CLUSTAL format seed alignment for MF_00456

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

F6GCT5_LACS5      -----------MDDSIKDDSIKRVVVKVGTNVLTNKDNR-------ILGPVLRELVRQIS
G2PIL8_MURRD      -----------MYKEL-------VVIKVGTNVMTNKDNR-------IVRPVLNNLVQQIA
D3HMF9_LEGLN      ---------------------MKIVIKVGTQSILSSDGT-------PFEPIMLHLVEQVV
PROB_LEPIN        ------MKPERNSLSEKIRNAEKIVIKVGSARLSGLPSE--------VNDFLFQLVSDIR
PROB_CAMJE        --------------------MKRIVVKVGSHVISEENTL--------SFERLKNLVAFLA
PROB_THEMA        -------------------MIMKVVVKVGSNLLVGSSG--------LRKSYIAELCREVA
PROB_AQUAE        ---------------------MRIVFKIGSNLLETDEGD-------IDLSFLSKLAEGIK
PROB_NOSS1        ----------MNFELERSDLTKTIVVKIGTSSLTQPETG------QLALSTIATLAETLS
PROB_SYNY3        ----------MTMAMQ----PQTLVIKIGTSSLARPETG------QLALSTIAALVETVC
PROB_YERPE        -----------------MSGSQTLVVKLGTSVLTG-GSR------RLNRAHIVELVRQCA
PROB_SERMA        -----------------MNGSQTLVVKLGTSVLTG-GSL------RLNRAHIVELVRQCA
PROB_SALTY        -----------------MSDSQTLVVKLGTSVLTG-GSR------RLNRAHIVELVRQCA
PROB_ECOLI        -----------------MSDSQTLVVKLGTSVLTG-GSR------RLNRAHIVELVRQCA
PROB_PASMU        -----------------MKIDKTLVVKFGTSTLTQ-GSA------KLNLPHMMDIVRQLA
PROB_HAEIN        ------------------MNKKTIVVKFGTSTLTQ-GSP------KLNSPHMMEIVRQIA
PROB_VIBCH        ----------MTTNQRSIKAPQTVVVKLGTSVLTG-GTL------ALDRAHMVELARQCA
PROB_DEIRA        ---------------------MRVVLKLGTSVLTA-GTD------RLHRPRLVDLMRDIA
PROB_RALSO        -----------MALRSLIADARRLVVKVGSSLVTD-DGR------GLDQAAIARWAAQIA
PROB_PSEAE        -------------MRDKVTGARRWVVKIGSALLTA-DGR------GLDRNAMAVWVEQMV
PROB_XYLFA        ---MTGTPPPSRFPEQPIPPWRRAVLKVGSSLLAA-AGG------GLSPRFALDLAHFVS
PROB_THET2        --------------MRPGLSAKRLVVKVGSAVLT--GER------GLDLEAMAEIARQVA
PROB_MEIRU        ---------MHGRLPLTAQTHRRLVVKVGSAVLS--GPQ------GR--QHQLAIAAQVA
PROB_MYCTU        MRSPHRD---------AIRTARGLVVKVGTTALTTPSG------M-FDAGRLAGLAEAVE
PROB_MYCLE        -MSVHRD---------AIRAARSLVVKVGTNALTTSSG------V-FDSSRLARLVDAIE
PROB_CORGL        ----MRE---------RISNAKRVVVKIGSSSLTNDEDGH----T-VDPNRINTIVNALQ
PROB_STRCO        -MAGARQ---------AVGEARRIVVKVGSSSLTTAAG------G-LDADRVDALVDVLA
PROB_AGRFC        -MSLTRK---------PLASHHRIVIKIGSALLVDRKSG-------LKKDWLDAICEDIA
PROB1_RHIME       -MTKARK---------ALENYRRVVIKIGSALLVDRRTG-------LKKSWLDALCADIA
PROB1_RHILO       -----MQ---------SLKKYRRITVKIGSALLVDRASG-------LKRDWLDSLADDIA
PROB_BRUME        ----MLK---------KLKDYRRIVVKIGSALLVDRATG-------LKREWLESLGQDIA
PROB_CAUVC        MTSGSQG---------AFEAARRIVFKVGSALLVDAETG------AANRAWLEAFCADAA
PROB2_RHIME       -MEDKF----------DLSSARLVVVKIGSTLVLDRETS------GIRSSWLESLTEDVS
PROB2_RHILO       -MQEKIRETCLATKTVKLLSARRLIVKIGSAVVADAETG------EIRGPWLETLIKDVV
PROB_CALS4        ---------------------MRIVVKVGTSTLTHE-------NGKLNLEIMEKLVRQIA
PROB_CLOAB        ----------MNTREKYLSNVNRLVIKVGSSTLTHP-------SGLLNFYKIEHIVRQIA
PROB_STRTR        -------------MKRNFDSVKRLVIKIGTSSLVLP-------SGKINLEKIDQLAFVIS
PROB_STRP1        ------------MMKRQFEDVTRIVIKIGTSSLVLP-------TGKINLEKIDQLAFVIS
PROB_LACLA        ----------MIMTRKNILSVKRIVVKIGTSSLILP-------NGKINLSNIDELAFVLS
PROB_LISMO        -------------MRESLKNSKRLVIKVGTSTLMYG-------NGHINLRTIEKLAMVLS
PROB_LISIN        -------------MRESLKNSKRLVIKVGTSTLMYG-------NGHINLRTIEKLAMVLS
PROB_CLOPE        -------------MRKALKDSKRIVVKVGTSTLTYE-------NGSVNLMRIEKLSRVIS
PROB_METAC        ----------MTDREQFFRDVNKIVIKIGTSSITRKGCDHTKENCNIDPAFMESIAAQVY
PROB_TREPA        ------------MIRALFAAAKKIVIKIGSNTLAQA-------DGTPDEEFLAECARACA
PROB_NEIMB        ------------------MKYKRIVFKVGTSSITHSDGS-------LSRGKIQTITCQLA
PROB_NEIMA        ------------------MKYKRIVFKVGTSSITHSDGS-------LSRGKIQTITRQLA
PROB_STRPN        ------------------MKYKRIVFKVGTSSLTNEDGS-------LSRSKVKDITQQLA
Q1IS81_KORVE      ---------------------MRFVIKVGTSLIAP-GGR-------IDTVLMRALVDQLD
PROB_BACSU        ------------------MKKQRIVVKIGSSSLTNSKGS-------IDEAKIREHVQAIS
PROB_BACHD        ------------------MKRQRIVIKIGSSSLTTKQGA-------LDLEKLEGYVRAIV
PROJ_BACSU        --------------MTPDTSMKRVVVKIGSSSLTSLHGE-------ISIRKLEALVDQVV
A5FEC3_FLAJ1      ------------------MGKKRILLKIGSNTLTKETNH-------ISRGKIEDLGIQIA
F0S938_PSESL      ------------------MKKPIIVIKFGSASITTAEGE--------LDEKVVKDIAKQV
                                           .*.*:  :                           

