CLUSTAL format seed alignment for MF_00458

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSAA_PROM1      MTISPPEKEQKKE----PVLDKPIETDAIPVDFSKLDKP--GFWSKSLAKG-PKTTTWIW
PSAA_PROMT      MTISPPEKEQKKE----PVLDKPIETDAIPVDFSKLDKP--GFWSKSLAKG-PKTTTWIW
PSAA_PROMA      MTISPPERGEKAKGAAPTPYDQPVDRDHAPIDYEKLNKP--GFWSSKLSKG-PKTTTWIW
PSAA_PROM0      MTISPPESGEKNK----KVLEDPVKADPRPIDFAKLDKP--GFWSTKLSKG-PKTTTWIW
PSAA_PROMS      MTISPPESGEKNK----KVLEDPVKADPRPIDFAKLDKP--GFWSSKLSKG-PKTTTWIW
PSAA_PROMP      MTISPPESGEKDK----KILESPVKADPRPIDFAKLDKP--GFWSSKLSKG-PKTTTWIW
PSAA_PROM9      MTISPPESGEKNK----KVLEDPVKADPRPIDFAKLDKP--GFWSTKLSKG-PKTTTWIW
PSAA_PROM5      MTISPPESGEKDK----KILESPVKADPRPIDFAKLDKP--GFWSSKLSKG-PKTTTWIW
PSAA_PROM3      MTISPPERGEKAK----PIYDQPVDRDHVPADFEKFEQP--GFFSKSLAKG-PNSTTWIW
PSAA_PROMM      MTISPPERGEKAK----PIYDQPVDRDHVPADFEKFEQP--GFFSKSLAKG-PNSTTWIW
PSAA_SYNS9      MTISPPERGSDAK--------SQVEKVDNPATFELFGKP--GHFDRALAKG-PKTTTWVW
PSAA_SYNPX      MTISPPERGSDAK--------SQVEKVDNPATFELFGKP--GHFDRALAKG-PKTTSWVW
PSAA_SYNSC      MTISPPERGSDAK--------SQVEKVDNPATFELFGKP--GHFDRALAKG-PKTTTWVW
PSAA_SYNS3      MTISPPERGSTAK--------SQVEKVDNPATFELFGKP--GHFDRALAKG-PKTTTWVW
PSAA_SYNJA      MTTTPKERE--------PKVKVSVDIDPVPTSFEKWAKP--GHFDRSLARG-PKTTTWIW
PSAA_SYNJB      MTTTPKERE--------PKVKVSVDVDPVPTSFEKWAKP--GHFDRSLSRG-PKTTTWIW
PSAA_GLOVI      MSTTPQERE--------KPVRVLVDNDPVPTSTEKWGKP--GWFERNLARG-PKTTTWIW
PSAA_SYNE7      MTISPPERE--------AKVKATVDKNPVPTSFEKWGKP--GHFDRTLAKG-PKTTTWIW
PSAA_SYNP6      MTISPPERE--------AKVKATVDKNPVPTSFEKWGKP--GHFDRTLAKG-PKTTTWIW
PSAA_NOSS1      MTISPPERE-------EKKARVIVDKDPVPTSFEKWAQP--GHFDRTLARG-PKTTTWIW
PSAA_TRIV2      MTISPPERE-------EKKARVIVDKDPVPTSFEKWAQP--GHFDRTLARG-PKTTTWIW
PSAA_TRIEI      MTISPPERE-------AK-VRVTVDTDPVPTSFEKWGKP--GHFSRSLARG-PKTTTWIW
PSAA_SYNY3      MTISPPERE-------AK-AKVSVDNNPVPTSFEKWGKP--GHFDRTLARG-PKTTTWIW
PSAA_THEEB      MTISPPERE-------PK-VRVVVDNDPVPTSFEKWAKP--GHFDRTLARG-PQTTTWIW
PSAA_TRICV      MAISSTERR-------AKNVQIFVEKDAVETSFAKWAQP--GHFSRTLAKG-PKTTTWIW
PSAA_THAPS      MAISSTERR-------SKNVQVFVEKDAVETSFAKWAQP--GHFSRTLAKG-PKTTTWIW
PSAA_PHATC      MAISSTDRR-------SKNVQIFVEKDAVETSFAKWAQP--GHFSRTLAKG-PKTTTWIW
PSAA_EMIHU      MKVGSKELE-------ASKVRVIVDKDPVATSFEKWAQP--GHFSRTLAKG-PKTTTWIW
PSAA_GUITH      MTISSTEQE-------AKKVNVVVDRNPVSTSFEKWGQP--GHFSRTLAKG-PKTTTWIW
PSAA_PORPU      MAISSKEQE-------TKKVKISVDKNPVDTSFEKWAQP--GHFSRTLAKG-PKTTTWIW
PSAA_PYRYE      MAISSKEQE-------TKKVKISVDKNPVDTSFEKWAQP--GHFSRTLAKG-PRTTTWIW
PSAA_GRATL      MTISSQEQE-------TKKVQVTVDKNPVATSFEKWAKP--GHFSRTLAKG-PKTTTWIW
PSAA_CYAM1      ----MTLTT-------EKQVKVVVDRDVVPTSFEKWAKP--GHFSRSLAKG-PKTTTWIW
PSAA_CYACA      MNQILKEKE-------QKTAKILVDRNPVPTSFEKWGVP--GHFSRSLAKG-PKTTTWIW
PSAA_CYAPA      MRISPPERE-------AKKVKIVIDKDPVSTSFDKWAVP--GHFSRTLAKG-PKTTTWIW
PSAA_EUGGR      MTITPPEQQ-------VKRVRVAFVSNPVETSFEKWSRP--GHFSRLLSKG-PNTTTWIW
PSAA_BIGNA      MAIDVSNQN-------DDLVKVVVDVDPVPTDFERWAKP--GHFSRSLSKG-PLTTTWIW
PSAA_CHLRE      MTISTPERE-------AKKVKIAVDRNPVETSFEKWAKP--GHFSRTLSKG-PNTTTWIW
PSAA_TETOB      MTISSPERE-------AKKVKIAVDRNPVETSFEKWAKP--GHFSRTLSKG-PNTTTWIW
PSAA_STIHE      MTINLPEKE-------AKRVQIAVDRNPVETSFQKWAKP--GHFSRTLAKG-PNTTTWIW
PSAA_OLTVI      MTISPPERE-------AKKVKIVVDRNPVETSLEKWAKP--GHFSRALSKG-PTTTTWIW
PSAA_CHLVU      MTISPPERE-------AKKVKIVVDRNPVATNFEKWAKP--GHFSRTLSKG-PTTTTWIW
PSAA_TUPAK      MTISPPERE-------AKKVKIVVDRDPVETSFEKWAKP--GHFSRTLSKG-PTTTTWIW
PSAA_NEPOL      MTISPPERE-------AKKVKIVVDRNPVVTSFEKWAKP--GHFSRTLAKG-PTTTTWIW
