STAA8       IIEMIHEKENTIVL----------------------------------------------
PAND_STAAS       IIEMIHEKENTIVL----------------------------------------------
PAND_STAAW       IIEMIHEKENTIVL----------------------------------------------
PAND_STAAB       IIEMIHEKENTIVL----------------------------------------------
PAND_STAES       IIEMINEKENTISNV---------------------------------------------
PAND_STAEQ       IIEMINEKENTISNV---------------------------------------------
PAND_STAHJ       IIQMIHEKEGTIIK----------------------------------------------
PAND_OCEIH       VKQMIEQEPPMTVL----------------------------------------------
PAND_NEIMA       IRDIISYEPPHTVL----------------------------------------------
PAND_NEIMB       IRDIISYEPPHTVL----------------------------------------------
PAND_NEIMF       IRDIISYEPPHTVL----------------------------------------------
PAND_NEIG1       IRDIISYEPPHTVL----------------------------------------------
PAND_SYNWW       IKELG-------------------------------------------------------
PAND_BACFR       SVVK--------------------------------------------------------
PAND_BACFN       SVVK--------------------------------------------------------
PAND_BACTN       SVVK--------------------------------------------------------
PAND_BACV8       KIV---------------------------------------------------------
PAND_PARD8       KLI---------------------------------------------------------
PAND_PORGI       KIILK-------------------------------------------------------
PAND_FLAPJ       SLK---------------------------------------------------------
PAND_GRAFK       LLK---------------------------------------------------------
PAND_CYTH3       LI----------------------------------------------------------
PAND_CARHZ       IVKIKEKEIHGQTE----------------------------------------------
PAND_DESHY       PVKIAHEEIHGQQS----------------------------------------------
PAND_HUNT2       IINIKSEEKHGEI-----------------------------------------------
PAND_MOOTA       ITAVKKGEQPGQVWV---------------------------------------------
PAND_CAMJR       ATKITNYEKHGAIF----------------------------------------------
PAND_CAMJJ       ATKITNYEKHGAIF----------------------------------------------
PAND_CAMJE       ATKITNYEKHGAIF----------------------------------------------
PAND_LACPL       LTKRVRYEKHGLLAEEL-------------------------------------------
PAND_ENTFA       VERVTSYEKHGRLSDIIL------------------------------------------
PAND_CLOAB       ISNVTEYEKHGTIG----------------------------------------------
PAND_CLONN       INKISNYERN--------------------------------------------------
PAND_HELPY       ILEKG-------------------------------------------------------
PAND_HELPH       ILEK--------------------------------------------------------
PAND_HELPJ       ILEKG-------------------------------------------------------
PAND_HELAH       ILEK--------------------------------------------------------
PAND_HELHP       ILSITNEV----------------------------------------------------
PAND_CAMFF       INE---------------------------------------------------------
PAND_SULDN       IEEILESI----------------------------------------------------
PAND_WOLSU       IVQIKHEV----------------------------------------------------
PAND_BDEBA       VTEKRKEDRKNNK-----------------------------------------------
PAND_NOSS1       PLEVRRYDDLLSQV----------------------------------------------
PAND_TRIV2       PLEVRRYDDLLSQV----------------------------------------------
PAND1_GLOVI      IVACV-------------------------------------------------------
PAND2_GLOVI      IVSVHRSVEHAG------------------------------------------------
PAND_CAUVC       IKKAA-------------------------------------------------------
PAND_HYPNA       IKRAS-------------------------------------------------------
