CLUSTAL format seed alignment for MF_00451

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NDK_AQUAE       ---MAVERTLIIVKPDAMEKGALGKILDRFIQE-GFQIKALKMFR-FTPEKAGEFYYVHR
NDK_AERPE       ---MAVQRTLLVVKPDGVERGLIGEVVSRVERK-GLKIVAMKMMR-LTREKAEEFYSVHR
NDK_THEAC       ----MTERTLVLLKPDAVKRRLIGRIISRLEDK-GLKVVALKFMQ-MTKDQAENHYSVHR
NDK_THEVO       -----MDRTLVLLKPDAVKRRLVGKIIERFEEK-GLKIVAMKFMQ-MTKDQAKTHYSVHQ
NDK_NOSS1       -----MERTFLAIKPDGVQRGLVGEIIRRFETK-GFTLVGLKFLQ-VSKELAEQHYGVHR
NDK_SYNE7       -----MERTFIAIKPDGVQRGLVGTIIGRFEQK-GFKLVGLKQLK-PSRELAEQHYAVHR
NDK_SYNY3       -----MERTFIMIKPDGVQRQLIGEIVGRFEKK-GFKLVAMKVMT-VSQELAEKHYEALN
NDK_HALSA       -MTDHDERTFVMVKPDGVQRGLIGDIVTRLETK-GLKMVGGKFMR-IDEELAHEHYAEHE
NDK_BACHD       -----MERTYLMIKPDGVQRNLIGEIVSRFEKK-GFTLIGAKLMT-VTKEQAETHYAEHK
NDK_BACSU       ----MMEKTFIMVKPDGVQRQLIGDILSRFERK-GLQLAGAKLMR-VTEQMAEKHYAEHQ
NDK_STAAM       -----MERTFLMIKPDAVQRNLIGEVISRIERK-GLKLVGGKLMQ-VPMELAETHYGEHQ
NDK_LISMO       -----MEQTYVMVKPDGVERGLIGEIVTRIEKK-GLKIVAGKLMQ-IDRELAEKHYAEHI
NDK_LISIN       -----MEQTYVMVKPDGVERGLIGEIVAKIEKK-GIKLVAGKLMQ-IDRTLAEQHYAEHI
NDK_DEIRA       -----MERTFAMIKPDGVRRGLTPEILARIHNK-GYRVVGLKQMM-MPRETAEQHYGEHR
NDK_MYCLE       ----MTERTLVLIKPDAVERQLIGEIISRIERK-GLTIAALELRQ-VGEELASQHYAEHE
NDK_MYCTU       ----MTERTLVLIKPDGIERQLIGEIISRIERK-GLTIAALQLRT-VSAELASQHYAEHE
NDK_MYCS2       ----MTERTLVLIKPDGVKRQLVGEILSRIERK-GLTLAALELKN-VSDDLARQHYAEHA
NDK_TREPA       ---MAFETTFVMLKPGVLQRRLVGEVLSRFERK-GLVLTALRLLC-VDTATAELHYAEHR
NDK_STRCO       ----MTQRSLVLLKPDAVRRGLTGEIISRIERKAGWQITALELRT-LDTETLEQHYGEHK
NDK_STRPN       -----MEQTFFIIKPDGVKRGLVGEVLKRIEQR-GFTIEKLEFRSQVSEELIDQHYQDLV
NDK_ARCFU       -----MERTFVMVKPDGVQRGLVGEVIGRLERK-GLKIVAMKMLW-IAREMAENHYAEHR
NDK_METTH       -----MEKSFVMLKPDAVKRRLAGRIIARFEDR-GLKIVAFKMLQ-IPEDLAMEHYQEHR
NDK_PYRAB       MCENEKERTLVIIKPDAVIRGLIGEIISRFEKR-GLKIVGMKMIW-ISKELAEKHYAEHR
NDK_PYRHO       --MSETERTLVIIKPDAVVRGLIGEIISRFEKK-GLKIVGMKMIW-IDRELAEKHYEEHR
NDK_METJA       ----MKERTFVALKPDAVKRKLIGKIIERFENK-GFEIVAMKMIK-LDREMAEKYYEEHK
NDK_SACS2       ---MVAQRTFVMIKPDGVKRGLIGEIISRFEKR-GLKIVSLKMVK-MSRDTAEKLYEEHK
NDK_SULTO       ---MSIQRTFVMIKPDGVRRNLIGEIISRFEKR-GLKIIGLKMVK-IDRPTAERLYEEHK
NDK_RHILO       ---MALERTFSMIKPDATRRNLTGAITKMLEDA-GLRVIASRRVW-MSRREAEGFYAVHK
NDK_RHIME       ---MAIERTFSMIKPDATKRNLTGAITKMLEDA-GLRVVASKRVW-MSRREAEGFYAVHK
NDK_BRUME       ---MAIERTFSMIKPDATRRNLTGAIIAKLEEA-GLRVVASKRVW-MSRREAEGFYAVHK