F6GCT5_LACS5      VLDERNIQVVLVTSGSAIAGKEVLGNIQETEAS--------------VRR---QIYSSVG
G2PIL8_MURRD      ELYERDIMTILVSSGSVIAGKEVLGKAKIKDKT--------------QRR---QVYSAIG
D3HMF9_LEGLN      TLQKAGHQVILVSSGAVASGRKVARQFFDRQYG--------------SSIGEKQVLASLG
PROB_LEPIN        HLRDLGKKVILVSSGAIARGRLLLSELPSTISSG-------------DSLAEKQALAAMG
PROB_CAMJE        KLME-KYEVILVTSAAISAGHTKLDIDR-------------------KNLINKQVLAAIG
PROB_THEMA        RLKSQGHEISIITSGARAAGFTYLGKGKRTQ-----------------DLHIKQALCAVG
PROB_AQUAE        KLHSFGDKVLIVSSGAVLSGAKKLGIKEKPK-----------------DLTLKQALASVG
PROB_NOSS1        HLRQQGNRVILVSSGAVGVGCARLGLTERPK-----------------AIALKQAVAAVG
PROB_SYNY3        KLIGQGHRVVLVSSGAIGVGCSRLGLTERPK-----------------KMALKQAIAAVG
PROB_YERPE        QQHAKGHRIVIVTSGAIAAGREHLGYPELPA-----------------TIASKQLLAAVG
PROB_SERMA        QQHAAGHRIVIVTSGAIAAGREHLGYPELPA-----------------TIASKQLLAAVG
PROB_SALTY        QLHAAGHRIVIVTSGAIAAGREHLGYPELPA-----------------TIASKQLLAAVG
PROB_ECOLI        QLHAAGHRIVIVTSGAIAAGREHLGYPELPA-----------------TIASKQLLAAVG
PROB_PASMU        QLHQAGFRLVIVTSGAIAAGRHYLNHPQLPP-----------------TIASKQLLAAVG
PROB_HAEIN        QLHNDGFRIVIVTSGAIAAGRHYLNHPQLPP-----------------TIASKQLLAAVG
PROB_VIBCH        ELKKQGHSVVIVTSGAIAAGREHLGYPALPN-----------------AISSKQLLAAVG
PROB_DEIRA        AVSAQGHEVVLVSSGAVTAGWEALGFPPRER-----------------TLAEKQLLAAVG
PROB_RALSO        ALRAAGKEVVLVSSGAIAEGMQRLGWTRRPK-----------------EIHELQAAAAVG
PROB_PSEAE        ALHCAGIELVLVSSGAVAAGMSRLGWVSRPS-----------------AMHELQAAASVG
PROB_XYLFA        ANITAGRQLVIVSSGAVAAGRALIPPLPESGG----------------ALAARQALAALG
PROB_THET2        ALREEGREVVLVSSGAVAAGMRRLGLKERPK-----------------DMPKKQALAALG
PROB_MEIRU        ALRAEGREVVLVSSGAQATGMQKLGLTEKPK-----------------SMPGKQALAAVG
PROB_MYCTU        RRMKAGSDVVIVSSGAIAAGIEPLGLSRRPK-----------------DLATKQAAASVG
PROB_MYCLE        ARMKAGTDVVIVSSGAIAAGIEPLGLSLRPK-----------------DLATKQAAASVG
PROB_CORGL        ARMEAGSDLIVVSSGAVAAGMAPLGLSTRPT-----------------ELAVKQAAAAVG
PROB_STRCO        KMRGADKEVVLVSSGAIAAGLAPLGLPRRPR-----------------DLARQQAAASVG
PROB_AGRFC        ALKKNGADVQVVSSGAIALGRTVLGLPSGAL-----------------KLEESQAAAAVG
PROB1_RHIME       ALRAKGVEVLVVSSGAIALGRTVLDLPAGAL-----------------KLEESQAAAAVG
PROB1_RHILO       VLAQGGAEILVVSSGAIALGRTILGLGKRAL-----------------KLEESQAAAAVG
PROB_BRUME        ALQHAGVEVLVVSSGAIALGRTVLGLPKKAL-----------------KLEESQAAAAAG
PROB_CAUVC        DLRAAGKQVLVVSSGAVALGRRRLGLTGRKT-----------------TLPEKQAAAAAG
PROB2_RHIME       RLLTRGQQVVLVSSGAVAIGSTIVDRLATYS-----------------QVSHKQAAAALG
PROB2_RHILO       RFFARGQQVIIVTSGAVAAGSRHFKQLDRSL-----------------RIEEKQAAAAIG
PROB_CALS4        NLSNKGEEVILVTSGAIGAGMGKLNLTEKP-----------------KNLPQKQALAAIG
PROB_CLOAB        DLHNQGIKVILVSSGAIGAGIGKLRLKERP-----------------KTIPEKQAAAAVG
PROB_STRTR        SLHNKGIEVVLVSSGAMGFGLNVLDLEKRP-----------------AEVGKQQAVSSVG
PROB_STRP1        SLMNKGKEVILVSSGAMGFGLDILKMEKRP-----------------TNLAKQQAVSSVG
PROB_LACLA        DLNNKGYEVILVTSGAIGVGLNVLGIDKRP-----------------KGIADQQALASIG
PROB_LISMO        DLRNEGKEVILVSSGAIGVGCHKLQLPVRP-----------------TSIPEQQAVASVG
PROB_LISIN        DLRNEGKEVILVSSGAIGVGCHKLQLPVRP-----------------TSIPEQQAVASVG
PROB_CLOPE        DICNMGKEVVLVSSGAIGVGVGKLRLEKKP-----------------ETIREKQAVAAVG
PROB_METAC        ELRKHGKEVILVSSGAIGVGLNELGIAPKP-----------------REIPIRQAAAAVG
PROB_TREPA        ALMRDGKQIVVVSSGAQVAGISALHCLSSPPQGAGLERHESRGVIPGDGASCKQALCAVG
PROB_NEIMB        ALHHAGHELVLVSSGAVAAGFGALGFKKRPV-----------------KIADKQASAAVG
PROB_NEIMA        ALHHAGHELVLVSSGAVAAGFGALGFKKRPV-----------------KIADKQASAAVG
PROB_STRPN        MLHEAGHELILVSSGAIAAGFGALGFKKRPT-----------------KIADKQASAAVG
Q1IS81_KORVE      L---ERHEYLIVSSGAIASGMSKLAFSAKPK-----------------SVRLMQACAAVG
PROB_BACSU        VLKKAGHEMILITSGAVAAGFSSLGYPSRPV-----------------TIKGKQAAAAVG
PROB_BACHD        NLRKAGHEVILISSGAVAAGFSRLGYPVRPT-----------------TMAGKQAAAAVG
PROJ_BACSU        KLKDAGYEVILVSSGAVAAGYRKLGFIQRPE-----------------KLPEKQASASIG
A5FEC3_FLAJ1      AL-NDEYEFIIVSSGAIAAAKQFVKLDNQDK-----------------DVFVKQALASIG
F0S938_PSESL      AVLHQKYNIVLVSSGAVAAGKKFIPKYAGTL-------------------IERKAAAAIG
                            :::*.:   .                                 :  .: *

F6GCT5_LACS5      QPRLMRHYYSLFHDYGMRCAQILATKRDFDPGK--HRENMISCYEGLLA-EGVTPIANED
