CLUSTAL format seed alignment for MF_00452

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PCKG_BORBR      --------MNKPSEVKPVALNVPDYVKHSGLIAWVERIAALTKPDRVVWCDGSQEEYDRL
PCKG_BORPA      --------MNKPSEVKPVALNVPDYVKHSGLIAWVERIAALTKPDRVVWCDGSQEEYDRL
PCKG_RALSO      --------MNQPVMQGVPALNVPAYVKHARLVAWVSEIAALTKPERVVWCDGSQEEYDRL
PCKG_BURMA      -----MTRSNVVAATRTVPIDVPEYVKHRGLIDWVARIAELTEPDRVVWCDGSQQEYDRL
PCKG_BURPS      -----MTRSNVVAATRTVPIDVPEYVKHRGLIDWVARIAELTEPDRVVWCDGSQQEYDRL
PCKG_AROAE      --------MNH-RFSEAALAATPTYVRHEGLKKWVAGIAALTEPERVVWCDGSEEEYDRL
PCKG_ACIAD      ----------------MTQVNAPEFVRHPKLIAWVEEIAKLTKPAKIEWCDGSDEEYQRL
PCKG_CHLLI      --------------MEPIPINAPDYVKNLKLLQWVKETVALCQPDSVCWCDGSTEEYDRL
PCKG_CHLTE      --------------MEPIPINAPDSVRNLKLLQWVRETAELCQPDSVCWCDGSVEEYDRL
PCKG_GEOSL      --------------------MSYELPNNEKLLKWVEEVAILCEPDRIHWCDGSQEEYDEL
PCKG_COREF      --------MTTAAIPGLQ---GEAPTNNQELLNWIAEAVELFQPEAVVFADGSQEEWDRM
PCKG_CORGL      --------MTTAAIRGLQ---GEAPTKNKELLNWIADAVELFQPEAVVFVDGSQAEWDRM
PCKG_CORJK      -----------MTIRGLV---GEAPTKNQEMLNWIEEAVELFQPESVVFCDGSEEEWNEL
PCKG_CORDI      --------MSTVSIKGLE---GEAPTKNEVLLNWIAENVELFQPDRVVFADGSQEEWDRL
PCKG_MYCBO      --------MTSATIPGL----DTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRL
PCKG_MYCTA      --------MTSATIPGL----DTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRL
PCKG_MYCLE      --------MTSATIPGL----DTAPTNHQKLLSWLEEVAELTHPAQVVFADGSDEEWQQL
PCKG_MYCPA      --------MTSATIPGL----DTAPTNHQGLLSWVQEVAELTQPDRVVFADGSDEEFNRL
PCKG_MYCSM      --------MTSATIPGL----DTAPTKHQGLLAWVQEVAELTQPDRVVFADGSDEEYERL
PCKG_NOCFA      --------MTSATIPGLRGSDGQAPTEHSELLAWVQEVAELTQPERVVWADGSDEEWERL
PCKG_STRAW      ---------MARDIAAPSS----VPTQHKELISWVNEIAELTQPDSVVWCDGSEAEYERL
PCKG_STRCO      ---------MARDIAAPP-----VPTNHQELISWVNEIAELTQPDAVVWCDGSEAEYERL
PCKG_LEIXX      ---------MTAPPRPTAPPGAAALTGLAALHAWVDELAALLQPDGIVWCDGSRGQTDRL
PCKG_CHLAB      -----------------MTSVWSEAIQHKDLKQWIQEVAELVTPKDIRICNGSDSEYVEI
PCKG_CHLCV      -----------------MTSAWSSEIQHEGLKQWIQEVAELVTPDDIRICNGSDSEYAEV
PCKG_CHLPN      -------------------MVWSTNIKHEGLKSWIDEVAKLTTPKDIRLCDGSDTEYDEL
PCKG_CHLMU      -----------------MTGDWMSKITHSGLKSWIEEVIALVSPKDVRLCDGSEAEYQQL
PCKG_CHLTR      -----------------MTGDWISKITHSGLKSWIEEVIALVSPDDVRLCDGSEAEYQQL
PCKG_TREPA      --------------------MELHEIAHARAKAWIEEMVALCAPDTVYVCDGSKKEYDTI
PCKG_THEAC      ------------------MLAIDESELNQHAMKWIEGIKKFTEAEDVVVCDGTPEEFKQI
PCKG_THEVO      ------------------MLALDETEINDGAKRWIVSIAKHLNPSSIYVCDGTKEEFDDL
PCKG_PYRAB      -------MEKLKRFLPEDQYEKLAAINNPYLHEFLAEWIEWLKPSKVFVCTDSPEDEEYV
PCKG_PYRHO      -------MEKLRELLPKDQYEKIAAINNPYLHEFLAEWIEWLEPSKVFVCTDSPEDEEYV
PCKG_PYRFU      --MMNEALKKLEELLDKDQFEKIKAINNPYLHSFLAEWIQWLEPSKVYVCTDSEEDEEYV
PCKG_THEKO      ----MNALERLEKLLDKEQFEKVKAIDNPELHEFLAEWIEWLEPDKVFVCTDSPEDEGYV
PCKG_SULAC      ---MKVDLSPLNGIISDKAFQKLKSINNPSLVHFLSKTIELTTPDRVYVSFGEEKDREYV
PCKG_SACS2      ---MKSSLDFLNNFIQRDAVKKLESINNYPLIEFLNSVVKLCEPDSVYLITGSDEEKEYI
PCKG_SULTO      MYIMRSSFNFLNLLVSDKMIKKIEILNNSYVEEFIEKTAELCNPSSIYLVTS-EEDKEYI
                                                 ::        .  :    .   :   :

PCKG_BORBR      CEQMVQGGTMRRLNPAKRANSYLACSDPSDVARVEDRTFICSEREEDAGPTNNWAAPQAM
PCKG_BORPA      CEQMVQGGTMRRLNPAKRANSYLACSDPSDVARVEDRTFICSEREEDAGPTNNWAAPQAM
PCKG_RALSO      CAEMVAAGTLKQLNPAKRKNSYLALSDPSDVARVEDRTFICSQKQEDAGPTNNWTAPAEM
PCKG_BURMA      CDAMVEQRTMVRLNPAKRPNSFLALSDPSDVARVEDRTFICSEHRDDAGPTNHWVAPAEM
PCKG_BURPS      CDAMVEQRTMVRLNPAKRPNSFLALSDPSDVARVEDRTFICSEHRDDAGPTNHWVAPAEM
PCKG_AROAE      CTEMVDAGMLIKLNPEKRKNSYLAWSDPSDVARVEDRTYICSKDKADAGPTNNWEDPAKM
PCKG_ACIAD      IDLMIANGTMQALNQEKHPGSYLANSDPSDVARVEDRTFICSEKQEDAGATNNWEAPEVM
PCKG_CHLLI      CEEMVNSGTFIKLSEQKRPNSYLCRSDPSDVARVEDRTFICSIRRQDAGPTNNWVAPKEM
PCKG_CHLTE      CNEMVASGTFIKLSEQKRPNSYLCRSDPSDVARVEDRTFICSIRRQDAGPTNNWVAPKEM
PCKG_GEOSL      CELLVQNGTFRKLNPEKRPNSYLAWSDPIDVARVEDRTFICSLSKQDAGPTNNWMNPKEM
PCKG_COREF      AEELVEAGTLIRLNEEKRPNSFLARSNPSDVARVESRTFICSENQEDAGPTNNWAPPQAM
PCKG_CORGL      AEDLVEAGTLIKLNEEKRPNSYLARSNPSDVARVESRTFICSEKEEDAGPTNNWAPPQAM
PCKG_CORJK      AEQLVEHGTLIKLDEEAQPNSFLARSNPSDVARVESRTFICSKTEEDAGPTNNWMDPEQM
PCKG_CORDI      TTQLVESGTLIRLNEEKRPNSFLARSNPADVARVESRTFICTPTPEGAGPTNHWADPAEM
PCKG_MYCBO      CDQLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMDPGEM
PCKG_MYCTA      CDQLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMDPGEM
PCKG_MYCLE      TERLVAAGTFKKLNDEKHPNSYLALSDPSDVARVESRTFICSEREIDAGPTNNWMDPAEM
PCKG_MYCPA      AAELVEAGTLKKLNEKKHPNSYLALSDPSDVARVESRTYICTEEESGAGPTNNWMDPTEM
PCKG_MYCSM      CAHLVEAGTFQKLNPEKQPNSYLALSDPSDVARVESRTFICTEREIDAGPTNNWMDPAEM