NDK_RHOSU       ---MAIQRTFSIIKPDATKRNLTGAINAKLEAA-GLRIVAQKRIH-LSKAQAAVFYAVHK
NDK_CAUVC       ----MTERTFSIIKPDATRRNLTGAINAVIEAA-GLRIVAQRRVK-LTEAQAKKFYEVHA
NDK_HELPY       ----MKQRTLSIIKPDALKKKVVGKIIDRFESN-GLEVVAMKRLH-LSVKDAENFYAIHR
NDK_HELPJ       ----MKQRTLSIIKPDALKKKVVGKIIDRFESN-GLEVVAMKRLH-LSVKDAENFYAIHR
NDK_CAMJE       -----MEKTLSIIKPDAVKKGVIGKILDRFESN-GLRIAAMKKVQ-LSKEQAENFYAVHK
NDK_MYXXA       ---MAIERTLSIIKPDGLEKGVIGKIISRFEEK-GLKPVAIRLQH-LSQAQAEGFYAVHK
NDK_NEIMA       ---MAIERTISIIKPDAVGKNVIGKIYSRFEEN-GLKIVAAKMKQ-LTLKEAQEFYAVHK
NDK_XYLFA       ---MVLERTLSIIKPDAVAKNVIGDIYSRFEKA-GLKVVAAKYKQ-LSRREAEGFYAVHR
NDK_PSEAE       ---MALQRTLSIIKPDAVSKNVIGEILTRFEKA-GLRVVAAKMVQ-LSEREAGGFYAEHK
NDK_RALSO       ---MAIERTLSIIKPDAVAKNVIGQIYARFEGA-GLKVVAAKMIH-LSRAEAEQFYAVHK
NDK_CHLMU       -----MEQTLSIIKPDSVGKAHIGEIVSIFEKA-GLRIAAMKMVH-LSVKEAEGFYAVHK
NDK_CHLTR       -----MEQTLSIIKPDSVGKAHIGEIIAIFEKS-GLRIAAMKMVH-LSVKEAEGFYVVHK
NDK_CHLPN       -----MEQTLSIIKPDSVSKAHIGEILSIFEQS-GLRIAAMKMMH-LSQTEAEGFYFVHR
NDK_ECOLI       ---MAIERTFSIIKPNAVAKNVIGNIFARFEAA-GFKIVGTKMLH-LTVEQARGFYAEHD
NDK_SALTY       ---MAIERTFSIIKPNAVAKNVIGSIFARFEAA-GFKIVGTKMLH-LTVEQARGFYAEHD
NDK_YERPE       ---MALERTFSIIKPNAVANNDIGAIYARFERA-GFKIIAAKMLH-LTKEQAEGFYAEHK
NDK_VIBCH       ---MALERTFSIIKPDAVKRNLIGEIYHRIEKA-GLQIIAAKMVH-LSEEQASGFYAEHE
NDK_HAEIN       ---MMTERTFSIIKPDVVKRNLIGAILTRFEQN-GFKIIASKMVR-LTREQAEGFYAEHQ
NDK_PASMU       ---MAVERTLSLIKPDAVKRHLIGAILSRFEQA-GFRVVAAKMLH-LTQAQAEGFYAEHQ
NDK_RICCN       ---MTIQYTFSMIKPDAIKRNKIGQVNTYLENA-GLKIVAQKMKF-LTKYEAACFYDEHR
NDK_RICPR       ---MTIQYTFSMIKPDVIKRNKIGQVNTYLENA-GLKIVAQKMKF-LTKYEAECFYDEHR
NDK_CLOPE       ---MRLEKSLVLIKPDAVERNLIGKILEVYEGA-GLKIKAMEMKQ-INKEFAEKHYEEHR
                      : :   :**.   .     :        *      .             *    

NDK_AQUAE       ERPFFQELVEFMSSGPVVAAVLEGEDAIKRVREIIGPTDSEEARKVAPNSIRAQFGTDKG
NDK_AERPE       DKPFFGELVEFITSGPVVAMVVEGDEAVSVVRLMIGSTD---GRKAAPGTIRGDFSLDIM
NDK_THEAC       SKPFFKDLVTYITSGPIVAMVLEGPKAIEVVRILAGSTD---GSKAQPGTIRGDFSMGIE
NDK_THEVO       NKPFFNDLVNYITSGPIVAMILEGAHAIEIVRLMSGATD---GSKAQPGTIRGDYSMGIE
NDK_NOSS1       ERPFFPSLVEFITSGPVVAMVWEGDGVIASARKIIGATNP--L-TAEPGTIRGDFGINIG
NDK_SYNE7       ERPFFNGLVEFITSGPIVAIVLEGEGVVAAARKLIGATNP--L-TAEPGTIRGDFGVNIG
NDK_SYNY3       DKPFFSGLVNFICSSPVVAMVWEGNSIVSTSRQMIGATDP--H-AAAPGTIRGDYGVSVG
NDK_HALSA       DKPFFDGLVSFITSGPVFAMVWEGADATRQVRQLMGATDA--Q-DAAPGTIRGDYGNDLG
NDK_BACHD       ERPFFGELVDFITSGPVFAMVWEGENVIATARKMMGATNP--A-DAEPGTIRGDFGVQVA