G2PIL8_MURRD      QPRMMRHYYNIFNDYGMKCAQVLPTKRDFNPGV--HRDNMINCLEGLLS-EGVIPIANED
D3HMF9_LEGLN      QYELMHIYASMFKKYNMLASQLLLTKQDFQTRQ--HYLNISRLLREILEHKNIVPIINEN
PROB_LEPIN        QNRLVNLYDSFFSKVNLSIAQILFGVLDLESKE--GYKNLKNTFTQLVE-WGILPVVNEN
PROB_CAMJE        QPFLISVYNELLAKFNKLGGQILLTGKDFDSRK--ATKHAKNAIDMMIN-LGILPIINEN
PROB_THEMA        QVQLMKVYENAFDFYGIKIAQILLTRDTFSNRK--RYLNLRNTLIGLSE-FDVVPIVNEN
PROB_AQUAE        QSYLMHLYDTIFSNYGLKVGQVLLTKDVFSKEKEERFKNAKSTLEKLLE-LGVVPVINEN
PROB_NOSS1        QGRLMRVYDDLFTTLQQPIAQVLLTRSDLVQRS--RYLNVYNTFRELLA-LGVIPVVNEN
PROB_SYNY3        QGRLMRTYDDLFSSLRQPIAQILLTRRELIERT--AYVNAYNTFQALFE-LGVIAIVNEN
PROB_YERPE        QSRLIQLWEQLFSIYGIHIGQMLLTRADLEDRE--RFLNARDTMNALLD-NRIVPVINEN
PROB_SERMA        QSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRE--RFLNARDTMTALLD-NRIVPVINEN
PROB_SALTY        QSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRE--RFLNARDTLRALLD-NHIVPVINEN
PROB_ECOLI        QSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRE--RFLNARDTLRALLD-NNIVPVINEN
PROB_PASMU        QSQLIQTWEKLFAIYDIHIGQILLTRADIEDRE--RFLNARDTLRALLD-NQIIPVINEN
PROB_HAEIN        QSQLIQAWEKLFAIYDIHIGQLLLTRADIEDRE--RFLNARDTLYALLD-NHIIPVINEN
PROB_VIBCH        QSRLIQVWESLFAIYGIKIGQMLLTRADLDDRE--RFLNARDTINALVE-NGIVPVVNEN
PROB_DEIRA        QVQLMHLYTSLAELYGLRSAQLLLTADDFRERT--RYLNARTTLEGCLS-RGVLPVINEN
PROB_RALSO        QMGLAQVYESEFARHGIRTAQVLLTHGDLADRE--RYLNARSTLLTLLG-LGVVPIINEN
PROB_PSEAE        QMGLVQAWESSFALHGLQTAQVLLTHDDLSDRK--RYLNARSTLRTLVE-LGVVPVINEN
PROB_XYLFA        QAQLIALWQRFFDR---PVAQVLLTHDDLRNRR--RYLNARATLRELLH-LGTLPVVNEN
PROB_THET2        QPLLMAFWQEAFAPFGLPVAQVLLTAEDLSSRS--RYLNAKATLRALLD-LGAIPVINEN
PROB_MEIRU        QPTLMLLWEQAFSWYDLKVAQVLLTAEDLAHRH--RYLNARQTLETLLE-WGIVPIINEN
PROB_MYCTU        QVALVNSWSAAFARYGRTVGQVLLTAHDISMRV--QHTNAQRTLDRLRA-LHAVAIVNEN
PROB_MYCLE        QVALVNSWSAAFARYGRAVGQVLLTAQDISMRV--QHTNAQRTLDRLRA-LHAVAIVNEN
PROB_CORGL        QVHLMHQWGRSFARYGRPIGQVLLTAADAGKRD--RARNAQRTIDKLRI-LGAVPIVNEN
PROB_STRCO        QGLLVARYTASFARYGVRVGQVLLTSDDMSRRA--HHRNASRTLDKLLA-MGAFPIVNEN
PROB_AGRFC        QIALARAWSESLSRHEIVAGQILLTLSDTEERR--RYLNARATINQLLK-IGAIPIINEN
PROB1_RHIME       QIVLARAWSESLSTHAIVAGQILLTLGDTEERR--RYLNARATIGQLLK-LGSVPIINEN
PROB1_RHILO       QIALAGAWSDALGRGALKSGQILLTLGDTEERR--RYLNARATISTLLK-MKAVPVINEN
PROB_BRUME        QIALAKAYADVLGGHGIKSGQILVTLSDTEERR--RYLNARATIETLLK-LKAVPIINEN
PROB_CAUVC        QSLLMRAWEEAFEPHGIGVAQILLTRDDTEMRR--RWLNARATTETLMG-LGVVPVVNEN
PROB2_RHIME       QVQLTHAYSESLKRHGLQVAQLLMGRGDLVDPA--HRLNTRAVLLRLID-LGAVPLVNEN
PROB2_RHILO       QIRLMIAYEQSLKRHGFGLGQVLLTSADVDNQR--CRLNARSAFQQLLN-VGAVPVINEN
PROB_CALS4        QGLLIEIYEKFFNEYGKITAQLLLTREDFSDRK--RYLNMSYTLSNLLK-WGVIPVINEN
PROB_CLOAB        QGVLMHTYEKLFAEYGQIVGQILITREDLSSKK--RVVNVQNTFSALLD-HGIIPIVNEN
PROB_STRTR        QVAMMSLYSQVFSHYQTKVSQLLLTRDVVEYSE--SLANAINAFESLFE-LGVVPIVNEN
PROB_STRP1        QVAMMSLYSQIFAYYQTNVSQILLTRDVVVFPE--SLANVTNAFESLIS-LGIVPIVNEN
PROB_LACLA        QVELMSLYTQMFRRYSQKVSQLLLTRDVTDFPT--SRENAENALNALLG-LGIIPIINEN
PROB_LISMO        QSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPI--SRENVMNTLESLLE-RGIIPIVNEN
PROB_LISIN        QSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPI--SRENVMNTLESLLE-RGIIPIVNEN
PROB_CLOPE        QCALMHIYNKFFGEYSHVVAQVLLTRDVLENER--MKNNVCNTFDTLLE-KGIIPIVNEN
PROB_METAC        QSILMQDWSRAFSKYGMKVAQILLTYEFYSDRV--TYLNLRNSISTLLE-YEVVPIINEN
PROB_TREPA        QAELISRWRSAFAAHQQCVGQFLCTKEDFTDSD--RAAQVRYTLSFLLE-RRVVPILNEN
PROB_NEIMB        QGLLMEEYTANLSSDGIVSAQILLSRADFADKR--RYQNAGGALSVLLQ-RRAVPIINEN
PROB_NEIMA        QGLLMEEYTANLSSDGIVSAQILLSRADFADKR--RYQNAGGALSVLLQ-RRAVPIINEN
PROB_STRPN        QGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKR--RYKNAHQALSVLLN-RGAIPIINEN
Q1IS81_KORVE      QSLLMYTY-EQLFFGKKVVAQLLLSSDDFTSAL--RYENLQHALHELLK-LGVVPIVNEN
PROB_BACSU        QTLLMQQYMNQFKQYSLTPGQILLTRNDFSKRE--RYRNAYATIMELLE-RGVIPIINEN
PROB_BACHD        QALLMQHYMERFHQHGIIAAQLLLTRKDFQNQT--QYTNAYSALMELLK-RGALPIINEN
PROJ_BACSU        QGLLMEAYSKLFLAHGYVASQILITRSDFSDEY--RYNNVRNTMNVLLE-RGIIPIINEN
A5FEC3_FLAJ1      QPHLMRIYNENFKDLGLNTSQCLLSYSDFEKEQ--TKKNIVNTINVLVK-NNYIPIINEN
F0S938_PSESL      NPLLLQTYSRYFEPYNLAIAQSLCERHHFSNRS--QFLQLKKTYEELWK-NNIIPVANEN
                  :  :   :           .* *               :               .: **:

F6GCT5_LACS5      DAVSLSMS---------------MFSDNDELASLVAELIDADRLIILSDTDGLYTGHPED