PCKG_NOCFA      TDQLVEAGTFKRLDPKKKPNSFLALSDPSDVARVESRTFICSRSEADAGPTNNWVDPAEM
PCKG_STRAW      SEELVRKGTFRKLDPIKRPNSYYAASDPTDVARVEDRTFICSEKEEDAGPTNHWKDPAEM
PCKG_STRCO      CGELVEKGTFRKLDPIKRPNSYYAASDPTDVARVEDRTFICSAKEEDAGPTNHWKDPAEM
PCKG_LEIXX      TKQLVAEGKLIRLNPEWRPNSFLSRTDPSDVARVEDRTFICSLDEADAGPTNNWREPEGM
PCKG_CHLAB      YGLMQQSGVAIPLNRDVHPNCFLVRSSPEDVARVEQFTFICTKEQKDAGPTNNWRDPEEM
PCKG_CHLCV      YGIMEKSGVAIPLNPDVHPNCFLVRSSPEDVARVEQFTFICTTKKEDAGPTNNWRDPQEM
PCKG_CHLPN      CTLMESTGTMIRLNPEFHPNCFLVRSSADDVARVEQFTFICTSTEAEAGPTNNWRDPQEM
PCKG_CHLMU      CQQMQEAGVMTLLNPELHPNCFLVRSSPDDVARVEQFTFICTKTKEEAGPTNNWRDPQEM
PCKG_CHLTR      CQQMQDAGVMTPLNPELHPNCFLVRSSPSDVARAEQFTFICTKTQEEAGPTNNWRDPQEM
PCKG_TREPA      MQKMVDAGLATPLKK--RKNCFLFRSQPSDVARVEARTFIASKREDDAGPTNHWTDPAEL
PCKG_THEAC      SNELIKSGEFIKLNENRYPNSFLYRSDRTDVARSEERTFIAAPDASMAGSLNNHMTLQQV
PCKG_THEVO      ASAMVKDGEMIKLNEKNFKNSYLYRSNATDVARTEERTFISARDKSFVGPLNNFLPLDRV
PCKG_PYRAB      RWKALYYGEEKMLEMPRHTVHY---DNYYDQARDKANTKLLVPKGVTLPFLNTMDREEGL
PCKG_PYRHO      RWKALYYGEEKMLEIPKHTVHY---DNYYDQARDKTNTKLLVPKGVELPFLNTMNREEGL
PCKG_PYRFU      RWKALYYGEERMLEMVRHTVHY---DNYYDQARDKQNTKLLVPKGTNLPFLNTMDREDGL
PCKG_THEKO      RWKALYYGEERMLETPNHTVHY---DNYYDQARDKANTAILLPGGKKLPYINTKDRDEGL
PCKG_SULAC      KKRALETKEEIKLKMEGHTIHF---DHPLDQARAREDTFILT--DEKIPFVNTKPRDEGL
PCKG_SACS2      RKKALESKEEIRLQTSGHTIHF---DHPLDQARAREDTFILS--DTKIPYVNTKPRNEGL
PCKG_SULTO      RRKAIETKEELPLKTLGHTIHF---DHPLDQARARDDTFILT--DDKIPFVNTKKREDGI
                            *.       :       * ** .  * :           *       :

PCKG_BORBR      RETLG------GLFDGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIMTRM
PCKG_BORPA      RETLG------GLFDGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIMTRM
PCKG_RALSO      RQTLN------GLFDGCMRGRTLYVVPFSMGPLGSPIAHIGVELSDSPYVAVNMRIMTRM
PCKG_BURMA      RATLN------GLFRGAMRGRTLYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIMTRM
PCKG_BURPS      RATLN------GLFRGAMRGRTLYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIMTRM
PCKG_AROAE      RDTLN------GLFAGSMRGRTMYVIPFSMGPLGSPIAHIGIEISDSPYVVTNMRTMTRM
PCKG_ACIAD      RAKLN------GLFDGCMQGRTMYVVPFSMGPLGSHIAQIGIELTDSPYVAVSMRKMARM
PCKG_CHLLI      KATLN------KLFTGCMKGRTMYVIPFSMGPLGSHIAHIGVEITDSPYVVTNMRIMTRM
PCKG_CHLTE      KATLN------KLLAGCMKGRTMYIIPFSMGPLGSHIAHIGVEITDSPYVVTNMRIMTRM
PCKG_GEOSL      KEKLL------GLFKGCMKGRTMYVIPFSMGPLGSPIAKIGVEITDSPYVVVNMRIMTRM
PCKG_COREF      KEEMT------EVYRGSMKGRTMYVVPFCMGPITDPEPKLGVQLTDSAYVVMSMRIMTRM
PCKG_CORGL      KDEMS------KHYAGSMKGRTMYVVPFCMGPISDPDPKLGVQLTDSEYVVMSMRIMTRM
PCKG_CORJK      RAEMR------EHFSGSMKGRRMYIVPFCMGPITDPSPKLGIEITDSPYVVMSMRIMTRM
PCKG_CORDI      KAELT------ERFRGSMKGRTMYVVPFCMGPINDPAPKLGVQLTDSEYVVLSMRIMTRM
PCKG_MYCBO      RSIMK------DLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRM
PCKG_MYCTA      RSIMK------DLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRM
PCKG_MYCLE      RSTMT------ELYRGCMRGRTMWVVPFCMGPPGAEDPKLGVEITDSEYVVASMKVMTRM
PCKG_MYCPA      RSIMT------DLYRGCMRGRTMWVVPFCMGPLGVEDPKLGVEITDSEYVVISMKVMTRM
PCKG_MYCSM      RGIMT------DLYRGSMRGRTLYVVPFCMGPLDAEDPKLGVEITDSEYVVVSMRTMTRM
PCKG_NOCFA      RATMT------ELYRGCMKGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRVMTRM
PCKG_STRAW      REIFAGEQG---VFRGSMRGRTMYVVPFCMGPLGSDLSAIGVEITDSAYVAVSMRTMTRM
PCKG_STRCO      RAIFTGDKGEGGLFRGSMRGRTMYVVPFCMGPLGSPLSALGVEITDSAYVAASMRTMTRM
PCKG_LEIXX      RAELR------EAFAGSMRGRTLYVVPFSMGPIGGPLSQLGVQLTDSAYVAVSMGIMTRV
PCKG_CHLAB      RQELH------GLFRGCMRGRTLYVVPFCMGPLNSPFSLIGVEITDSPYVVCSMKIMTRM
PCKG_CHLCV      RQELQ------GLFRGCMRGRTLYVIPFCMGPLNSPFSLIGVELTDSPYVVCSMKIMTRM
PCKG_CHLPN      RRELH------QLFRGCMQGRTLYIVPFCMGPLDSPFSIVGVELTDSPYVVCSMKIMTRM
PCKG_CHLMU      RAELH------ELFQGCMQGRTLYIVPFCMGPLHSPFSLVGIEITDSPYVVCSMKIMTRM
PCKG_CHLTR      RAELH------ALFRECMRGRTLYIVPFCMGPLNSPFSLIGVEITDSPYVVCSMKIMTRM
PCKG_TREPA      KKTMT------GLYSQCMKGRTMYVIPFSMGPVGSPISKNGIEITDSEYVVCNMHIMTRV
PCKG_THEAC      SEVWN------KFFRGAYRGKTMFVIPYALGPLNSRFTDYGIEITDSRYVVLNLHYITRM
PCKG_THEVO      KQVWN------QFFKGAYTGKTMFVIPYALSSPESKFADFGIEVTDSKYVVLNLHYITRM
PCKG_PYRAB      KEIRE-------IMKGIMKGKELFICFFVLGPRNSIFTIPAVQLTDSAYVAHSEFLLYRK
PCKG_PYRHO      KEIRE-------IMKGIMRGKELFICFFVLGPTNSIFTIPAVQLTDSAYVAHSEFLLYRK
PCKG_PYRFU      REIRE-------IMKGIMRGKELFIGFFVLGPKNSVFTIPAVQLTDSAYVMHSEFLLYRK
PCKG_THEKO      KEIRE-------LMKGIMKGKELFVCFFVLGPKNSIFTIPAVQLTDSAYVAHSEFILYRK
PCKG_SULAC      REMLS-------LLKGSMKGREMYVGFYSLGPRNSKFSILAVQITDSPYVIHSENILYRN
PCKG_SACS2      SEMLT-------LLKGSMRGREMYVGFYSLGPRNSPFQILAVQVTDSPYVIHSENILYRI
PCKG_SULTO      REVLS-------LLKDSMKGREMYVGFYSLGPKNSIFQHLAIQISDSPYVIHSENILYRL