NDK_BACSU       GKPFFGELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNP--K-EALPGTIRGDYGMFVG
NDK_STAAM       GKPFYNDLISFITSAPVFAMVVEGEDAVNVSRHIIGSTNP--S-EASPGSIRGDLGLTVG
NDK_LISMO       GKSFFEDLIGFITSGPVFAMVLEGDDAIATARRMMGKTNP--L-EADPGTIRADYAIHTN
NDK_LISIN       GKPFFEDLIGFITSGPVFAMVLEGDDVIKTARRMMGKTNP--L-EADPGTIRAEYAIHTN
NDK_DEIRA       ERPFFGELVDFITGGPVVAIALEGENAIAGWRAMMGATNP--A-NAAPGTIRADFATSTG
NDK_MYCLE       SKPFFGSLLEFITSGPVMAAIVEGPRAVAAVRQLTGGTDP--VEKAAPGTIRGDLALETQ
NDK_MYCTU       GKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDP--VQAAAPGTIRGDFALETQ
NDK_MYCS2       DKPFFGSLLEFITSGPLVAAIVEGPRAVAAFRQIAGGTDP--VEKAVPGTIRGDFALITQ
NDK_TREPA       EKPFYPSLIAYITSAPVVALAFKGENAISLVRTLCGSTR---VEHAQPGTIRGDFALRTT
NDK_STRCO       GKPFYEPLVEFMASGPVVAMVVEGERVIEGVRALAGPTDP--I-AAAPGSIRGDYGVIVR
NDK_STRPN       GQSFYPPIREFMTSGPVLVGVISGPKVIETWRTMMGATRP--E-EALPGTIRGDFAKAAG
NDK_ARCFU       EKPFFSALVDYITSGPVVAMVVEGKNAIKVVRTLVGATNP--A-EAAPGTIRGDFGLDVG
NDK_METTH       EKPFFRDLVDYITSAPVIAMVIEGKDCISLIRKMVGATNP--A-EADLGTIRGDFALETG
NDK_PYRAB       EKPFFKSLVEYITRTPVVVMVVEGRCAIEVVRKMAGATDP--K-NAEPGTIRGDFALEVS
NDK_PYRHO       EKPFFKALIDYITKTPVVVMVLEGRYAVEVVRKMAGATDP--K-DAAPGTIRGDFGLEVS
NDK_METJA       GKEFYERLINFMTSGRMIVMVVEGENAISVVRKMIGKTNP--A-EAEPGTIRGDFALTTP
NDK_SACS2       GKSFFEELVNYVTSGPVVCMVIEGDDVVQVIRRMIGNTDP--K-EAPPGTIRGDYALSKS
NDK_SULTO       GKSFFEELISYITSGPVVCMVIEGDEAVSVVRKMIGNTDP--K-EAPPGTIRGDYALSKA
NDK_RHILO       DRPFFGELVEFMSSAPTIVQVLEGENAIARNREVMGATNP--A-NAAEGTIRKVHALSIG
NDK_RHIME       ERPFFGELVEFMSSGPTVVQVLEGENAIAKNREVMGATNP--A-NAAEGTIRKVHALSIG
NDK_BRUME       DRPFFGELVEFMSSGPTVVQVLEGENAIAKNREVMGATNP--A-NADEGTIRKAFALSIG
NDK_RHOSU       ERPFYDELCEFMASEPIVVQVLEGEDAIAKNREVMGATNP--A-EAAEGTIRKEFALSIG
NDK_CAUVC       ERPFYGELVGQMTAEPVVVQVLQGDNAVLKYREVMGATNP--E-NADEGTIRKLFALSIG
NDK_HELPY       ERPFFKDLIEFMVSGPVVVMVLEGKDAVAKNRDLMGATDP--K-LAQKGTIRADFAESID
NDK_HELPJ       ERPFFKDLIEFMVSGPVVVMVLEGKDAVAKNRELMGATDP--K-LAQKGTIRADFAESID
NDK_CAMJE       ERPFFKDLVEFMISGPVVVSILEGEGAVLKNRDLMGATNP--K-EAKAGTIRADFAESID
NDK_MYXXA       ARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNP--A-QAAEGTIRKDFATSID
NDK_NEIMA       DRPFYAGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNP--S-EAAEGTIRADFATSVS
NDK_XYLFA       DRPFFNALVEFMISGPVMIQVLESENAVARHRELLGATNP--K-DAALGTIRADFAESIE
NDK_PSEAE       ERPFFKDLVSFMTSGPVVVQVLEGEDAIAKNRELMGATDP--K-KADAGTIRADFAVSID
NDK_RALSO       ERPFFKDLVDFMISGPVMVQALEGESAIVKNRDLMGATDP--K-KAEKGTIRADFADSID