G2PIL8_MURRD      DAVSVSMS---------------MFSDNDELATLLAQLMRADKLILMTDIDGLYDGHPEK
D3HMF9_LEGLN      DSVAIAEL---------------MFTDNDELSGLIAAMINADKLIILSNVEGVYTKHPNE
PROB_LEPIN        DSVATEEV---------------KFGDNDMLSALVSLIVEADLLIILTGVDGFLK-----
PROB_CAMJE        DATAIEEI---------------VFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSE
PROB_THEMA        DTVATEEI---------------TLGDNDTLAAMFSIAWDADFLVLFTTVDGVIDENG--
PROB_AQUAE        DAVAVEEL---------------VFGDNDFLAVYVSFMVNADLLVIFSSAGGLKDDKDRI
PROB_NOSS1        DTVAVDEL---------------KFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRS
PROB_SYNY3        DTVAIDEL---------------KFGDNDTLSALVASLVEADWLFLLTDVDRLYSSDPRL
PROB_YERPE        DAVATAEI---------------KVGDNDNLSALAAILASADKLLLLTDQAGLYTADPRN
PROB_SERMA        DAVATAEI---------------KVGDNDNLSALAAILAGADKLLLLTDQQGLYTADPRN
PROB_SALTY        DAVATAEI---------------KVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPRS
PROB_ECOLI        DAVATAEI---------------KVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRS
PROB_PASMU        DAVATSEI---------------KVGDNDNLSALVAILVQAEQLYLLTDQQGLFDRDPRK
PROB_HAEIN        DAVATAEI---------------KVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDPRK
PROB_VIBCH        DAVATNEI---------------KVGDNDNLSALVGILCGADKLLLLTDQKGLFTADPRK
PROB_DEIRA        DTVAVEQI---------------KVGDNDTLSAFVANLVEADLLLILTDAPGLYTADPRT
PROB_RALSO        DTVVTDEI---------------KFGDNDTLGALVTNLIEGDALIILTDQRGLYTADPRK
PROB_PSEAE        DTVVTDEI---------------RFGDNDTLAALVANLVEADLLVILTDRDGMFDADPRN
PROB_XYLFA        DTVSVDEL---------------KLGDNDNLAAIVAALIDAQALFIATDIDGLYTTDPRH
PROB_THET2        DTVAFEEI---------------RFGDNDQLSARVAALVEAGLLALLSDVDALYEEDPKK
PROB_MEIRU        DTVMVEEI---------------KFGDNDQLSALIASLVGADLLILLSDIEALYEADPRT
PROB_MYCTU        DTVATNEI---------------RFGDNDRLSALVAHLVGADALVLLSDIDGLYDCDPRK
PROB_MYCLE        DTVATNEI---------------RFGDNDRLSAVVAHLVGAEALVLLSDINGLYDSDPRK
PROB_CORGL        DTVATTGV---------------NFGDNDRLAAIVAHLVSADALVLLSDVDGLFDKNP-T
PROB_STRCO        DTVATDEI---------------RFGDNDRLAALVAHLVRADLLVLLSDVDGVYDGDP-S
PROB_AGRFC        DTVATTEI---------------RYGDNDRLAARVATMTGADLLVLLSDIDGLYTAPPHL
PROB1_RHIME       DTVATTEI---------------RYGDNDRLAARVATMVGADLLVLLSDIDGLYTAPPHL
PROB1_RHILO       DTVATSEI---------------RYGDNDRLAARVATMMGADLLVLLSDIDGLYTAPPAR
PROB_BRUME        DTVATTEI---------------RYGDNDRLAARVATMMGADLLILLSDIDGLYTAPPHK
PROB_CAUVC        DTVVTEEI---------------RYGDNDRLAARVAQMAGADLLVLLSDIDGLYTADPRK
PROB2_RHIME       DTTATCGT---------------RVGDNDRLAAWIAEIINADLLILLSNVDGLFMKDPRN
PROB2_RHILO       DATATPEV---------------CLGDNDRLAARVAQIAKADLLILLSDVDGLFTEDPHD
PROB_CALS4        DTVAVEEI---------------KIGDNDTLAALVASLVEADLLIILTDIDGLFDKDPRI
PROB_CLOAB        DATVVEEI---------------KFGDNDTLSARVASLIKADLLILLSDIDGLYDSNPAV
PROB_STRTR        DAVSVDEMDHA-----------TKFGDNDRLSAIVAKVVGADLLIMLSDIDGLFDKNPNV
PROB_STRP1        DAVSVDEMDHA-----------TKFGDNDRLSAVVAGITKADLLIMLSDIDGLFDKNPTI
PROB_LACLA        DAIAVDEMDHQ-----------TKFGDNDKLGAIVSKLVNADLLIMLSDIDGLFDKNPSI
PROB_LISMO        DTVAVEELEHV-----------TKYGDNDLLSAIVAKLVQADLLIMLSDIDGFYGSNPST
PROB_LISIN        DTVAVEELEHV-----------TKYGDNDLLSAIVAKLVQADLLIMLSDIDGFYGSNPST
PROB_CLOPE        DAISIDEIQNI-----------LNFGDNDNLSAIVSTLVNADTLIILSDIDGFYDSDPRT
PROB_METAC        DCTCTNEIE-------------AIFGDNDKLSAMVASKIDADLLIILSDIDGLFDRNPKT
PROB_TREPA        DALCCSDVPSVPADRRVSLSPQKRIGDNDSLSAFVALLWQADLLLLLSDIDGVYDKDPKA
PROB_NEIMB        DTVSVEEL---------------KIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
PROB_NEIMA        DTVSVEEL---------------KIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
PROB_STRPN        DSVVIDEL---------------KVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNS
Q1IS81_KORVE      DSVSVRELV-------------GAFGDNDELSALLATAVKADWLVLLTNVDGFYD----S
PROB_BACSU        DSTSVEEL---------------TFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
PROB_BACHD        DSTSIAEL---------------TFGDNDMLSALVSGLIHAHTLCILTDVNGLYDANPKT
PROJ_BACSU        DTVTVNRL---------------KFGDNDTLAAKVAGLIDADMLVILSDIDGLYDGNPRT
A5FEC3_FLAJ1      DTVATDEI---------------RFGDNDKLAALTAVLLNVDILIIATNTNGIYTKNSIH
F0S938_PSESL      DVVSNMEL---------------KFSDNDELATLIAVGFGAEQLLFSTSVPGVLDEKGKV
                  *                         *** *.           * : :    .       