PAND_MARMM       VIAKPQAA----------------------------------------------------
PAND_SALRD       VTKTRTLDVAKETDENLAPDGMEDVLIAEGPQS---------------------------
PAND_CHLCH       PKSRHLVGEQSEPLSN--------------------------------------------
PAND_CHLTE       PKRRHRVGSEDEYLG---------------------------------------------
PAND_PELLD       PKRRHRIGEEDEQLD---------------------------------------------
PAND_CHLPD       PKRRHRIGQEDEQLSSSI------------------------------------------
PAND_FRATH       ------TGD---------------------------------------------------
PAND_FRATO       ------TGD---------------------------------------------------
PAND_FRATT       ------TGD---------------------------------------------------
PAND_FRAT1       ------TGD---------------------------------------------------
PAND_FRATW       ------TGD---------------------------------------------------
PAND_FRATN       ------TGD---------------------------------------------------
PAND_COXBU       ------LND---------------------------------------------------
PAND_THEMA       -----IVQEK--------------------------------------------------
PAND_HALWD       ------ISERE-------------------------------------------------
PAND_SYNY3       TVDFYLQELIPKEDGVKFIN------NICSEAIPH-------------------------
PAND_TRIEI       CREFLYQILNPNQGSVEFHSLPVIPEGKTSEYLQQMIETNKI------------------
PAND_AGRFC       VKDVLRYRVKETARRPFDFFI-----------ETLPRAENSDVDDGSAA--------DRA
PAND_MAGSA       VDQVLYYDVFQSEKRPYDFRIVDADKHTIESCHTWPNVDITKLRSDLAAKGWSEAEIDSF
PAND1_RHILO      ILDRLSYSVDIDTDGRYSFAI-------------LDEADEPLVIPALVSGA---------
PAND2_RHILO      ILDRLSYSVDLDPDGRYCFSI-------------LDEADEALAIPALVSGA---------
PAND_PYRIL       LKEVRKISLSDMY-----------------------------------------------
                                                                             

PAND_ECO57       -------
PAND_ECOL6       -------
PAND_SHIBS       -------
PAND_SHIDS       -------
PAND_SHIFL       -------
PAND_SHISS       -------
PAND_ECOLI       -------
PAND_SHIF8       -------
PAND_ECOUT       -------
PAND_ECOK1       -------
PAND_ECOL5       -------
PAND_SALCH       -------
PAND_SALPA       -------
PAND_SALTI       -------
PAND_SALTY       -------
PAND_YERPE       -------
PAND_YERPA       -------
PAND_YERPN       -------
PAND_YERPP       -------
PAND_YERPS       -------
PAND_YERE8       -------
PAND_PECAS       -------
PAND_SODGM       -------
PAND_PHOLL       -------
PAND_ACIAD       -------
PAND_ACIBT       -------
PAND_PSYA2       -------
PAND_PSYCK       -------
PAND_PSEAE       -------
PAND_PSEAB       -------
PAND_PSEFL       -------
PAND_PSEU5       -------
PAND_CHRSD       -------
PAND_ALCBS       -------
PAND_METCA       -------
PAND_NITOC       -------
PAND_HYDCU       -------
PAND_SACD2       -------
PAND_ALKEH       -------
PAND_HALHL       -------
PAND_PSYIN       -------
PAND_BURMA       -------
PAND_BURPS       -------
PAND_BURP1       -------
PAND_BURP0       -------
PAND_BURTA       -------
PAND_PARXL       -------
PAND_BURCA       -------
PAND_BURCH       -------
PAND_BURL3       -------
PAND_BURCM       -------
PAND_ACISJ       -------
PAND2_POLSJ      -------
PAND_POLNA       -------
PAND1_POLSJ      -------
PAND_RHOFT       -------
PAND_THIDA       -------
PAND_METFK       -------
PAND_DECAR       -------
PAND_CHRVO       -------
PAND_XANAC       -------
PAND_XANC5       -------
PAND_XANOR       -------
PAND_XANOM       -------
PAND_XANCP       -------
PAND_XANC8       -------
PAND_XYLFA       -------
PAND_XYLFT       -------
PAND_RUTMC       -------
PAND_VESOH       -------
PAND_BORBR       -------
PAND_BORPA       -------
PAND_BORPE       -------
PAND_BORA1       -------
PAND_CUPNH       -------