PSAA_OSTTA      MTISPPERE-------IKTVKIVVDRDPVPTSFEKWAKP--GHFSRTLAKG-PATTTWVW
PSAA_MESVI      MTISPPERE--------ANGKIVVDRDPVKTSFERWGKP--GHFSRSLAKG-PNTTTWIW
PSAA_CHLAT      MTISPPEQE--------ASVKIVVDRDPVKTSFERWAKP--GHFSRTLAKG-PNTTTWIW
PSAA_STAPU      MTIRSPEP----------EVKIVVDNDPVKTSFEKWAKP--GHFSRALAKG-PSTTTWIW
PSAA_ZYGCR      MTIRSPEP----------EVKILVDIDPVPTSFERWAKP--GHFARSLAKG-PSTTTWIW
PSAA_CHAGL      MTIRSPET----------EVKIVVEKDPVKTSFEKWAQP--GHFSRTLAKG-PSTTTWIW
PSAA_ANGEV      MTIRSPEP----------EVKIVVERDPIKTSFEKWAQP--GHFSRTLAKG-PNTTTWIW
PSAA_PSINU      MTIRSPEP----------EVKILVERDPVKTSLEKWAQP--GHFSRTLAKG-PNTTTWIW
PSAA_ANTAG      MTIRSPEP----------EVKIVVEKDPVKTSFEKWAKP--GHFSRTLAKG-PSTTTWIW
PSAA_PHYPA      MTIRSPEP----------EVKIMVEKDPVKTSFEKWAKP--GHFSRTLAKG-PNTTTWIW
PSAA_MARPO      MTIRSPEP----------EVKIVVEKDPVKTSFEKWAKP--GHFSRTLAKG-PSTTTWIW
PSAA_PINKO      MIIRSPKP----------EVKIVVERDPVKTSFEKWAKP--GHFSKTLAKG-PDTTTWIW
PSAA_PINTH      MTIRSPEPE-------VKKVKVVVDRDTVKTSFEKWAKP--GHFSRTLAKG-PDTTTWIW
PSAA_GOSBA      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_GOSHI      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_HELAN      MIIRSPEP----------EVKILVDRDHIKTSFEEWARP--GHFSRTIAKG-PETTTWIW
PSAA_LACSA      MIIRSPEP----------EVKILVDRDHIKTSFEEWARP--GHFSRTIAKG-PETTTWIW
PSAA_SPIOL      MIIRSPEP----------EVKILVDRDPVKTSFEAWAKP--GHFSRTIAKG-PETTTWIW
PSAA_NICSY      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_TOBAC      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_NICTO      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_ATRBE      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_SOLBU      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_SOLLC      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_SOLTU      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_JASNU      MIIRSPEP----------EVKILVDRDHIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_DAUCA      MIIRSPEP----------EVKILVDRDHIKTSFEEWARP--GHFSRTLAKG-PDTTTWIW
PSAA_PANGI      MIIRSPEP----------EVKILVDRDHIKTSFEEWARP--GHFSRTLAKG-PDTTTWIW
PSAA_BARVE      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_CAPBU      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_OLIPU      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_CRUWA      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_ARATH      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_NASOF      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_LEPVR      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_AETCO      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_LOBMA      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_ARAHI      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_DRANE      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_AETGR      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_POPAL      MIIRSPEP----------EVKILVDRDPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_POPTR      MIIRSPEP----------EVKILVDRDPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_EUCGG      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_CITSI      MIIRSPEP----------EVKILVDRDPVKTSFEEWAKP--GHFSRTIAKG-PETTTWIW
PSAA_OENEH      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PETTTWIW
PSAA_CUCSA      MIIRSPEP----------EVKILVDRDPIKTSFEDWARP--GHFSRTIAKG-PDTTTWIW