F6GCT5_LACS5      KNSRKLTEVTVDQ--NVEKYVQSNSKKEGEGRGGMASKLKIAKVTAKKNIPTYIASGKRE
G2PIL8_MURRD      ADSKVIDKVEPKE--DLDKYIEEGNKQEGEGRGGMGSKLSYAQKAAADNIPSYIVNGKRD
D3HMF9_LEGLN      ADSELISMIHPK-----NDWPEVSAVKSLHGRGGMISKLGTARRMSNLGVTTHIASINQH
PROB_LEPIN        --EEKVVPFLEK--ISKEDLGLAGGP-SGPGTGGMFTKLKSAGLLSEAGIPTAILNGKKM
PROB_CAMJE        FSDAKRLEKITH--IKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNKKMFLASGFDL
PROB_THEMA        -KLVERFDESVK---------LKDMGKSSWGTGGIRSKIESALMASRCGVKATICSGNDV
PROB_AQUAE        IPVVEDIEKVFK---------YVRGTGTSFGTGGMRSKLEATRLATTLNIPVIITSKE--
PROB_NOSS1        VPDARPISLVTSIKELADLQVQTGSQGSQWGTGGMMTKISAARIAIAAGVRTVITQGRYP
PROB_SYNY3        DPDAYPIPLVKA-AELAQLQVRTDSTGSAWGTGGMATKITAARIATGSGVRTVITHGQKP
PROB_YERPE        NPEAELIREVHG--IDDVLRGMAGDSVSGLGTGGMATKLQAADVACRAGIDVVIAAGSQV
PROB_SERMA        NPQAELIREVHG--IDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDVVIAAGSKP
PROB_SALTY        NPQAELIKDVYG--VDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKP
PROB_ECOLI        NPQAELIKDVYG--IDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKP
PROB_PASMU        HPDAKLIADVDK--ITDHIRAIAGGSGTSLGTGGMSTKISAADVATRSGIETIIAPGNRP
PROB_HAEIN        NPEAKLIPVVEQ--ITDHIRSIAGGSGTNLGTGGMMTKIIAADVATRSGIETIIAPGNRP
PROB_VIBCH        DPNAQLIKEVTT--IDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEVIIAAGRAP
PROB_DEIRA        HPDATLIPVVER--VTPDIWALAGGAGSHRGTGGMHTKIQAAEIATRAGTPVVIAPGDLP
PROB_RALSO        HPDARFVDEAQA--GAPELEAMAGGAGSSIGKGGMLTKIVAAKRAAKSGAHTVIASGREA
PROB_PSEAE        NPDAQLIYEARA--DDPQLDAVAGGSAGALGRGGMQTKLRAARLAARSGGHTVIVGGRIE
PROB_XYLFA        HPDAQPLHEVRT--LTPEHLAMAGDSSSTVGTGGMRTKLEAALKAGAAGIDTYLFNGRSS
PROB_THET2        NPQARPIPEVES--VEA-VLAHAGEE-NPLGSGGMKSKLLAARIAGRVGIPTLLLPGKRP
PROB_MEIRU        HPEAQPIPYVER--VDAGVLRMAGDSPNRVGTGGMKSKLLAAEKAQAAGIPHLLLPGTRP
PROB_MYCTU        TADATFIPEVSG-PADLDGVVAGRSSH--LGTGGMASKVAAALLAADAGVPVLLAPAADA
PROB_MYCLE        NTGARFVPEVTG-SADLDGVVASRGSS--LGTGGMVSKMSSALLAADAGVPVLLAAAADA
PROB_CORGL        DPTAKFISEVRD-GNDLKGVIAGDGGK--VGTGGMASKVSAARLASRSGVPVLLTSAANI
PROB_STRCO        RPGTSRLAEVRD-MGDLAGVDIGSAGKAGVGTGGMVTKVEAARIAAAAGIPVVLTSAVHA
PROB_AGRFC        DPDAKFLETIADITPEIEAMAGGA--ASELSRGGMRTKIDAGKIATAAGCGMIIASGKTL
PROB1_RHIME       DPNARFLETVAEITPEIEAMAGGA--ASELSRGGMRTKIDAGKIATTAGCAMIIASGKPD
PROB1_RHILO       DPKAKFIPVVDRITPDIEAMAGAA--ASELSRGGMRTKLDAGKIATAAGTAMIITSGTRL
PROB_BRUME        NPDAQFLPFVETITPQIEAMAGAA--ASELSRGGMKTKLDAGKIANAAGTAMIITSGTRF
PROB_CAUVC        NPKAQHIPRVSEITPEIAGMAEGANAAAGVGTGGMATKIAAARIARAAGCATLITLGSRP
PROB2_RHIME       NPLTPMLTEVESITREIEAMATQS--VDPYSSGGMISKIEAGKIAMNAGCRMIIANGTRS
PROB2_RHILO       NPLARMIPEVRRITPEIEIMASLS--PARHGSGGMVTKLMAARIAMEAGCNVVIAKGSKS
PROB_CALS4        YKDAKVIEVVEE--FSDDLFKIAGGAGTKRGTGGMYTKIQAAKICYNSGVKMVIANGKID
PROB_CLOAB        NKNAVLIDTVNE--VNEEVKASAGGAGSKLGTGGMATKIRAAEIATENGISMVIANGEKQ
PROB_STRTR        YEDATLRSYVPE--ITEEILASAGGAGSKFGTGGMMSKIKSAQMVFENQSQMVLMNGENP
PROB_STRP1        YEDAQLRSHVAN--ITQEIIASAGGAGSKFGTGGMLSKVQSAQMVFENKGQMVLMNGANP
PROB_LACLA        YDDAKIFNEIHE--ITDELRQMAGGAGSRFGTGGMTSKLAAAQILFENGQEMVLTNGERI
PROB_LISMO        DPDAVMFSEINQ--ITPEIEALAGGKGSKFGTGGMLTKLSAASYCMNANQKMILTNGKNP
PROB_LISIN        DPDAVMFSEINQ--ITPEIEALAGGKGSKFGTGGMLTKLSAASYCMNANQKMILTNGKNP
PROB_CLOPE        NEDSKMLKEVYE--ITPEIEECAGGAGSNRGTGGMVTKLSAAKVATSNGIDMILANGENP
PROB_METAC        HSDAKLLTLIKK--ITPEIESYGGDPTNFKGVGGMRTKIKAAKICSMAGCYVVIANSEIE
PROB_TREPA        HTDAQHVPLVTD--VSALVGKTSMGSSNVFGTGGIATKLDAARLVTRAGIPLVLANGRHL
PROB_NEIMB        NPDAVRLDKIEH--INHEIIEMAGGSGSANGTGGMLTKIKAATIAAESGVPVYICSSLKP
PROB_NEIMA        NPDAVRLDKIEH--INHEIIEMAGGSGSANGTGGMLTKIKAATIATESGVPVYICSSLKP
PROB_STRPN        DPRAKRLERIET--INREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKS
Q1IS81_KORVE      AGRGQKLVRTVR--RLTPKMEALCGEKSELGTGGMRSKLRAAMMASENGVQVAIANGTAP
PROB_BACSU        NPEAKRFDYLPE--ITPELLGYAGSAGSKVGTGGMKSKLLATQTALSLGVKVFIGTGSGE