                                   *: :::  : :..        .::::** **  .   : * 

PCKG_BORBR      GRKVFDVLGSDGAFVPCVHSVGMPLAE----GQQD-VAWPCNP-TKYIV-HYPETREIWS
PCKG_BORPA      GRKVFDVLGSDGAFVPCVHSVGMPLAE----GQQD-VAWPCNP-TKYIV-HYPETREIWS
PCKG_RALSO      GRAVYDVLGADGEFVPCVHTVGKPLAA----GEQD-VPWPCNP-TKYIV-HFPETREIWS
PCKG_BURMA      GRAVLDALGERGEYVPCVHSVGRPLAA----GEQD-VPWPCNP-TKYIV-HFPESREIWS
PCKG_BURPS      GRAVLDALGERGEYVPCVHSVGRPLAA----GEQD-VPWPCNP-TKYIV-HFPESREIWS
PCKG_AROAE      GRAVFDVLGTDGEFVPCVHSVGAPLGD----GEKD-SRWPCNPDTKYIV-HFPETREIWS
PCKG_ACIAD      GKAVYDVLGTDGEFVPCVHTVAAPLAE----GQKD-VAWPCNP-EKYIV-HYPETREIWS
PCKG_CHLLI      GRQVLELLDEEAEFVPCLHSVGAPLEP----GQAD-VPWPCND-TKYIV-HFPEEHAIVS
PCKG_CHLTE      GRAVLDLLDEEAEFVPCLHSVGAPLEP----GQQD-VPWPCND-TKYIV-HFPEERSIVS
PCKG_GEOSL      GKKVLDILGEQGEFVPCLHSVGAPLEQ----GQKD-STWPCNK-EKYIV-HFPEERSIWS
PCKG_COREF      GKDALDKIGENGSFVRCLHSVGAPLEE----GQED-VAWPCND-TKYIT-QFPETKEIWS
PCKG_CORGL      GIEALDKIGANGSFVRCLHSVGAPLEP----GQED-VAWPCND-TKYIT-QFPETKEIWS
PCKG_CORJK      GKEALDKIGENGEFVKGLHSVGAPLEP----GQED-STWPCND-TKYIT-HFPEDREIWS
PCKG_CORDI      GAEALAKIGDTGSFVPCLHSVGAPLEP----GQED-VAWPCNE-EKYIT-HFPETKEIWS
PCKG_MYCBO      GKAALEKMGDDGFFVKALHSVGAPLEP----GQKD-VAWPCSE-TKYIT-HFPETREIWS
PCKG_MYCTA      GKAALEKMGDDGFFVKALHSVGAPLEP----GQKD-VAWPCSE-TKYIT-HFPETREIWS
PCKG_MYCLE      GTSALEKIGDDGFFVKALHSVGAPLQP----GQQD-MPWPCNE-TKYIT-HFPETREIWS
PCKG_MYCPA      GKAALEKMGDDGFFVKALHSVGAPLEP----GQKD-VPWPCND-TKYIT-HFPETREIWS
PCKG_MYCSM      GRAALDKLGDDGFFVKALHSIGAPLEP----GQKD-VPWPCND-TKYIT-HFPETREIWS
PCKG_NOCFA      GKAALEKMGTDRPFVKALHSVGAPLAE----GQQD-VPWPCND-TKYIT-HFPEDREIWS
PCKG_STRAW      GQPVLDELGTDGFFVRAVHTLGAPLEA----GEAD-VPWPCNS-TKYIS-HFPESREIWS
PCKG_STRCO      GQPVLDELGDEGFFVKAVHSVGAPLEP----GQAD-VPWPCNS-TKYIS-HFPEDREIWS
PCKG_LEIXX      ASAVLDLIAAGQPWVPTVHSVGAPLVDEAGVRQED-VAWPCNP-VKYIV-QFPETREIWS
PCKG_CHLAB      GEEVLKALGTSGSFHKCLHSVGVPLAP----GEKD-LAWPCNP-QHMRIVHFQDDSSVMS
PCKG_CHLCV      GAEVLKSLGTTGSFHKCLHSVGAPLSP----GEKD-VAWPCNP-KNMRIVHFQDDSSVMS
PCKG_CHLPN      GDDVLRSLGTSGKFLKCLHSVGKPLSP----GEAD-VSWPCNP-KSMRIVHFQDDSSVMS
PCKG_CHLMU      GASVLEMLGSSGTFYKCLHSVGKPLAP----GEKD-VAWPCNP-GHMRIVHFQDDSSVMS
PCKG_CHLTR      GASVLAMLGSNGTFYKCLHSVGKPLAP----GEKD-VAWPCDP-EHMRIVHFQDDSSVMS
PCKG_TREPA      GTRVLEALGTDGEFVPCLHSVGKPLGP----GVTDAGQWPCADMERKYISHFPEERLVWS
PCKG_THEAC      GKQVIGSMPEK--FVKGVHATGT-LDP----GNKFIIHIPWDK-------PEGVDADILS
PCKG_THEVO      GKGVIEKIGDR--FIKGVHATGN-LDP----GNKFIIHMPWEK-------PEGVDADILS
PCKG_PYRAB      GYEEFKRLGPTKNFLKFVHSAGELDER-----------KTSKNLDKRRIYIDLVDETVYS
PCKG_PYRHO      GYEEFKRLGPTKNFFKFVHSAGELDER-----------KTSKNLDKRRIYIDLLDETVYS
PCKG_PYRFU      GYEEFKRLGPTKNFLKFVHSAGELDER-----------KTSKNLDKRRIYIDLVDETVYS
PCKG_THEKO      GYEEFKRLGRSARFFRFVHSAGELDER-----------KTSKNLDKRRIYIDLEDETVYS
PCKG_SULAC      AFEDFYG---DKPFLKFIHSKGQLD------------------IKKRRIMIDVKENTVYS
PCKG_SACS2      AFEDFSN---NTKFLRFVHSKGEPD------------------IKKRRIMIDLANNTVYS
PCKG_SULTO      DFDDFKG---NKQFLKFVHSKGELD------------------IKKRRIMIDLKEDTVYS
                             :   :*: .                                   : *

PCKG_BORBR      FGSGYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPKGRKYHVAAAFPSACGK
PCKG_BORPA      FGSGYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPKGRKYHVAAAFPSACGK
PCKG_RALSO      FGSGYGGNALLGKKCFALRIASTMGRDQGWLAEHMLILGVTSPEGKTYHVAAAFPSACGK
PCKG_BURMA      FGSGYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPEGRKYHIAAAFPSACGK
PCKG_BURPS      FGSGYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPEGRKYHIAAAFPSACGK
PCKG_AROAE      YGSGYGGNALLGKKCFALRIASTMARDEGWLAEHMLILGVESPEGEKTYVAAAFPSACGK
PCKG_ACIAD      YGSGYGGNALLGKKCLALRIASAMGREQGWLAEHMLILGVTNPKGEKHYIAAAFPSACGK
PCKG_CHLLI      YSSGYNGNTLLGKKCFALRIASSMARDEGWLAEHMLILGVESPAGEKDYVAAAFPSACGK
PCKG_CHLTE      YGSGYGGNALLGKKCFALRIASSMARDEGWLAEHMLILGVESPEGEKDYVAAAFPSACGK
PCKG_GEOSL      FGSGYGGNALLGKKCLALRIASKQGKDEGWLAEHMLILGVESPTGDKTYVGAAFPSACGK
PCKG_COREF      YGSGYGGNAILAKKCYALRIASVMAREEGWMAEHMLILKLTNPEGQAYHIAAAFPSACGK
PCKG_CORGL      YGSGYGGNAILAKKCYALRIASVMAREEGWMAEHMLILKLINPEGKAYHIAAAFPSACGK
PCKG_CORJK      YGSGYGGNAILAKKCYALRIASAMARDEGWMAEHMLILKLISPEDKAYYICAAFPSACGK
PCKG_CORDI      YGSGYGGNAILAKKCYALRIASVMAKEEGWMAEHMLILKLTSPEKKVYYIAAAFPSACGK
PCKG_MYCBO      YGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGK
PCKG_MYCTA      YGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGK
PCKG_MYCLE      YGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGK
PCKG_MYCPA      YGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGK
PCKG_MYCSM      FGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYFIAAAFPSACGK
PCKG_NOCFA      YGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYIAAAFPSACGK
PCKG_STRAW      YGSGYGGNALLGKKCYALRIASVMARDEGWLAEHMLILKLTPPQGESKYVAAAFPSACGK
PCKG_STRCO      YGSGYGGNALLGKKCYALRIASVMARDEGWLAEHMLVLKLTPPTGAPKYVAAAFPSACGK
PCKG_LEIXX      YGSGYGGNAILAKKCFALRIASVMARDEGWLAEHMLIVKVTSPEGRVFHFAAAFPSSCGK
PCKG_CHLAB      FGSGYGGNALLGKKCVALRLASYIARSQGWLAEHMLIIGVTNPEGQKKYFAASFPSACGK
PCKG_CHLCV      FGSGYGGNALLGKKSVALRLASYIARSQGWLAEHMLIIGVTNPEGQKKYFAASFPSACGK
PCKG_CHLPN      FGSGYGGNALLGKKCVALRLASYMAKSQGWLAEHMLIIGITNPEGKKKYFSASFPSACGK
PCKG_CHLMU      FGSGYGGNALLGKKCVALRLASYLGHKQGWLAEHMLVIGVTNPEGRKKYFAAAFPSACGK
PCKG_CHLTR      FGSGYGGNALLGKKCVALRLASYLGHQQGWLAEHMLIIGVTNPEGRKKYFAAAFPSACGK
PCKG_TREPA      FGSGYGGNALLGKKCFALRIASVLARDEGWLAEHMLILKITNPAGKTKYIGAAFPSACGK
PCKG_THEAC      VNTNYGGNALLSKKCHALRIASVRARKEGWLAEHMLLLEVEDPHGRKVYITGAFPSASGK
PCKG_THEVO      VNTNYGGNALLSKKCHALRIASVRAREEGWLAEHMLLLEVKDPQGKSHFITGAFPSASGK
PCKG_PYRAB      ANTQYGGNTIGLKK-LAFRLTIQRAVREGWLSEHMFLMRVNGPNGRKTYFTGAYPSMCGK
PCKG_PYRHO      ANTQYGGNTIGLKK-LAFRLTIQRAVKEGWLSEHMFLMRVNGPNGRKTYFTGAYPSMCGK
PCKG_PYRFU      ANTQYGGNVIGLKK-LAFRLTIQRAVREGWLSEHMFLMRVNGPNGRKTYFTGAYPSMCGK
PCKG_THEKO      VNTQYGGNTIGLKK-LAFRLTIKRAVEEGWLSEHMFLMRVNGPHGRKTYFTGAYPSMCGK
PCKG_SULAC      VNTTYAGNSVGLKK-LALRLTVTKAVNEGWLSEHMAIVGFEGNRG-THYFTASFPSGSGK
PCKG_SACS2      VNTTYAGNSVGLKK-LALRLTIMKAVEEGWLSEHMAIVGFNGDKG-IHYFTASFPSGSGK
PCKG_SULTO      VNTTYAGNSVGLKK-LALRLTIAKAVKEGWLSEHMAIIGFEGDKG-THYFTASFPSGSGK
                 .: * ** :  **  ::*::   .  :**::*** :: .        .. .::** .**

PCKG_BORBR      TNFAMLIPPH--GMDGWKVTTIGDDIAWIKPGPDG----RLHAINPEAGYFGVAPGTSEK
PCKG_BORPA      TNFAMLIPPH--GMDGWKVTTIGDDIAWIKPGPDG----RLHAINPEAGYFGVAPGTSEK
PCKG_RALSO      TNFAMLIPPA--GFDGWKVTTIGDDIAWIKPRQDANGQTRLYAINPEAGFFGVAPGTGEK
PCKG_BURMA      TNFAMLIPPK--GFEGWRVTTIGDDIAWLKPGRDG----RLYAINPEAGYFGVAPGTGEK
PCKG_BURPS      TNFAMLIPPK--GFEGWRVTTIGDDIAWLKPGRDG----RLYAINPEAGYFGVAPGTGEK
PCKG_AROAE      TNFAMLIPPK--SFNGWKITTIGDDIAWIKPGKDG----KFYAINPEAGFFGVAPGTSEK
PCKG_ACIAD      TNFAMLIPPA--GYEGWKIETVGDDIAWIKPGEDG----RLYAINPEAGFFGVAPGTNTK
PCKG_CHLLI      TNFAMIIPPG--EMEGWKITTVGDDIRLDQQGKDG----RLHAINPEYGFFGVAPGTSDK
PCKG_CHLTE      TNFAMMIPPG--EMEGWKITTVGDDIAWIKQGKDG----RLYAINPEYGFFGVAPGTSEK
PCKG_GEOSL      TNFAMLIPPKPLQDKGWKVTTIGDDIAWIKPGPDG----QVYAINPEYGYFGVAPGTNVK
PCKG_COREF      TNLAMITPTI----PGWKAEVVGDDIAWLKFREDGH----LYAVNPENGFFGVAPGTNYA
PCKG_CORGL      TNLAMITPTI----PGWTAQVVGDDIAWLKLREDG-----LYAVNPENGFFGVAPGTNYA
PCKG_CORJK      TNLAMIQPTI----PGWRAEVVGDDIAWLHFGEDGR----LYAVNPENGFFGVAPGTNYA
PCKG_CORDI      TNLAMLQPTI----DGWSAEVVGDDIAWLRFGEDGR----LYAINPENGFFGVAPGTNYS
PCKG_MYCBO      TNLAMLQPTI----PGWRAETLGDDIAWMRFGKDGR----LYAVNPEFGFFGVAPGTNWK
PCKG_MYCTA      TNLAMLQPTI----PGWRAETLGDDIAWMRFGKDGR----LYAVNPEFGFFGVAPGTNWK
PCKG_MYCLE      TNLAMLQPTI----PGWRAETLGDDIAWMRFGKDGR----LYAVNPEFGFFGVAPGTNWK
PCKG_MYCPA      TNLAMLQPTI----PGWRAETLGDDIAWMRFGKDGR----LYAVNPEFGFFGVAPGTNWK
PCKG_MYCSM      TNLAMLQPTI----EGWRAETVGDDIAWMRFGKDGR----LYATNPEFGFFGVAPGTNWS
PCKG_NOCFA      TNLAMIQPTV----PGWRAETLGDDIAWMRFGKDGR----LYAVNPEFGFFGVAPGTNHS
PCKG_STRAW      TNLAMLEPTV----GGWTVETIGDDIAWMRFGEDGR----LYAINPEAGFFGVAPGTGEH
PCKG_STRCO      TNLAMLEPTI----SGWTVETIGDDIAWMRFGEDGR----LYAINPEAGFFGVAPGTGEH
PCKG_LEIXX      TNLAMLKPSI----PGWTVETVCDDIAWLRPGPDGR----LRAINPEAGFFGVAPGTGEL
PCKG_CHLAB      TNLAMLKPKI----PGWKVECVGDDIAWIRPGPDGR----LYAVNPEFGFFGVAPGTSAT
PCKG_CHLCV      TNLAMLMPKI----PGWEVECIGDDIAWIRPGPDGR----LYAVNPEFGFFGVAPGTSET
PCKG_CHLPN      TNLAMLMPKL----PGWKIECIGDDIAWIRPGRDGR----LYAVNPEYGFFGVAPGTSER
PCKG_CHLMU      TNLAMLMPKL----PGWKVECIGDDIAWIRPGDDGR----LYAVNPEFGFFGVAIGTSEK
PCKG_CHLTR      TNLAMLMPKL----PGWKVECIGDDIAWIRPGNDGR----LYAVNPEFGFFGVALGTSET
PCKG_TREPA      TNLAMMIPTL----PGWKVETVGDDIAWMKFGKDGR----LYAINPEAGFFGVAPGTSDF
PCKG_THEAC      TNLAMINPPKQYAEAGWKTRLLSDDIAWMKM-KDGM----LYATNPENGFFAVVPGTNYR
PCKG_THEVO      TNLAMISPPKDYRDAGWSTRLISDDISWIKI-VDGK----FMATNPENGFFAVVPGTNYN
PCKG_PYRAB      TSTAMIP----------WENIVGDDLVFIKNVDGTA-----RAVNVEIGVFGIIEGINEK
PCKG_PYRHO      TSTAMIP----------WENIVGDDLVFIKNVDGIA-----RAVNVEIGVFGIIEGVNQK
PCKG_PYRFU      TSTAMIP----------WENIVGDDLVFIKNLDGVA-----RAVNVEIGVFGIIEGINQK
PCKG_THEKO      TSTAMIP----------WENIVGDDLTFILPVNGIA-----RGANVEKGVFGIIQGVNPE
PCKG_SULAC      TSTSML------------GSLISDDLAFIKEIDGVC-----RAVNPEIGIFGIIQGINER
PCKG_SACS2      TSTSMI------------GNLISDDLAFIREFEGLP-----KAVNPEIGVFGIIQGINAR
PCKG_SULTO      TSTSMM------------GKLISDDLAFIREINGVA-----RAVNPEIGVFGIIQGINSK
                *. :*:               : **:       .        . * * * *.:  * .  