PAND_RALSO       -------
PAND_METPP       -------
PAND_HERAR       -------
PAND_AQUAE       -------
PAND_DESPS       -------
PAND_SYNFM       -------
PAND_LEPIN       -------
PAND_LEPIC       -------
PAND_LEPBJ       -------
PAND_LEPBL       -------
PAND_BRADU       -------
PAND_ANADE       -------
PAND_MYXXD       -------
PAND_LEGPA       -------
PAND_LEGPH       -------
PAND_LEGPL       -------
PAND_RHOBA       -------
PAND_CORGL       -------
PAND_CORGB       -------
PAND_COREF       -------
PAND_STRAW       -------
PAND_STRCO       -------
PAND_MYCBP       -------
PAND_MYCTA       -------
PAND_MYCBO       -------
PAND_MYCTU       -------
PAND_MYCPA       -------
PAND_MYCA1       -------
PAND_MYCUA       -------
PAND_MYCSJ       -------
PAND_MYCSK       -------
PAND_MYCSS       -------
PAND_MYCVP       -------
PAND_MYCLE       -------
PAND_NOCFA       -------
PAND_RHOJR       -------
PAND_NOCSJ       -------
PAND_SACEN       -------
PAND2_PAEAT      -------
PAND_ARTS2       -------
PAND1_PAEAT      -------
PAND_DEIRA       -------
PAND_DEIGD       -------
PAND_THET2       -------
PAND_THET8       -------
PAND2_FRACC      Q------
PAND_FRAAA       R------
PAND_ACIC1       -------
PAND_THEFY       -------
PAND_MYCS2       -------
PAND_CORJK       -------
PAND1_FRACC      -------
PAND_DEHM1       -------
PAND_DEHMC       -------
PAND_PELCD       -------
PAND_PELPD       -------
PAND_SYNAS       -------
PAND_BACAN       -------
PAND_BACHK       -------
PAND_BACCZ       -------
PAND_BACAH       -------
PAND_BACC1       -------
PAND_BACCR       -------
PAND_BACSK       -------
PAND_BACHD       -------
PAND_BACLD       -------
PAND_BACSU       -------
PAND_GEOKA       -------
PAND_GEOTN       -------
PAND_LISIN       -------
PAND_LISMF       -------
PAND_LISMO       -------
PAND_LISW6       -------
PAND_STAAC       -------
PAND_STAAR       -------
PAND_STAAM       -------
PAND_STAAN       -------
PAND_STAA3       -------
PAND_STAA8       -------
PAND_STAAS       -------
PAND_STAAW       -------
PAND_STAAB       -------
PAND_STAES       -------
PAND_STAEQ       -------
PAND_STAHJ       -------
PAND_OCEIH       -------
PAND_NEIMA       -------
PAND_NEIMB       -------
PAND_NEIMF       -------
PAND_NEIG1       -------
PAND_SYNWW       -------
PAND_BACFR       -------
PAND_BACFN       -------
PAND_BACTN       -------
PAND_BACV8       -------
PAND_PARD8       -------
PAND_PORGI       -------
PAND_FLAPJ       -------
PAND_GRAFK       -------
PAND_CYTH3       -------
PAND_CARHZ       -------
PAND_DESHY       -------
PAND_HUNT2       -------
PAND_MOOTA       -------
PAND_CAMJR       -------
PAND_CAMJJ       -------
PAND_CAMJE       -------
PAND_LACPL       -------
PAND_ENTFA       -------
PAND_CLOAB       -------
PAND_CLONN       -------
PAND_HELPY       -------
PAND_HELPH       -------
PAND_HELPJ       -------
PAND_HELAH       -------
PAND_HELHP       -------
PAND_CAMFF       -------
PAND_SULDN       -------
PAND_WOLSU       -------
PAND_BDEBA       -------
PAND_NOSS1       -------
PAND_TRIV2       -------
PAND1_GLOVI      -------
PAND2_GLOVI      -------
PAND_CAUVC       -------
PAND_HYPNA       -------
PAND_MARMM       -------
PAND_SALRD       -------
PAND_CHLCH       -------
PAND_CHLTE       -------
PAND_PELLD       -------
PAND_CHLPD       -------
PAND_FRATH       -------
PAND_FRATO       -------
PAND_FRATT       -------
PAND_FRAT1       -------
PAND_FRATW       -------
PAND_FRATN       -------
PAND_COXBU       -------
PAND_THEMA       -------
PAND_HALWD       -------
PAND_SYNY3       -------
PAND_TRIEI       -------
PAND_AGRFC       IA-----
PAND_MAGSA       IASHFSL
PAND1_RHILO      -------
PAND2_RHILO      -------
PAND_PYRIL       -------