PROB_BACHD        HPNAKRYQYLPT--IPDEMLQMGGEAGSNVGTGGMKSKVAAAQTALSLGVDVFIGKASGE
PROJ_BACSU        NPEAKKIQRVSE--ITPDIEACAGDTGSIVGTGGMRSKLDAFKIVMASGIKGFLGQADAG
A5FEC3_FLAJ1      DENPETIKLVND---LKSLEKEIGESKSSHGTGGMQSKIEAAGISKAANIETWIVNGLND
F0S938_PSESL      VPEIRVIDKEAL--------SLARTDKSSVGLGGMTSKLNFARLATQMGIKAVIFGIRTE
                                                . **: :*:              :      

F6GCT5_LACS5      NVIVDIINNKQVGTKFIH------------------------------------------
G2PIL8_MURRD      NVILDVIDGKNVGTEVSKPE----------------------------------------
D3HMF9_LEGLN      EVIMRILSEESLGTTILPTKKRSNIKRWIAYGENKLGTITINTRLVEIIKENKRVISILP
PROB_LEPIN        HVIREFLEKNSIGTLVAPSGNRVFSEEDVKEIIRKNRNGNGGNSL---------------
PROB_CAMJE        SVAKTFLLED------KQIGGTLFE-----------------------------------
PROB_THEMA        SNLTRFVKGEPVGTVF-EPQGR-LKAKKAWIAFLSEPAGKIYVNKGAEEALKSG-NSLLP
PROB_AQUAE        ENILDLRNLKTKGTLF-KPSKRKLRNALKVIATLEEPKGIIVVDRGAQEALKAG-KSLLP
PROB_NOSS1        RNIEKIIQGELIGTHF-QPQPEPTSARKRWIAYGLVPVGKLYLDSGAIAAIVKAGKSLLP
PROB_SYNY3        EQILAILQGANLGTQF-EAQPRSDNARKRWIAYGLVPTGKIFIDAGAVQALKARGKSLLA
PROB_YERPE        GVIADVIDGTPVGTRF-HSLETPLENRKRWIFGAPPA-GEITVDDGAVFAIMERGSSLLP
PROB_SERMA        GVVADVIEGKPVGTRF-HALETPLENRKRWIFGAPPA-GEITVDDGAVEAMMARGSSLLP
PROB_SALTY        GVIGDVMEGISVGTRF-HAQASPLENRKRWIFGAPPA-GEITVDEGATAAMLERGSSLLP
PROB_ECOLI        GVIGDVMEGISVGTLF-HAQATPLENRKRWIFGAPPA-GEITVDEGATAAILERGSSLLP
PROB_PASMU        NVIVDLAYGQAIGTKF-SVQADRLESRKQWLYAAPSA-GIITIDAGAENAMLMQHKSLLP
PROB_HAEIN        NVIADLAYEQNIGTKFIAHQSDRLESRKQWLFAAPSA-GIITIDNGAQNAILEQNKSLLP
PROB_VIBCH        NVIFDSLSDEPQGTRF-LALEEALENRKRWILAGPAASGDIVIDDGAVKAVQTKGSSLLA
PROB_DEIRA        EALRRVVDGEALGTRF-LAHGTRLEARKRWILAEIAH-GRLLLDGGAAQAVRERGSSLLP
PROB_RALSO        DVLARLAGGEAIGTQL-RAPTGRMAARKQWMIDHLQLRGRVVLDAGAVDKLTAGGKSLLP
PROB_PSEAE        RVLDRLRAGERLGTLL-TPDRSRKAARKQWLAGHLQMRGTLVLDDGAVKAVSQDHKSLLP
PROB_XYLFA        DVVRGLAQHRLRGTRI-HPTCTPIAARKYWLRHAPVEPGAILIDAGAAAALAQQGASLLP
PROB_THET2        GVLLQALSGAPLGTYFHA-RRRYR-GEKAWLFGLLRPKGELVLDRGAVRALKERGASLLP
PROB_MEIRU        QSIAEALQGAPVGTLFAGGQRRYS-GRKLWLYQLPKPQGEVVVDAGAAKALRQGGASLLP
PROB_MYCTU        A--TALADASV-GTVF-AARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSLLA
PROB_MYCLE        A--TALTDASV-GTVF-AARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLLA
PROB_CORGL        G--PALEDAQV-GTVF-HPKDNRLSAWKFWALYAADTAGKIRLDDGAVEAVTSGGKSLLA
PROB_STRCO        A--DALAGGDT-GTYF-HATGRRSADRLLWLQHASAPQGALVLDDGAVRAVVEGRKSLLP
PROB_AGRFC        NPLKAIENGAR-SSWF-APSGTPVTARKTWIAGQLQPAGEIHVDAGAEKALYAG-KSLLP
PROB1_RHIME       HPLAAIEAGAR-SSWF-APSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSG-KSLLP
PROB1_RHILO       SPLMAIERGER-ATFF-RPSANPVKGYKTWIAGQLEPAGRLTVDAGAVGALASG-KSLLP
PROB_BRUME        GPLSAIDRGER-ATLF-EAAHAPVNAWKTWISGNLEPAGRLTVDAGAVKALKSG-KSLLP
PROB_CAUVC        RPLAAIAAGEK-ATLI-EAGASPAAAYKAWIAGSLAPQGWVTVDAGAASALLAG-KSLLP
PROB2_RHIME       HPLYAIESGGP-STHF-IPVARDRV-----------------------------------
PROB2_RHILO       YPLAAIENGAP-STWF-IPPARETATRGGR------------------------------
PROB_CALS4        NVLNRIAAGEKIGTTF-LPMKNPISSRKIWIAFNAKVNGFLFVDEGAAKALVKHGKSLLP
PROB_CLOAB        EAIRNILNFENEGTLF-IPKNK--------------------------------------
PROB_STRTR        RDILRVLEGAKIGTLF-KQED---------------------------------------
PROB_STRP1        RDILRVLEGQPLGTWF-KQIEEVRHD----------------------------------
PROB_LACLA        REIKEIIEGREIGTYF-HQKS---------------------------------------
PROB_LISMO        TIIFDIMQGEQIGTLF-ASKKEEFSHDGTH------------------------------
PROB_LISIN        TIIFDIMQGEQVGTLF-ASKKEEFSHDGTH------------------------------
PROB_CLOPE        EILIDILNGEDIGTMF-VAKKGE-------------------------------------
PROB_METAC        DVVTKILSGEEIGTLF-LAERHIQKNRARWIILARASGTVRVDAGAKAAVLGKN--SLLP
PROB_TREPA        DPILSLMRGDARGTLF-VPVS---------------------------------------