PCKG_BORBR      TNFNAMATLK--ANVIFTNVALTDDGDVWWEGMTDTPPAHLIDWQG-------QDWTPAI
PCKG_BORPA      TNFNAMAMLK--ANVIFTNVALTDDGDVWWEGMTDTPPAHLIDWQG-------QDWTPAI
PCKG_RALSO      TNFNAMATLK--ENVIFTNVALTDDGDVWWEGMTDTPPAHLTDWQG-------QDWTPAI
PCKG_BURMA      TNPNALATLR--ENVIFTNVALTEDGDVWWEGLTDTPPARLTDWQG-------NAWTPEI
PCKG_BURPS      TNPNALATLR--ENVIFTNVALTEDGDVWWEGLTDTPPARLTDWQG-------NAWTPEI
PCKG_AROAE      TNYNAMATLK--ENIIFTNVALTDDGDVWWEGMSKEAPAHLIDWQG-------NDWTPEI
PCKG_ACIAD      TNPNCMATLH--KDVIYTNVAVTEDGQVWWEGLSKEVPANLTNWKG-------Q------
PCKG_CHLLI      SNPNAMATLH--ANCIFTNVALTPDGDVWWEDMTDTPPEYLIDWQG-------KPWVP--
PCKG_CHLTE      SNPNAMATLH--ANCIFTNVALTPDGDVWWEGMTDTPPDFLIDWQG-------KPWVP--
PCKG_GEOSL      TNPNAMASCS--ANTIFTNVALTPDDDVWWEGMTDEPPAQLTDWQG-------NPWTP--
PCKG_COREF      SNPIAMQTMEP-GNTLFTNVALTDDGDIWWEGMDGDAPEHLIDWKG-------NDWTP--
PCKG_CORGL      SNPIAMKTMEP-GNTLFTNVALTDDGDIWWEGMDGDAPAHLIDWMG-------NDWTP--
PCKG_CORJK      SNPMAMKSMEP-GNTLYTNVALTDDNNVWWESKEGE-PQHLIDWLG-------NEWTP--
PCKG_CORDI      SNPNAMRTMEP-GNTLFTNVALTDDGDIWWEDLENM-PEHLTDWLG-------NDWTP--
PCKG_MYCBO      SNPNAMRTIAA-GNTVFTNVALTDDGDVWWEGLEGD-PQHLIDWKG-------NDWYFR-
PCKG_MYCTA      SNPNAMRTIAA-GNTVFTNVALTDDGDVWWEGLEGD-PQHLIDWKG-------NDWYFR-
PCKG_MYCLE      SNPNAMRTIAA-GNTVFTNVALTDDNDVWWEGLEGE-PAHLIDWKG-------NDWYAG-
PCKG_MYCPA      SNPNAMRTIEA-GNTVFTNVALTDDNDVWWEGLEGQ-PEHLIDWKG-------NDWYAG-
PCKG_MYCSM      SNPNAMKTIAA-GNTVFTNVAKTDDGDVWWEGLEGD-PQHLIDWKG-------NDWTPE-
PCKG_NOCFA      SNPNAMATMEA-GNTVYTNVALTDDNDVWWEGLEGE-PDHLIDWKG-------NDWYLR-
PCKG_STRAW      TNANAMKTLW--GNSVFTNVALTDDNDIWWEGMTEETPAHLTDWKG-------NDWTP--
PCKG_STRCO      TNANAMKTLW--GNSVFTNVALTDDGDVWWEGMTEETPAHLTDWKG-------NDWTP--
PCKG_LEIXX      TNKTAVEALW--GNTIFTNVALRDDGDVWWEGLTAEPPAHLIDWEG-------NDWTP--
PCKG_CHLAB      TNPNALATCT--SNSIFTNVALTPDGDVWWEGLTSQPPEGLIDWQG-------KPWKP--
PCKG_CHLCV      TNPNALATCK--TNSVFTNVALTPDGNVWWEGLTSQPPEGLIDWRG-------NPWQP--
PCKG_CHLPN      TNPNALATCR--SNSIFTNVALTADGDVWWEGLTEQPPEPLTDWLG-------KPWKP--
PCKG_CHLMU      TNPNALATCH--SDSIFTNVALTSDGDVWWEGKTATPPQGMIDWKG-------RNWTP--
PCKG_CHLTR      TNPHALATCY--ADSLFTNVALTADGDVWWEGKTTTPPQGMIDWKG-------RTWVS--
PCKG_TREPA      SNKNAMDSIK--ENAIFTNCGLTEDGDVWWEGIGYPAKGTIIDWHGVSRPAPTRDKSP--
PCKG_THEAC      TNKNAMITLS--RNTIFTNTGMTKTGEPWWEGLDPL-QEELYDWKG-------VLRKP--
PCKG_THEVO      TNKNAMATLS--KNTIFTNVGLTMSGDPWWEGLDPV-YDELYDWKG-------NKRKI--
PCKG_PYRAB      DDPIIWQVLHSPVEIIFSNVLVK-DGKPYWNGMGIEIPDEGENHSGKWW------RGKRD
PCKG_PYRHO      DDPIIWKVLHSPVEIIFSNVLVK-DGKPYWNGMGIEIPDEGENHSGKWW------RGKRD
PCKG_PYRFU      DDPIIWQVLHSPVEIIFSNVLVK-DGKPYWNGMGIEIPDEGENHSGKWW------RGKRD
PCKG_THEKO      DDPIIWQVLHSPVEIIFSNVLVK-DGKPYWNDMGIEIPDEGENHSGKWW------RGKKD
PCKG_SULAC      DDPVIWDVLHKPGEVIFSNVLMTDDGGVYWEGSEVEKPEKGYNYEGAWT------KESGK
PCKG_SACS2      DDPIIWEVLHKPGEVIFSNVLMTEDGDVYWEGSELPKPERGYNHEGRWD------RESGK
PCKG_SULTO      DDPIIWEVLHKPNEVIFSNVLMTEDGYVYWEGSDDKRPERGINYEGFWS------NDMNK
                 :           : :::*      .  :*:.          :  *              

PCKG_BORBR      AAETGRKAAHPNARFTAPAAQCPSIDPE-WENPKGVAIDAFIFGGRRSTTVPLVTEARNW
PCKG_BORPA      AAETGRKAAHPNARFTAPAAQCPSIDPE-WENPKGVAIDAFIFGGRRSTTVPLVTEARNW
PCKG_RALSO      AKETGRKAAHPNSRFTAPAAQCPSIDPE-WDNPAGVAIDAFIFGGRRSTTVPLVTEARDW
PCKG_BURMA      GRETGRKAAHPNSRFTAPASQCPSIDDD-WENPGGVPIDAFIFGGRRSTTVPLVTEARDW
PCKG_BURPS      GRETGRKAAHPNSRFTAPASQCPSIDDD-WENPGGVPIDAFIFGGRRSTTVPLVTEARDW
PCKG_AROAE      AKETGRKAAHPNSRFTAPASQCPSVDPQ-WEDPAGVPISAFIFGGRRATTVPLVYEAFNW
PCKG_ACIAD      PHVAGEKAAHPNARFTVAAGQCPSIDAD-WENPAGVPISAFIFGGRRADTVPLVSEAFDW
PCKG_CHLLI      --GCDRPAAHPNSRFTAPASQCPVIDPA-WENPRVLPISAFIFAGRRGDTIPLVYQSSNW
PCKG_CHLTE      --GCERPAAHPNARFTAPAHQCPVIDEN-WENPDGVPISAFIFGGRRGDTIPLVYQSANW
PCKG_GEOSL      --DCGRPAAHPNARFTSPASQCPSIDPD-WENPKGVPMSAFIFGGRRKDTVPLVYQAFNW
PCKG_COREF      --ESNQPAAHPNSRYCVAIEQCPTAAPE-FNDWKGVKVDAILFGGRRPDTVPLVTQTHDW
PCKG_CORGL      --ESDENAAHPNSRYCVAIDQSPAAAPE-FNDWEGVKIDAILFGGRRADTVPLVTQTYDW
PCKG_CORJK      --DSGNKAAHPNSRYCVPIEQCPVAAPE-FNDPKGVPVSAILFGGRRADTVPLVTQARDW
PCKG_CORDI      --ESSQPSSHPNSRYCVPLAQCPVAAEE-YNDPQGVPISAILFGGRRPDTVPLVSQAHNW
PCKG_MYCBO      --ETETNAAHPNSRYCTPMSQCPILAPE-WDDPQGVPISGILFGGRRKTTVPLVTEARDW
PCKG_MYCTA      --ETETNAAHPNSRYCTPMSQCPILAPE-WDDPQGVPISGILFGGRRKTTVPLVTEARDW
PCKG_MYCLE      --KTETPAAHSNSRYCTPMSQCPILAPE-WDDPRGVPISVILFGARRKTTVPLVTQARNW
PCKG_MYCPA      --KTETPAAHPNSRYCTPMSQCPILAPE-WDDPQGVPISGILFGARRKTTVPLVTQARDW
PCKG_MYCSM      --SGEK-AAHPNSRYCTPISQCPTLAPE-WDDPQGVPISAILFGGRRKTTVPLITEARDW