PSAA_LOTJA      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_SOYBN      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_PHAVU      MIIRSPEP----------EVKILVDRDPIKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_PELHO      MIIRSSEP----------EVKILVDRDPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_MORIN      MIIRSPEP----------DVKILVDRDPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_VITVI      MIIRSPEP----------EVKILVDRDPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_COFAR      MIIRSPEP----------EVKILVDRDPVKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_CALFG      MIIRSPES----------EVKIMVDRDPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_LIRTU      MIIRSPEP----------EVKIVVDRDPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_AMBTC      MIIRSPES----------EVKIMVDRDPIKTSFEEWARP--GHFSRTIAKG-PNTTTWIW
PSAA_DRIGR      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PETTTWIW
PSAA_AGRST      MIIRSPEP----------EVKIVVDRDPVKTSFEEWARP--GHFSRTLAKG-PDTTTWIW
PSAA_WHEAT      MIIRSPEP----------EVKIVVDRDPVKTSFEEWARP--GHFSRTLAKG-PDTTTWIW
PSAA_HORVU      MIIRSPEP----------EVKIVVDRDPVKTSFEEWARP--GHFSRTLAKG-PDTTTWIW
PSAA_ORYNI      MMIRSPEP----------EVKIVVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_ORYSA      MMIRSPEP----------EVKIVVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_ORYSI      MMIRSPEP----------EVKIVVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_ORYSJ      MMIRSPEP----------EVKIVVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_SACHY      MIIRPSEP----------EVKIAVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_SACOF      MIIRPSEP----------EVKIAVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_SORBI      MIIRPSEP----------EVKIAVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_MAIZE      MIIRSSEP----------EVKIAVDRDPIKTSFEEWARP--GHFSRTIAKGNPDTTTWIW
PSAA_PHAAO      MIIRSPEP----------EVKIVVDRNPIKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_ACOCL      MIIRSPEP----------EVKIVVDRDPIKTSFEAWARP--GHFSRTIAKG-PDTTTWIW
PSAA_NANDO      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTLAKG-PETTTWIW
PSAA_PLAOC      MIIRSPES----------EVKILVDRDPVKTSFEEWARP--GHFSRTLAKG-PETTTWIW
PSAA_PIPCE      MIIRSPES----------EVKIVVDRDPVKTSFEEWAKP--GHFSRTIAKG-PDTTTWIW
PSAA_NYMAL      MIIRSPEP----------EVKILVDRDPVKTSFEEWARP--GHFSRTIAKG-PDTTTWIW
PSAA_HUPLU      MTIRSPEP----------EVKIAVERDPVKTSFEKWAQP--GHFSRTLAKG-PSTTTWIW
PSAA_ADICA      MTIRSPEP----------EVKIMVEKDPVKTSFEKWAQP--GHFARNLAKG-PSTTTWIW
PSAA_CHAVU      MTISRPEQ----------EVKILVEKDPIKTSFEKWAKP--GHFSRNLSKG-PNTTTWIW
PSAA_HETTR      ---------------------MKLFFRYVNSRVWSQAGS--SHFNKALAKG-PKTTTWIW
PSAA_AMPCA      MPPGRPEVYQERF----DIVQPHCSSEHTISLNTDFSKAAFGSATGLVAKAASQTTTAIW
                                                      .  .     :::. . :*: :*

PSAA_PROM1      NLHADAHDFDTHVGD--LQETSRKVFSAHFGHLAVIFIWMSAAFFHGARFSNYSGWLSDP
PSAA_PROMT      NLHADAHDFDTHVGD--LQETSRKVFSAHFGHLAVIFIWMSAAFFHGARFSNYSGWLSDP
PSAA_PROMA      NLHADAHDFDTHLGD--LEETSRKIFSAHFGHLAVVFIWMSAAFFHGARFSNYTGWLADP
PSAA_PROM0      NLHADAHDFDVHTGD--AEEATRKIFSAHFGHLAVIFIWMSAAFFHGARFSNYSGWLADP
PSAA_PROMS      NLHADAHDFDVHTGD--AEEATRKIFSAHFGHLAVIFIWMSAAFFHGARFSNYSGWLADP
PSAA_PROMP      NLHADAHDFDIHTGD--AEEATRKIFSAHFGHLAVIFIWMSAAFFHGARFSNYSGWLADP
PSAA_PROM9      NLHADAHDFDVHTGD--AEEATRKIFSAHFGHLAIIFIWMSAAFFHGARFSNYTGWLADP
PSAA_PROM5      NLHADAHDFDVHTGD--AEEATRKIFSAHFGHLAVIFIWMSAAFFHGARFSNYSGWLADP
PSAA_PROM3      NLHADAHDFDTHIGD--LEETSRKIFSAHFGHLAIVFIWLSGAFFHGARFSNYSGWLADP
PSAA_PROMM      NLHADAHDFDTHIGD--LEETSRKIFSAHFGHLAIVFIWMSGAFFHGARFSNYSGWLADP
PSAA_SYNS9      NLHANAHDFDAHTSD--LQEVSRRIFSAHFGHLAVIFIWLSGAFFHGARFSNYSGWLADP