PROB_NEIMB        DALAEAAEHQADGSFFVPR-AKGLRTQKQWLAFYSESRGSVYVDEGAEHALSEQGKSLLM
PROB_NEIMA        DALAEAADNQADGSFFVPR-AKGLRTQKQWLAFYSESRGGVYVDEGAEHALSEQGKSLLM
PROB_STRPN        DSMIEAAEETEDGSYFVAQ-EKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQYGKSLLL
Q1IS81_KORVE      QAIRNAIERKI-GTYFPAT-KPAPKKRAKAAD----------------------------
PROB_BACSU        QKLADILDGRGDGTYIGDKELSSVNNTRQWIQFHSPISGEIIIDAGAEEAMIHNGSSLLP
PROB_BACHD        HALLDILSGKGDGTYVGNTGDLMEGKTKQWIRLHSPVSGVVRIDQGAERAIMNEGKSLLP
PROJ_BACSU        DILYHAVHEQAEGTYFEAEGTLPLNQKEQWIAFNSGPEGEMILSDDCSRKITNGQSSLYL
A5FEC3_FLAJ1      NFILKALKDEIPFTKIV-------------------------------------------
F0S938_PSESL      DGILKSLKGETGTVCH--PQPTKISSRNKWLASGSLIRGSVQVDEGAQKALEKR-RSLLA
                                                                              

F6GCT5_LACS5      ------------------------------------------------------------
G2PIL8_MURRD      ------------------------------------------------------------
D3HMF9_LEGLN      VGIEKFTGDFKRGDLVEILTPNN----EKIGIGLAKYDAIKLNEYLGHSAKPEFIHYDHL
PROB_LEPIN        ------------------------------------------------------------
PROB_CAMJE        ------------------------------------------------------------
PROB_THEMA        VGVTGVEGTFDVGDVVEIVNEEG----ELVGRGIVNYSSSDLEKIAGHKSSDLKKILGYE
PROB_AQUAE        AGVVSVQGNFKRGDVVSIQNEEG----LIIGKGKVNFSSEEIEKIKGLKTSEVRKLLNTT
PROB_NOSS1        AGVKTVAGEFEPQDAVQLCDPQG----NEIARGLVNYSSNDLQKICGRHSKEIPTILGYV
PROB_SYNY3        IGVVALEGEFSATDAVIICDPQG----QELGRGLVNYNCNELEKIKGLHSEAIAAVLGYV
PROB_YERPE        KGIRSVKGDFSRGEVIRIRNLNG----RDLAHGVSRYNSDALRMLAGHHSQQISEILGYE
PROB_SERMA        KGIREVKGDFSRGEVIRIRNLTG----RDLAHGVSRYNSDAMRMIAGHHSQEISEILGYE
PROB_SALTY        KGIKSVTGNFSRGEVIRICNLQG----RDIAHGVSRYNSDALRRIAGHHSQQIDAILGYE
PROB_ECOLI        KGIKSVTGNFSRGEVIRICNLEG----RDIAHGVSRYNSDALRRIAGHHSQEIDAILGYE
PROB_PASMU        AGIVNVEGRFSRGEVVKIRTQQG----KDVALGMPRYNSDALHLIQGKHSQDIEQVLGYE
PROB_HAEIN        AGIINVEGRFSRGEVVKIRTQSG----KDIALGMPRYNSDALQLIKGRKSADIENVLGYE
PROB_VIBCH        KGVVRVQGQFARGEVVRVLDKQS----HLIARGIAAYSNDELAQIAGKHSKEIIDILGYD
PROB_DEIRA        AGIRQVEGDFERGHTVRLLAPDG----QELGRGLTRYRADDLRRVCGHHSREIEALLGYT
PROB_RALSO        IGVTEVQGEFARGEVISCVDTAG----REVARGLTNYSAAEARLIARKASSEIEAVLGYV
PROB_PSEAE        VGVKAVQGSFRRGEMVVCVDQGG----REVARGLVNYSALEAQKILGQPTDAIEALLGYV
PROB_XYLFA        GGVLSAEGDFRRGDMIQIATRSPDHPPHPLARGLVQYSAADVRRIAGCHSRDIQPLLGYT
PROB_THET2        AGVKEVRGRFSRGEAVRLLSEEG----EEVGVGLANYASEEIARIKGRRSAEIEAVLGYR
PROB_MEIRU        AGILEVRGQFGVGEAVRCLDEQG----NLIGVGLVNYSAAELARIKRRKTREIEALLGYK
PROB_MYCTU        AGITAVSGRFCGGDVVELRAPDA----AMVARGVVAYDASELATMVGRSTSELPGEL---
PROB_MYCLE        AGITAVSGRFYGGDVVELRGPDA----TMVARGVVAYDATELAAMMGRSTSELPCEL---
PROB_CORGL        VGITEIIGDFQQGEIVEILGPAG----QIIGRGEVSYDSDTLQSMVGMQTQDLPDGM---
PROB_STRCO        AGIAGVEGDFAAGDPVELRDGTG----RAVARGLVNFDAKEMPRLIGRSTRELARELGPA
PROB_AGRFC        AGVRQVKGNFGRGDAIAIIGVEG----REVARGLAGYDAEEARLIIGHKSNEIETILGYV
PROB1_RHIME       AGVRQVTGSFSRGDTIAIIGASG----REIARGLAGYDADEARQIAGKKSAEIAAILGYA
PROB1_RHILO       AGVKLVSGNFSRGDTVAILSPDG----REIARGLVAYDAADAVRIAGLKTAEIETVLGYE
PROB_BRUME        AGVKEVDGDFERGDTVAVMNEDG----REIARGLIAYDAADARKVAGHKSDEISAILGYD
PROB_CAUVC        AGVRAVEGPFDKGDAVRVRDENG----REVARGLVRYDSADAQRIAGLRSDAIEAELGFT
PROB2_RHIME       ------------------------------------------------------------
PROB2_RHILO       ------------------------------------------------------------
PROB_CALS4        SGIVKTEGQYDVGDCVAVVDHQG----REIARGLVNYSSEEVEKIKGCKTHDIESILGYK
PROB_CLOAB        ------------------------------------------------------------
PROB_STRTR        ------------------------------------------------------------
PROB_STRP1        ------------------------------------------------------------
PROB_LACLA        ------------------------------------------------------------
PROB_LISMO        ------------------------------------------------------------