PCKG_NOCFA      --ETETLAAHPNSRYCTPMSQCPILAPE-WDDPQGVPISAILFGGRRKTTVPLVTESFDW
PCKG_STRAW      --ESGTPAAHPNARFTVPASQCPIIAPE-WEDPKGVPISAILFGGRRATAVPLVTESFDW
PCKG_STRCO      --ESGTPAAHPNARFTTPAAQCPIIAPE-WEDPRGVPISAILFGGRRATAVPLVTESFDW
PCKG_LEIXX      --ASGRPAAHPNSRFTVSAAQCPVIADE-WDVVDGVPIDAILFGGRRATNVPLVAQARDW
PCKG_CHLAB      ---GGAPAAHPNSRFTTPVQQCPVLDPQ-WNSPEGVPIEAMIFGGRRSETIPLVYEALSW
PCKG_CHLCV      ---GGAPAAHPNSRFTAPVKQCPVLDPQ-WNSPEGVPIEAIIFGGRRSETIPLVYEALSW
PCKG_CHLPN      ---GGSPAAHPNSRFTAPLRQCPSLDPE-WNSPQGVPLDAIIFGGRRSETIPLVYEALSW
PCKG_CHLMU      ---GGEPAAHPNARFTAPLDHCPSLDPQ-WDSPQGVPLEAIIFGGRRTETIPLVYESLSW
PCKG_CHLTR      ---GGEPAAHPNARFTAPLDHCPSLDPQ-WNNPQGVPLEAVIFGGRRTETIPLVYEALSW
PCKG_TREPA      ---KGEEIAHPNARFTAPARQCPAIASN-WEDPEGVPIDAFLFGGRRPSTVPLVHQARDW
PCKG_THEAC      ---DGEPIAHPNSRFTSPLSNYPFLSDR-SEDPEGVPVSAILFGGRRASLVPLVYEAFNW
PCKG_THEVO      ---GGEPIAHPNSRYTSPLTNYPYLSDL-YEDPEGVPVSAILFGGRRATLIPLVFEAFNW
PCKG_PYRAB      KEGNEIPPSHKNARFTVRLEAFPNLDKEALENPCGVEVGGMIFGGRDPDTWPPVREAFDW
PCKG_PYRHO      AEGKEIPPSHKNARFTVRLEAFPNLDREALNNPCGVEVGGMIFGGRDPDTWPPVREAFDW
PCKG_PYRFU      AEGKEIPPSHKNARFTVRLEAFPNLDREALENPCGVEVGGMIFGGRDPDTWPPVRESFNW
PCKG_THEKO      AEGNEIPPSHKNARFTVSLEHFPNVDMEALENPCGVEVGGMIFGGRDADTWPPVREAFNW
PCKG_SULAC      ------PASHPNARFTSPLTSFSNLDKD-YDNPQGVVIDGIIFGVRDYSTLVPVTEAFSW
PCKG_SACS2      ------PASHPNARFTVPLTSFSNLDKN-WDNPNGVIIDGIIFGVRDYSTLVPVVEAFSW
PCKG_SULTO      ------PASHPNARFTVPLTAFKNLDEN-YDNPDGVEIEGIIFGVRDYDTLIPVVEAFSC
                        :* *:*:               :    : :  .:*. *       : :: . 

PCKG_BORBR      VEGVYMAATMGSETTAA-AAGQQGVVRRDPFAMLPFCGYNMSDYFDHWLKLGRRL----E
PCKG_BORPA      VEGVYMAATMGSETTAA-AAGQQGVVRRDPFAMLPFCGYNMSDYFDHWLKLGRRL----E
PCKG_RALSO      TEGVYMAATMGSETTAA-AVGQQGVVRRDPFAMLPFCGYNMADYFAHWLKLGDQL----A
PCKG_BURMA      IEGVYMAATMGSETTAA-AAGQQGIVRRDPFAMLPFCGYNMSDYFSHWLALGEKL----A
PCKG_BURPS      IEGVYMAATMGSETTAA-AAGQQGIVRRDPFAMLPFCGYNMSDYFSHWLALGEKL----A
PCKG_AROAE      NFGVYMAATLGSETTAA-AFGAQGVVRRDPFAMLPFCGYHMGDYFNHWLRMGHVV----E
PCKG_ACIAD      VDGVYKAATMGSETTAA-AVGQQGIVRRDPFAMLPFAGYNMADYFDHWLQLGQQVGEKAE
PCKG_CHLLI      YYGVYMAATMGSEKTAA-AARSATCV--DPFAMLPFCGYHMGDYFNHWLHVGRTVS----
PCKG_CHLTE      YYGVYLAATMGSEKTAA-AAGKIGDVRRDPFAMLPFCGYHMGDYFNHWLHVGRTLT----
PCKG_GEOSL      SNGVYLAATLGSETTAA-AVGAVGNVRRDPFAMLPFCGYHMADYFGHWLQFGRSIP----
PCKG_COREF      EHGTMVGALLASGQTAASAEAKVGTLRHDPMAMLPFMGYNAGEYLQNWIDMGNKGGD---
PCKG_CORGL      EHGTMVGALLASGQTAASAEAKVGTLRHDPMAMLPFIGYNAGEYLQNWIDMGNKGGD---
PCKG_CORJK      NHATFIGATLASGQTAAAAEAAVGSLRHDPMAMLPFIGYNAGDYLQHWIDMGNKGGD---
PCKG_CORDI      DHATMIGALLSSGQTAA-AEGTVGALRHDPMAMLPFIGYNAADYLQHWIDMGKKGGD---
PCKG_MYCBO      QHGVFIGATLGSEQTAA-AEGKVGNVRRDPMAMLPFLGYNVGDYFQHWINLGKHADES--
PCKG_MYCTA      QHGVFIGATLGSEQTAA-AEGKVGNVRRDPMAMLPFLGYNVGDYFQHWINLGKHADES--
PCKG_MYCLE      QHGVFMGATMGSEQTAA-AEGKVGTVRRDPMAMLPFMGYHVGDYFQHWIDLGKHSDES--
PCKG_MYCPA      QHGVFMGATMGSEQTAA-AEGKVGTVRRDPMAMLPFLGYHVGDYFQHWIDLGKNSDES--
PCKG_MYCSM      QHGVFIGATLGSEQTAA-AEGKVGTVRRDPMAMLPFLGYNVGDYFAHWINVGKNADES--
PCKG_NOCFA      QHGVFMGATLSSEQTAA-AEGKVGTVRRDPMAMLPFLGYHVGDYLDHWIQLGKSADAT--
PCKG_STRAW      NHGVFLGANVASEKTAA-AEGKVGELRRDPFAMLPFCGYNMGDYMGHWVDVAKDKDQA--
PCKG_STRCO      NHGVFLGANVASEKTAA-AEGKVGELRRDPFAMLPFCGYNMGDYMGHWVDVAKDKDQS--
PCKG_LEIXX      KHGVFIGATISSEQTAA-AEGTVGELRRDPFAMLPFCGYNMADYWAHWLRMGEKLGA---
PCKG_CHLAB      QHGVTIGASMSSATTAASVGEQ-GKLRHDPFAMLPFCGYNMAHYFDHWLSFASN------
PCKG_CHLCV      QHGVTIGASMSSATTAAIVGEQ-GKLRHDPFAMLPFCGYNMAHYFDHWLSFASN------
PCKG_CHLPN      EHGVTIGAGMSSTTTAAIVGQL-GKLRHDPFAMLPFCGYNMAYYFQHWLSFAEN------
PCKG_CHLMU      EHGVMMGAGMSSTTTAAIAGEL-GKLRHDPFAMLPFCGYNMAAYFEHWLSFAG-------
PCKG_CHLTR      EHGVMMGAGMSSTTTAAIVGEL-GKLRHDPFAMLPFCGYNMAAYFEHWLSFAT-------
PCKG_TREPA      NHGVFLGSIIGSEVTAAVISDQVGQIRRDPFAMLPFCGYHMADYFSHWIKLGSQA-----
PCKG_THEAC      NHGVFMGATMGVEKTAA-SEGKVGELRRDPMAMRPFCGYNISDYFRHWIEMGRKLS----
PCKG_THEVO      NHGVFLGATMGVERTAA-SEGKVGDLRRDPMAMRPFCGYNINEYFRHWIEIGERSK----
PCKG_PYRAB      EHGVITMGASLESETTAATLGKEGVRAFNPMSILDFLSVHLGDYIRNYLEFGRKLK----
PCKG_PYRHO      EHGVITMGASLESETTAATLGKEGVRAFNPMSILDFLSVHIGDYIRNYLEFGRKLK----
PCKG_PYRFU      DHGVITMGAALESETTAATLGKEGVRAFNPMSILDFLSVHIGDYLRNYLEFGRKLK----
PCKG_THEKO      EHGVITMGASLESETTAATLGKEGVRAFNPMAILDFMSVHLGDYLRNYLEFGRKLK----
PCKG_SULAC      EHGVITIGASMESSRTSAVIGKADVLEFNPMAILDFMPLSLGKYLNNYLTFGRNLK----
PCKG_SACS2      SHGVITIGASMESARTSAVIGKSDELEFNPMAILDFMPISLSRYLRNYLNFGKRLR----
PCKG_SULTO      SHGIVTIGASMESARTSAVIGKGDEYEFNPMAILDFMPIHLGEYLGNYLEFCKKLK----
                  .    .       ::           :*:::  *       *  ::: .         