PSAA_SYNPX      NLHANAHDFDAHTSD--LQEVSRRIFSAHFGHLAVIFIWLSGAFFHGARFSNYSGWLADP
PSAA_SYNSC      NLHANAHDFDAHTSD--LQEVSRRIFSAHFGHLAVIFIWLSGAFFHGARFSNYSGWLADP
PSAA_SYNS3      NLHANAHDFDSHTSD--LEEVSRKIFSAHFGHLAVIFIWLSGAFFHGARFSNFSGWLADP
PSAA_SYNJA      NLHALAHDFDSHTSD--LEDVSRKIFSAHFGHLAVVFVWLSGMYYHGAQFSNYSAWLADP
PSAA_SYNJB      NLHALAHDFDSHTSD--LEDVSRKIFSAHFGHLAVVFVWLSGMYYHGAQFSNYSAWLADP
PSAA_GLOVI      DLHALAHDFETHTSD--KEEISRKIFSAHFGHLAVVCVWLSGMFWHGAYFSNFTAWMENP
PSAA_SYNE7      NLHANAHDFDSHTSD--LEDISRKIFSAHFGHLAVIFIWLSGAYFHGARFSNFSGWLADP
PSAA_SYNP6      NLHANAHDFDSHTSD--LEDISRKIFSAHFGHLAVIFIWLSGAYFHGARFSNFSGWLADP
PSAA_NOSS1      NLHALAHDFDTHTSD--LEDISRKIFAAHFGHLAVVTIWLSGMIFHGAKFSNYEAWLSDP
PSAA_TRIV2      NLHALAHDFDTHTSD--LEDISRKIFAAHFGHLAVVTIWLSGMIFHGAKFSNYEAWLSDP
PSAA_TRIEI      NLHADAHDFDSHTSD--LEDVSRKIFSAHFGHLAIIFVWLSGAYFHGAKFSNYEAWLADP
PSAA_SYNY3      NLHANAHDFDSQTSD--LEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADP
PSAA_THEEB      NLHALAHDFDTHTSD--LEDISRKIFSAHFGHLAVVFIWLSGMYFHGAKFSNYEAWLADP
PSAA_TRICV      NLHADAHDFDSQTSS--LEEVSRKIFSAHFGQLAVIFLWISGMHFHGAYFSNYSAWLSDP
PSAA_THAPS      NLHADAHDFDSQTSS--LEEVSRKIFSAHFGQLAIIFLWISGMHFHGAYFSNYSAWLTDP
PSAA_PHATC      NLHADAHDFDSQTSS--LEEVSRKIFSAHFGQLSVIFLWISGMHFHGAYFSNYSAWLTDP
PSAA_EMIHU      NLHADAHDFDSQTSS--LEDISRKIFSAHFGQLAIIFLWVSQAYFHGARFSNYSAWLLNP
PSAA_GUITH      NLHADAHDFDSHTSS--LEDISRKIFSAHFGQLSIIFLWISGMHFHGARFSNYSAWLSNP
PSAA_PORPU      NLHADAHDFDSQTSS--LEEVSRKIFSAHFGQLAVIFLWLSGMYFHGARFSNYVAWLSNP
PSAA_PYRYE      NLHADAHDFDSQTSS--LEEVSRKIFSAHFGQLSVIFLWLSGMYFHGARFSNYVAWLSNP
PSAA_GRATL      NLHADAHDFDSHTSS--LEEVSRKIFSAHFGQLAIIFLWLSGMYFHGAKFSNYIAWLSNP
PSAA_CYAM1      NLHADAHDFDSHTSS--LEEVSRKIFSAHFGQLAIIFIWLSGMYFHGARFSNYVAWLSNP
PSAA_CYACA      NLHADVHDFDSHTSS--LEDISRKIFSAHFGQLSLIFIWLSGMYFHGARFSNYTIWLSNP
PSAA_CYAPA      NLHADVHDFDSYTSD--LEDVSRKIFSAHFGHLAVVFIWLSGAYFHGARFSNYEAWLSNP
PSAA_EUGGR      NLHADAHDFDNHTTD--LEDISRKVFSAHFGQLAIIEIWLSGMFFHGARFSNYEAWLLDP
PSAA_BIGNA      NLHADVHDFDGYSTN--LQDISRKIFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSNP
PSAA_CHLRE      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_TETOB      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLGVIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_STIHE      NLHADAHDFDSHTSD--LQDISRKVFSAHFGQLGIILIWLSGMYFHGARFSNYEAWLSDP
PSAA_OLTVI      NLHADAHDFDSHTSD--LEDISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_CHLVU      NLHADAHDFDTQTSD--LEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLTDP
PSAA_TUPAK      NLHADAHDFDAQTTD--LEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_NEPOL      DLHADAHDFDSHTTD--LEDISPKIFSAHFGQLGVILIWLSGMYFHGARFSNYEAWLSDP
PSAA_OSTTA      DLHADAHDFDSHTTD--LEDISRKVFSAHFGQLGVIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_MESVI      NLHADAHDFDSHTND--LEDISRKVFSAHFGQLAVIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_CHLAT      NLHADAHDFDSHTND--LEDISRKVFSAHFGQLAVIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_STAPU      DLHADAHDFDSHTSD--LEEISRKVFSAHFGQLAVIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_ZYGCR      DLHADAHDFDSHTSD--LEEISRKVFSAHFGQLAVIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_CHAGL      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQIAVILIWLSGMYFHGARFSNYEAWLSDP
PSAA_ANGEV      NLHADAHDFDSHTND--LEDISRKVFSAHFGQLAIILIWLSGMYFHGARFSNYEAWLSDP
PSAA_PSINU      NLHADSHDFDSHTND--LEEISRKVFSAHFGQLAIIFVWLSGMYFHGARFSNYEAWLSDP
PSAA_ANTAG      NLHADAHDFDSHTND--LEEVSRKVFSAHFGQLAIIFIWLSGMYFHGARFSNYEAWLGDP