NDK_CHLMU       ERPFFQELVDFMISGPVVVMVLQGENAVARNRELMGATNP--K-EAAEGSIRALFGESIG
NDK_CHLTR       ERPFFQELVDFMISGPVVVMVLQGENAVDRNRELMGATNP--K-EAAEGSIRALFGESIG
NDK_CHLPN       ERPFFQELVDFMVSGPVVVLVLEGANAVSRNRELMGATNP--A-EAASGTIRAKFGESIG
NDK_ECOLI       GKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNP--A-NALAGTLRADYADSLT
NDK_SALTY       GKPFFDGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNP--A-NALAGTLRADYADSLT
NDK_YERPE       GRPFFDGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNP--D-NALAGTLRADFSDSFT
NDK_VIBCH       GKPFFEPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNP--E-EAACGTLRADYALSMR
NDK_HAEIN       GKEFFVPLVEYMMSSPIVVSVLEKENAVKDYRTLIGTTNP--E-TAAEGTIRKDFALSQR
NDK_PASMU       DKAFFPELVAYMISAPVLALVLEKENAVKDYRTLIGATNP--A-VAAEGTIRRDFAIDGR
NDK_RICCN       ARPFFNSLVEYITSGAVVLQVLKGEDAITLNRTVMGATNP--A-EAEAGTIRKDLGESIE
NDK_RICPR       ARSFFNSLVEYITSGAVVLQVLKGEDAITLNRTIMGATNP--A-EAKEGTIRKDLGESIE
NDK_CLOPE       DKQFFNSLIKYITRSPLVALILEGEDAINKIRSLNGATNP--E-KAEFGTIRRRFALSGT
                 : *:  :   :     .    .        * : * *       .  .::*   .    

NDK_AQUAE       KN-----AIHASDSPE--SAQYEICFIFSG---LEIV------------------
NDK_AERPE       KN-----IVHASDSPE--SFEREFRVLFSE---SEIVEW----------------
NDK_THEAC       KN-----IIHASDSPE--AYSHEMPIFFNE---SEIVEWSYGDEIIY--------
NDK_THEVO       KN-----IIHASDSLE--AYNHEMPIFFSD---NEIIEWAYGDEVIY--------
NDK_NOSS1       RN-----LIHGSDAPE--TAQKEVSLWFTD---AELVNWQPHLTPWLHE------
NDK_SYNE7       RN-----IIHGSDAIE--TAQQEIALWFSP---AELSDWTPTIQPWLYE------
NDK_SYNY3       RN-----IIHGSDAIE--TAKREISLWFKD---EEVNEWDATLNPWLYE------
NDK_HALSA       HN-----LIHGSDHEDEGANEREIALFFDD---DELVDWDRDASAWVYEDLADHD
NDK_BACHD       MN-----VIHGSDSPE--SAKREIDIFFDS---SELNEYDKVVNRWV--------
NDK_BACSU       KN-----IIHGSDSLE--SAEREINIFFKN---EELVSYQQLMAGWIY-------
NDK_STAAM       RN-----IIHGSDSLE--SAEREINLWFNE---NEITSYASPRDAWLYE------
NDK_LISMO       RN-----VIHGSDSPE--SAQREIQLFFAP---DEILSYQKAVDTWI--------
NDK_LISIN       RN-----VIHGSDSPE--SAKREIQLFFEP---HEILSYEKAVDTWI--------
NDK_DEIRA       EN-----VTHGSDSPE--SAERELALFFGD---GELLS-----------------
NDK_MYCLE       FN-----LVHGSDSTA--SAQREIALWFPG---I---------------------
NDK_MYCTU       FN-----LVHGSDSAE--SAQREIALWFPG---A---------------------
NDK_MYCS2       DN-----LVHGSDSPE--SAAREIALWFPG---EATA------------------
NDK_TREPA       TN-----IVHASDSPE--SAARELALYFSA---QDFVEWRDGNYDFF--------
NDK_STRCO       EN-----LIHASDSEE--SAERELKIFFPG---RV--------------------