PROB_LISIN        ------------------------------------------------------------
PROB_CLOPE        ------------------------------------------------------------
PROB_METAC        AGIVDIEGTFDRGD-VVKLECEG----KVFAKGITNYTSKELIKIKGAQTNQIDNILGYN
PROB_TREPA        ------------------------------------------------------------
PROB_NEIMB        SGIAGIEGHFSRMDTVTVYSKATKQP---LGKGRVLFGSAAAEDLLKSRKAKGVFIHRDD
PROB_NEIMA        SGIAGIEGHFSRMDTVTVYSKATKQP---LGKGRVLFGSAAAEDLLKLRKAKGVFIHRDD
PROB_STRPN        SGIVEAEGVFSYGDIVTVFDKESGKS---LGKGRVQFGASALEDMLRSQKAKGVLIYRDD
Q1IS81_KORVE      ------------------------------------------------------------
PROB_BACSU        AGVVGVNGSFPKGAVVEVRG--PGGV---IGKGQTHYSSEEIMEAKGKRSDELDFEKTF-
PROB_BACHD        AGVTSVHGTFQAGDVVHIWNE-QNKV---IAKGQVTLSSEQLRKVQGRKSDEAKQLIPLV
PROJ_BACSU        DGVQKIKGKFKSGSVVRLMDS-KGTE---IGLGIVNYSSVQLQEPEKKK--ELTNRALID
A5FEC3_FLAJ1      ------------------------------------------------------------
F0S938_PSESL      VGVKSFLSDFESGEVFQIVNEKN----IVIAVAKAKIDSKTLKTIESRQNIELAHADDIV
                                                                              

F6GCT5_LACS5      ----------------------------------
G2PIL8_MURRD      ----------------------------------
D3HMF9_LEGLN      HIF-------------------------------
PROB_LEPIN        ----------------------------------
PROB_CAMJE        ----------------------------------
PROB_THEMA        GNKVVVHIDNMWVA--------------------
PROB_AQUAE        -KDEVIHRDNMVIFL-------------------
PROB_NOSS1        GAETVIHRDNLVLT--------------------
PROB_SYNY3        GPDTVIHRDNLVLQEN------------------
PROB_YERPE        YGPVAVHRDDMIVS--------------------
PROB_SERMA        YGPVAVHRDDMIVS--------------------
PROB_SALTY        YGPVAVHRDDMITR--------------------
PROB_ECOLI        YGPVAVHRDDMITR--------------------
PROB_PASMU        YGAVAVHRDDMIVL--------------------
PROB_HAEIN        YGAVAMHRDDMIILS-------------------
PROB_VIBCH        HGSEVIHRDDMVVIQE------------------
PROB_DEIRA        YGEEAVHRDDLVLL--------------------
PROB_RALSO        SAAELVHRDNLVLL--------------------
PROB_PSEAE        DGPELVHRDNLVLV--------------------
PROB_XYLFA        YGDTIVHRDDLVLL--------------------
PROB_THET2        YTEEVVHRDHLALKEEA-----------------
PROB_MEIRU        NTDEAIHRDYFALASELE----------------
PROB_MYCTU        -RRPVVHADDLVAVSAKQAKQV------------
PROB_MYCLE        -RRPAVHADDLVSI--------------------
PROB_CORGL        -QRPVVHADYLSNYASRA----------------
PROB_STRCO        YEREVVHRDDLVILHP------------------
PROB_AGRFC        GRAAMIHRDDLVMTGAAVKVKHAKKDE----VHA
PROB1_RHIME       GRTAMVHRDDLVMTAPSGARLVEESDEGKGKLHA
PROB1_RHILO       ARSAMIHRDDLVVSHAGGDISGG-----------
PROB_BRUME        ARAAMIHRNDLVVRAASDAKAA------------
PROB_CAUVC        -EGPMIHADDLAVAH-------------------
PROB2_RHIME       ----------------------------------
PROB2_RHILO       ----------------------------------
PROB_CALS4        YYDEVIHRDNLVVLERGEKYGG------------
PROB_CLOAB        ----------------------------------
PROB_STRTR        ----------------------------------
PROB_STRP1        ----------------------------------
PROB_LACLA        ----------------------------------
PROB_LISMO        ----------------------------------
PROB_LISIN        ----------------------------------
PROB_CLOPE        ----------------------------------
PROB_METAC        NYDNVIKKENIGILEGIN----------------
PROB_TREPA        ----------------------------------
PROB_NEIMB        WISITPEIRLLLTEF-------------------
PROB_NEIMA        WISITPEIRLLLTEF-------------------
PROB_STRPN        WISITPEIQLLFTEF-------------------
Q1IS81_KORVE      ----------------------------------
PROB_BACSU        --EVIHRNDWVNVKD-------------------
PROB_BACHD        RDEVVHRDQLVIQEKELNES--------------
PROJ_BACSU        QEAFVCHVDFSLPVN-------------------
A5FEC3_FLAJ1      ----------------------------------
F0S938_PSESL      LL--------------------------------