PSAA_PHYPA      NLHADAHDFDSHTND--LEEISRKVFSAHFGQLAVIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_MARPO      NLHADAHDFDSHTND--LEEISRKVFSAHFGQLAIIFIWLSGMYFHGARFSNYEAWLSDP
PSAA_PINKO      NLHADAHDFDSHTKD--LEEISRKVFSAHFGQLAIIFIWLSGMYFHGARFSNYEAWLADP
PSAA_PINTH      NLHADAHDFDSHTNN--LEDISRKIFSAHFGQLAIIFIWLSGMYYHGARFSNYEAWLADP
PSAA_GOSBA      NLHADAHDFDSHTSD--LEEISRKIFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_GOSHI      NLHADAHDFDSHTSD--LEEISRKIFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_HELAN      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_LACSA      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SPIOL      NLHADAHDFDSHTSD--LEEISRKIFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_NICSY      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_TOBAC      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_NICTO      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ATRBE      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SOLBU      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SOLLC      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SOLTU      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_JASNU      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_DAUCA      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_PANGI      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_BARVE      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_CAPBU      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_OLIPU      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_CRUWA      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ARATH      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_NASOF      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_LEPVR      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_AETCO      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_LOBMA      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ARAHI      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_DRANE      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_AETGR      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_POPAL      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_POPTR      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_EUCGG      NLHADAHDFDSHTND--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_CITSI      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_OENEH      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_CUCSA      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLGDP
PSAA_LOTJA      NLHADAHDFDSHTSD--LEDISRKIFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SOYBN      NLHADAHDFDSHTND--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_PHAVU      NLHADAHDFDSHTND--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_PELHO      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_MORIN      NLHADAHDFDSQTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_VITVI      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_COFAR      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_CALFG      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_LIRTU      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_AMBTC      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_DRIGR      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_AGRST      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_WHEAT      