NDK_STRPN       ENEIIQNVVHGSDSEE--SAKREIALWF---------------------------
NDK_ARCFU       RN-----VVHASDSPQ--SAEREISLFFSD---DEIVNWEKADEDWIYEER----
NDK_METTH       RN-----IIHASDSPE--SAEREIKLFFDE---SEICSYEMPDREMIYEE-----
NDK_PYRAB       DA--ICNVVHASDSKE--SAEREIKLYFRD---DEIFDYPRAEDWFYRKGI----
NDK_PYRHO       DA--ICNVIHASDSKE--SAEREISLFFKP---EELFEYPRAADWFYKKGI----
NDK_METJA       D-----NIIHASDSKE--SAEREIKLFFKE---DEIFDK----------------
NDK_SACS2       E-----NVIHASDSIE--KAQREMSLFFDK---SDL-------------------
NDK_SULTO       E-----NVIHASDSEE--KAKREMSIFFKE---EELVTPLAQVHM----------
NDK_RHILO       EN-----SVHGSDAPE--TAAQEIKYWFSD---TEIVG-----------------
NDK_RHIME       EN-----SVHGSDAPE--TAAEEIAYWFSG---TEIVG-----------------
NDK_BRUME       EN-----SVHGSDAPE--TAAEEIAYWFSG---TEIVG-----------------
NDK_RHOSU       EN-----SVHGSDAED--TAKEEIAYFFSG---LELVG-----------------
NDK_CAUVC       EN-----SVHGSDSLE--NAGIEIAQFFTE---DEIVG-----------------
NDK_HELPY       AN-----AVHGSDSLE--NAHNEIAFFFAA---RDL-------------------
NDK_HELPJ       AN-----AVHGSDSLE--NAHNEIAFFFAA---REF-------------------
NDK_CAMJE       AN-----AVHGSDSLE--NAKIEIEFFFKP---NEIC------------------
NDK_MYXXA       KN-----TVHGSDSLE--NAKIEIAYFFRE---TEIHSYPYQK------------
NDK_NEIMA       IN-----AVHGSDSVE--NAALEIAYFFSQ---TEICPR----------------
NDK_XYLFA       AN-----AAHGSDSVE--NAAIEVAYFFAA---TEIILR----------------
NDK_PSEAE       EN-----AVHGSDSEA--SAAREIAYFFAA---TEVCERIR--------------
NDK_RALSO       AN-----AVHGSDAAE--TAAVEVAFFFPG---LNIYSR----------------
NDK_CHLMU       VN-----AVHGSDSLE--NAAIEVSYFFAK---TEIVNALA--------------
NDK_CHLTR       VN-----AVHGSDSLE--NAAIEVSYFFAK---TEIVNSVA--------------
NDK_CHLPN       VN-----AVHGSDTLE--NAAVEIAYFFSK---IEVVNASKPLV-----------
NDK_ECOLI       EN-----GTHGSDSVE--SAAREIAYFFGE---GEVCPRTR--------------
NDK_SALTY       EN-----GTHGSDSLE--SAQREIAFFFGE---GEVCPRTR--------------
NDK_YERPE       AN-----AVHGSDAVE--SAQREIAYFFAA---DEIFPRS---------------
NDK_VIBCH       YN-----SVHGSDSPA--SAAREIEFFFPE---SEICPRP---------------
NDK_HAEIN       EN-----SVHGSDSIE--SANREIAYFFTN---SEIFER----------------
NDK_PASMU       HN-----SVHGSDSLD--SAKREIAYFFVE---SEIF------------------
NDK_RICCN       AN-----SIHGSDSEN--SAKREIEFFFNK---SEIIE-----------------
NDK_RICPR       AN-----SIHGSDSEN--SAKREIKFFFSK---SEIIE-----------------
NDK_CLOPE       EN-----SVHASDSIE--SAEKEIKLWFPKVFYEEICG-----------------
                         *.**         *.   *