PCKG_BORBR      ETGATLPRIYCVNWFRKGPDGKFVWPGFGENMRVLRWMLGRLDGQA-GGVDQVFGISPAY
PCKG_BORPA      ETGATLPRIYCVNWFRKGPDGKFVWPGFGENMRVLRWMLGRLDGQA-GGVDQVFGISPAY
PCKG_RALSO      KSGAELPKIFCVNWFRKDEQGRFVWPGFGENMRVLKWMIDRIEGQA-RGDEHVFGVSPRY
PCKG_BURMA      AAGATLPKIYCVNWFRKDADGRFAWPGFGENMRVLKWMLDRIDGRG-EGVEHAFGVTPRY
PCKG_BURPS      AAGATLPKIYCVNWFRKDADGRFAWPGFGENMRVLKWMLDRIDGRG-EGVEHAFGVTPRY
PCKG_AROAE      DT----PKIFCVNWFRMNERGEFMWPGFGENMRVLKWIVDRVRGRV-GGKETGLGWMPKF
PCKG_ACIAD      AAGNKLPKIFNVNWFRRDAEGNFVWPGFGQNMRVLEWMIDRVEGRA-NAVETPIGYVPTY
PCKG_CHLLI      ----DPPRIFIVNWFRKTRTGKFLWPGFGDNMRVLKWMMGRVHGRS-GAVESPLGWMPRY
PCKG_CHLTE      ----DPPRIFGVNWFRKDENGKFLWPGFGENMRVLKWIIGRVHGRA-AAVESPLGWMPRY
PCKG_GEOSL      ----RPPRIFSVNWFRKDANGKFIWPGYGDNMRVLKWIVERVQGKA-GAVESPLGWMPRY
PCKG_COREF      ----KMPSIFLVNWFRRGEDGRFLWPGFGENSRVLKWVIDRIEGRV-GAEETVVGYTARA
PCKG_CORGL      ----KMPSIFLVNWFRRGEDGRFLWPGFGDNSRVLKWVIDRIEGHV-GADETVVGHTAKA
PCKG_CORJK      ----KMPEVFLVNWFRRGEDGRFLWPGFGENSRVLKWIIDRIEGRV-EADETVVGYTARY
PCKG_CORDI      ----KMPEVFLVNWFRRGDDGRFLWPGFGDNSRVLKWIVDRIEGRV-EADETIAGYTARV
PCKG_MYCBO      ----KLPKVFFVNWFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKA-GGATTPIGTVPAV
PCKG_MYCTA      ----KLPKVFFVNWFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKA-GGATTPIGTVPAV
PCKG_MYCLE      ----NLPKVFFVNWFRRGEGGKFLWPGFGENSRVLKWIVDRIEHKA-GGQDTLIGIVPTA
PCKG_MYCPA      ----KLPKVFFVNWFRRGDDGGFLWPGFGENSRVLKWIVDRIEHKA-GGQDTPIGIVPKA
PCKG_MYCSM      ----KLPKVFFVNWFRRGDDGRFLWPGFGENSRVLKWAVERIEHKA-DGKSTPIGIVPTA
PCKG_NOCFA      ----KLPKIFYVNWFRRGEDGRFLWPGFGENSRVLEWIVGRIEGSA-DAEETAIGNVPRA
PCKG_STRAW      ----KLPKIYYVNWFRKNDEGKFVWPGFGENSRVLKWIVERLEGRA-EGVETPIGILPTR
PCKG_STRCO      ----KLPKIYYVNWFRKDDAGRFVWPGFGENGRVLKWIVERLEGRA-DGVETPIGVLPTK
PCKG_LEIXX      ----DAPAIFQVNWFRKGDDGRFLWPGFSENARVIEWIARRVEGSA-GAEETAIGRLPLA
PCKG_CHLAB      -TSLKLPKIYGVNWFRKDKNGNFIWPGFSDNLRVLEWIFRRTNGEESIAKKTPIGYLPEE
PCKG_CHLCV      -TSLKLPKIYGVNWFRKDKDGNFIWPGFSDNLRVIEWIFRRTNGEESIAKKTPIGYLPEE
PCKG_CHLPN      -RSLKLPKIFGVNWFRKNNQGEFLWPGFSENLRVLEWIFQRTDGLEDIAERTPIGYLPNI
PCKG_CHLMU      -KGLQLPRIFSVNWFRKDENGQFIWPGFSENLRVLEWIFRRTDGEDSIARRTPIGYLPTE
PCKG_CHLTR      -KGLQLPRIFGVNWFRKDEHGQFIWPGFSENLRVLEWIFRRTDGEDAIAHRTPVGYLPTA
PCKG_TREPA      -RAENLPKIFCVNWFRKDAEGNFLWPGYGDNSRVLAWIFDRCDGVD-NAVETAIGWMPKE
PCKG_THEAC      ----RRPKIFYVNWFRRRQDGSFIWPGFSENFRVIEWILYRLDHND-NAIETPIGYIP--
PCKG_THEVO      ----NKPKIFYVNWFRRRADGTFIWPGFAENFRVLEWIIYRTSHND-NAVETPIGYIP--
PCKG_PYRAB      ----KKPKIFAVNYFLRENG-KWLNEKL-DKAVWLKWMELRVHGDV-EAIETPIGYIPKY
PCKG_PYRHO      ----KTPKIFAVNYFLRENG-RWLNEKL-DKAVWLKWMELRVHNDV-DAIETPIGYIPRY
PCKG_PYRFU      ----KTPKIFAVNYFLRENG-QWLNEKL-DKAVWLKWMELRVHNDV-GAIETPIGYIPRY
PCKG_THEKO      ----KTPKIFAVNYFLRENG-VWLNHKL-DKAVWLKWMELRVHGDV-EAIETPIGYIPKY
PCKG_SULAC      ----YVPKIFSFNYFLKDENNKFLNSKE-DKRVWVKWAVKRVESET-DAIYTPVGFIPYY
PCKG_SACS2      ----KSPKIFGFNYFLKDDN-KFLNSKE-DKKVWVSWAVKRVEETA-NAIYTPIGLIPFY
PCKG_SULTO      ----KVPRIFGFNYFLKEGN-RFLNSKE-DKRVWIKWAVKRVEGSV-DVIYTPIGLVPYY
                      * :: .*:*       :      ::   : *   *             *  .  