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_HORVU      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ORYNI      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ORYSA      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ORYSI      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ORYSJ      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SACHY      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SACOF      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_SORBI      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_MAIZE      NLHADAHDFDSHTGD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_PHAAO      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_ACOCL      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_NANDO      NLHADAHDFDSHTSD--LEEISRKIFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_PLAOC      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_PIPCE      NLHADAHDFDSHTSD--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_NYMAL      NLHADAHDFDSHTND--LEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDP
PSAA_HUPLU      NLHADAHDFDSHTND--LEEISRKVFSAHFGQLAIIFIWLSGMYFHGARFSNHEAWLSDP
PSAA_ADICA      NLHADAHDFDSHTND--LEDISRKIFSAHFGQLAIIFIWLSGMYFHGARFSNYESWLNDP
PSAA_CHAVU      NLHADAHDFDSHTSD--LEDISRKVFSAHFGQLAVIFIWISGMYFHGARFSNYEAWLSDP
PSAA_HETTR      SLHADAHDFQQSSSESTAASVGAKVFSSGLAHFSIVFFWLGGMHFHGAYFSNYSAWLKDP
PSAA_AMPCA      NLHADAHDFSNSSYL------SKQVFAANLAHIGVAFIWLSGMHFHGAYFSNYLDWLQDP
                .***  ***.             ::*:: :.::.:  .*:.   :*** ***.  *: :*

PSAA_PROM1      THVKPGAQVVWPIVGQEMLN--ADLGGNYH--GIQITSGIFQMWRGWGITNETELMALAI
PSAA_PROMT      THVKPGAQVVWPIVGQEMLN--ADLGGNYH--GIQITSGIFQMWRGWGITNETELMALAI
PSAA_PROMA      TNVKPGAQVVWPVVGQEILN--ADLGGNYQ--GLQITSGIFQMWRAWGITSEVQLMALAI
PSAA_PROM0      THVKPGAQQVWAIVGQEMLN--ADLGANYN--GIQISSGIFHMWRAWGITNESELMALAI
PSAA_PROMS      THVKPGAQQVWAIVGQEMLN--ADLGANYN--GIQISSGIFHMWRAWGITNESELMALAI
PSAA_PROMP      THVKPGAQQVWAIVGQEMLN--GDLGANYN--GIQISSGVFHMWRAWGITNESELMALAI
PSAA_PROM9      TNVKPGAQQVWAVVGQEMLN--GNLGADYN--GIQISSGIFHMWRAWGITNESELMALAI
PSAA_PROM5      THVKPGAQQVWAIVGQEMLN--GDLGANYN--GIQISSGVFHMWRAWGITNESELMALAI
PSAA_PROM3      THVKASAQVVWPIVGQEIMN--ADVGAGFN--GIQITSGIFQMWRAWGITSETELMALAT
PSAA_PROMM      THVKASAQVVWPIVGQEIMN--ADMGAGFN--GIQITSGIFQMWRAWGITSETELMALAT
PSAA_SYNS9      THVKPSAQVVWPIFGQEILN--GDMGAGFN--GIQITSGLFHVWRGWGITSETQLMALAI
PSAA_SYNPX      THVKPSAQVVWPIFGQEILN--GDMGAGFQ--GIQITSGLFHVWRGWGITSETQLMALAI
PSAA_SYNSC      THVKPSAQQVWAVFGQEVLN--GDMGAGFQ--GIQITSGLFQMWRAWGITSETQLMALAI
PSAA_SYNS3      THVKPSAQVVWPVFGQEILN--GDMGAGFQ--GIQITSGLFHVWRAWGITNETQLMSLAI
PSAA_SYNJA      INIKPSAQVVWPIFGQEILN--GDVGGGFE--GIRITSGLFHLWRAAGITNEFQLLCTAI
PSAA_SYNJB      INIKPSAQVVWPIFGQEILN--GDVGGGFE--GIRITSGLFHLWRAAGITNEFQLLCTAI
PSAA_GLOVI      LGLKPSAQTVWPVFGQEILNDPSTVAKGFEQGGIVITSGLFHLWRAVGFTTTGQLAAMSI
PSAA_SYNE7      THVKPSAQVVWPIFGQEILN--GDVGGGFH--GIQITSGLFQLWRASGYTNEFQLYVTAI
PSAA_SYNP6      THVKPSAQVVWPIFGQEILN--GDVGGGFH--GIQITSGLFQLWRASGYTNEFQLYVTAI
PSAA_NOSS1      LNVRPSAQVVWPIVGQDILN--GDVGGGFH--GIQITSGLFQVWRGWGITNSFQLYCTAI
PSAA_TRIV2      LNVRPSAQVVWPIVGQDILN--GDVGGGFH--GIQITSGLFQVWRGWGITNSFQLYCTAI
PSAA_TRIEI      TGIKPSAQVVWPVLGQGILN--GDMGGGFH--GIQITSGLFQLWRASGITNEYQLYCTAI
PSAA_SYNY3      THIKPSAQVVWPIVGQGILN--GDVGGGFH--GIQITSGLFYLWRASGFTDSYQLYCTAI
PSAA_THEEB      TGIKPSAQVVWPIVGQGILN--GDVGGGFH--GIQITSGLFQLWRASGITNEFQLYCTAI
PSAA_TRICV      ISIKQSSQVVWPIVGQEILN--ADVGGNFQ--GVQTTSGWFQMWRAEGITSEVELYWIAI