PCKG_BORBR      GDIDWTGLE-FSPDKFEQVISVDLPAWRAELALHDE-LFTQLAAR---LPEDLPLTRTAI
PCKG_BORPA      GDIDWTGLE-FSPDKFEQVISVDLPAWRAELALHDE-LFTQLAAR---LPEDLPLTRTAI
PCKG_RALSO      EELRWDGLD-FSAEQFAKVISLDAQAWQQELTLHAE-LFAQLAHH---LPQALPEAKARL
PCKG_BURMA      EDLHWAGLA-FSPAQYAQVTSMNPDEWRAELALHAE-LFDKLSAR---LPDALAETKARI
PCKG_BURPS      EDLHWAGLA-FSPAQYAQVTSMNPDEWRAELALHAE-LFDKLSAR---LPDALAETKARI
PCKG_AROAE      EDIDWTGAD-VTREQFEALTSVDADAWKKELALHKE-WFDKLQDR---LPRELVLKRELF
PCKG_ACIAD      EDLNWTGTD-FSKEEFDLITSQSKDQWITEIESHTE-LFNKLGER---LPKALKERQDQL
PCKG_CHLLI      ESLDWRGLDGFTSNKFSKLMSVDREG-KQELFSHEE-LLEKLYDR---LPKEFTHIRELL
PCKG_CHLTE      ESLDWRGLDGFTRDKFSTLMSVDREAWKQELFSHEE-LLEKLYDR---LPKEFTHIRELM
PCKG_GEOSL      EDMDWDGLD-MPREKFNELTSVDRDVWQNELISHEE-LFVKLFDR---LPKEFLHMRELI
PCKG_COREF      EDLDLEGLD-TPIEDIREALTAPAEQWAADLEDNAE-YLTFLGPK---VPTEVHEQFEAL
PCKG_CORGL      EDLDLDGLD-TPIEDVKEALTAPAEQWANDVEDNAE-YLTFLGPR---VPAEVHSQFDAL
PCKG_CORJK      EDIYTDGLK-ETEEDIREALSVNPADWERDLADNEE-WLKFLGPK---VPSEVWDEFQGL
PCKG_CORDI      EDLDLTGLD-TPIEDIREALSAPAAQWKSDLADNEE-YLTFLGSKGSAVPAEVLEQFEAL
PCKG_MYCBO      EDLDLDGLD-VDAADVAAALAVDADEWRQELPLIEE-WLQFVGEK---LPTGVKDEFDAL
PCKG_MYCTA      EDLDLDGLD-VDAADVAAALAVDADEWRQELPLIEE-WLQFVGEK---LPTGVKDEFDAL
PCKG_MYCLE      TDLDLDGLD-ISSDDVAKALAVDPAEWRNELPLIEE-WFEFVGDK---LPSGMQDEFEAL
PCKG_MYCPA      EDLDLDGLD-VSVDDVAKALAVNPDEWREELPQIEE-WFEFVGEK---LPTGVRDEFEAL
PCKG_MYCSM      ADLDLEGLD-VDPADVDEALAVKPEEWRAELPLIEE-WFEFVGEK---LPTGLKDEFDAL
PCKG_NOCFA      AHLDLDGLD-VDPADVDEALAVKAEEWRKEIPLIEE-WFEFVGDK---LPSGVRDEFEAL
PCKG_STRAW      EALDTAGLD-LSASDLDFLLTVDKEVWREEAALVPE-HLNTFGEH---TPKELWDEYRAL
PCKG_STRCO      ESLDTDGLD-LADADLEFLLSVDKEVWREEAALVPE-HLNTFGDH---TPAELWDQYRAL
PCKG_LEIXX      DELDLDGLG-LPAEDLAALFDIDTERWLAECALTEQ-YFARFGPR---VPPALTAELASL
PCKG_CHLAB      SALNLEGLN-LSTQALQDLLSVDVPGWLKEVANVRE-YCKIFGSD---LPQAITDELFRI
PCKG_CHLCV      SSLNLEGLN-LSSQALQDLLSVDVSGWLKEVANVRE-YCKIFGSD---LPQTITDELFRI
PCKG_CHLPN      QKFNLNGLN-LDLQTVQELFSVDAEGWLAEVENIGE-YLKIFGSD---CPQQITDELLRI
PCKG_CHLMU      EGLNTTGLN-LSRDALQSLLAVDTQGWRAEVNNIRE-YCSIFGSD---MPRQILEELSRI
PCKG_CHLTR      EGLNTSGLD-LSEDALRALLTVDAQGWKAEVSNIRK-YCSIFGAD---MPQRILEELSRI
PCKG_TREPA      GALNTEGLN-VSTQAVKELLSVDIAGWKKEIKDIRENHYPKFGAR---LPQQLRDALEVL
PCKG_THEAC      ENINTDGLN-LTKQDMEELFRIDRDGWREEMKSIGD-YFSQIGNI----PEDLLIEFEME
PCKG_THEVO      ESLNLAGLN-ISEEDVKELFRIDKEGWKEEMNEIQK-YFSELGNV----PEEILKEFELE
PCKG_PYRAB      EDLRELFKQVLNKEYKKEDYEKQFKIRVPELLAKID-RIWNIYEPIGNIPEELFKQLEEE
PCKG_PYRHO      EDLKVLFKQVLNKDYSREDYEKQFKIRVPELLAKIE-RIWKIYEPIDNIPEELFKQLKDE
PCKG_PYRFU      EDLKVLFRQVLNKDYSREDYEKQFKIRVPELLAKID-RIWKIYEPIDNIPEELFQELEKE
PCKG_THEKO      KDLAKLFKDVLNKEYTKEDYERQFKIRVPELLAKID-RIEEIYRKLDNVPEELFKVLEEE
PCKG_SULAC      EDLSKLFNSTLGKQYTKEAYELQFTLKLSKYLEKTE-RIMKIYSEIADTPIEVINELKAQ
PCKG_SACS2      EDLKALFKRVLGKEYGKEEYEKQFTIKLRKYLEKTE-RIIEIYLKFEDIPSEVINELKMQ
PCKG_SULTO      EDLKTLFREMLNKEYTIEDYEKQFTLKLDKYLEKNE-RILKLYKEIL-APKEVIAELEQQ
                  :                          .     .     .       *  .       

PCKG_BORBR      ERRMAA------------------
PCKG_BORPA      ERRMAA------------------
PCKG_RALSO      EARLQG------------------
PCKG_BURMA      EKRLGG------------------
PCKG_BURPS      EKRLGG------------------
PCKG_AROAE      ELTLAV------------------
PCKG_ACIAD      LQAVQKI-----------------
PCKG_CHLLI      LSTLWMSPEHWELAPELYSAES--
PCKG_CHLTE      LSTLWRSPEHWELAPERYTAEH--
PCKG_GEOSL      LSSLWRSPEHWEQIGDVHPEGWNE
PCKG_COREF      KKRIQAAQAS--------------
PCKG_CORGL      KARISAAHA---------------
PCKG_CORJK      KDRVEAAK----------------
PCKG_CORDI      KARVAAAES---------------
PCKG_MYCBO      KERLG-------------------
PCKG_MYCTA      KERLG-------------------
PCKG_MYCLE      KQRLAKED----------------
PCKG_MYCPA      KQRLSEAG----------------
PCKG_MYCSM      KERLG-------------------
PCKG_NOCFA      KQRLG-------------------
PCKG_STRAW      VQRLG-------------------
PCKG_STRCO      VRRLG-------------------
PCKG_LEIXX      RDKLRA------------------
PCKG_CHLAB      ENELKIIK----------------
PCKG_CHLCV      ERELK-------------------
PCKG_CHLPN      KSELKEK-----------------
PCKG_CHLMU      ENELK-------------------
PCKG_CHLTR      ESELK-------------------
PCKG_TREPA      EARINGSEGAACTRDMC-------
PCKG_THEAC      KRRIS-------------------
PCKG_THEVO      KKRLGY------------------
PCKG_PYRAB      RERLLKAREKYGDYISPFSLL---
PCKG_PYRHO      RERLLKAKAEFGDYISPFTLEKRI
PCKG_PYRFU      RKRILEAREKYGDYISPFALEK--
PCKG_THEKO      RQRLLEAREKYGDYISPFALEGE-
PCKG_SULAC      KDRLLDYINRYGDKVSPFQLVKS-
PCKG_SACS2      KERIVDYINKYGDSVSPFRLEKD-
PCKG_SULTO      KERILKYIDKYGKRISPLDLR---
                   :