PSAA_THAPS      ISIKQSSQVVWPIVGQEILN--ADVGGNFQ--GIQTTSGWFQMWRAEGITSEVELYWTAI
PSAA_PHATC      VNIKQSSQVVWPIVGQEILN--GDVGGNFQ--GIQTTSGWFQMWRAEGITSEVELYWIAI
PSAA_EMIHU      TSIKPSAQVVWPVVGQEILN--GDVGGGFS--GVQITSGVFQMWRASGITNETELYWTAM
PSAA_GUITH      TTVKPSAQVVWPIVGQEILN--GDVGGGFQ--GVQVTSGFFQIWRAEGITSEVELYWCAV
PSAA_PORPU      TGIKPSAQVVWPIVGQEILN--GDVGGGFQ--GVQVTSGWFQLWRASGITTEFQLYCTAI
PSAA_PYRYE      TGIKPSAQVVWPIVGQEILN--GDVGGGFQ--GVQVTSGWFQLWRASGITTEFQLYCTAI
PSAA_GRATL      TAIKPSAQIVWPIVGQEILN--GDVGGGFQ--GVQITSGFFQIWRASGITTEFELYATAI
PSAA_CYAM1      TGIKPSAQVVWPIVGQQILN--ADVGGGMQ--GIQITSGLFQLWRASGIVNELQLYVTAL
PSAA_CYACA      SLIKPSAQIVWPIVGQEILN--ADLGGGSQ--GIQITSGFFHLWRASGITNELELYVTAL
PSAA_CYAPA      TTIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGLFQMWRASGITTELQLYVTAI
PSAA_EUGGR      IHVKPSAQIVWPIVGQEILN--GDVGGNFQ--GIQITSGLFQLWRSCGITSEFQLYITAL
PSAA_BIGNA      AKIKPSAQVVWPIVGQDILN--GDVGDGFR--GVQITSGLFHVWRASGITNELELFSTAI
PSAA_CHLRE      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITSELQLYTTAI
PSAA_TETOB      VHIKPSAQVVWPVVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITSELQLYTTAI
PSAA_STIHE      THIKPSAQIVWPIVGQEILN--GDVGGGFQ--GVQITSGFFQLWRASGITSELQLYTTAV
PSAA_OLTVI      THIKPSAQVVWPVVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITSELQLYATAI
PSAA_CHLVU      THIKPSAQVVWPIVGQEILN--ADVGGGFQ--GLQITSGFFQLWRASGITSELQLYTTAI
PSAA_TUPAK      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITTELQLYSTAI
PSAA_NEPOL      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITSELQLYSTAI
PSAA_OSTTA      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GVQITSGFFQLWRGSGITSELQLYSTAI
PSAA_MESVI      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GVQITSGFFQLWRASGIVNEQQLYTTAI
PSAA_CHLAT      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITSELQLYSTAI
PSAA_STAPU      VNIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGLFEMWRGSGITTELQLYSTAI
PSAA_ZYGCR      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQIWRAAGVTSELQLYATAI
PSAA_CHAGL      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GVQITSGFFQIWRASGITSELQLYSTAI
PSAA_ANGEV      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITNELQLYCTAI
PSAA_PSINU      IHIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_ANTAG      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQIWRASGITSELQLYSTAI
PSAA_PHYPA      THIKPSAQVVWPIVGQKILN--GDVGGGFQ--GIQITSGFFQLWRASGITSELQLYTTAI
PSAA_MARPO      THIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQLWRASGITSELQLYSTAI
PSAA_PINKO      THIKPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_PINTH      THIKPSAQIVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_GOSBA      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_GOSHI      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_HELAN      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_LACSA      THIRPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_SPIOL      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_NICSY      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_TOBAC      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_NICTO      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_ATRBE      THIGPSAQVVWPIVGQEILN--GDVRGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_SOLBU      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_SOLLC      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_SOLTU      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_JASNU      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_DAUCA      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_PANGI      THIGPSAQVVWPVVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_BARVE      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_CAPBU      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_OLIPU      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_CRUWA      THIGPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQIWRASGITSELQLYCTGI
PSAA_ARATH      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_NASOF      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_LEPVR      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_AETCO      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_LOBMA      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_ARAHI      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_DRANE      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_AETGR      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_POPAL      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_POPTR      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_EUCGG      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_CITSI      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_OENEH      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_CUCSA      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQMWRASGITNELQLYCTAI
PSAA_LOTJA      THIRPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_SOYBN      THIRPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_PHAVU      THIRPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITNELQLYCTAI
PSAA_PELHO      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_MORIN      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITNELQLYCTAI
PSAA_VITVI      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQMWRASGITNELQLYCTAI
PSAA_COFAR      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITNELQLYCTAI
PSAA_CALFG      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITNELQLYCTAI
PSAA_LIRTU      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_AMBTC      THIAPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_DRIGR      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_AGRST      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_WHEAT      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_HORVU      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITSELQLYCTAI
PSAA_ORYNI      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_ORYSA      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_ORYSI      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_ORYSJ      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_SACHY      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_SACOF      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_SORBI      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_MAIZE      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_PHAAO      THIAPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_ACOCL      THIRPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_NANDO      THIRPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_PLAOC      THIRPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_PIPCE      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQLWRASGITNELQLYCTAI
PSAA_NYMAL      THIGPSAQVVWPIVGQEILN--GDVGGGFR--GIQITSGFFQIWRASGITSELQLYCTAI
PSAA_HUPLU      THVKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQIWRASGITSELQLYSTAI
PSAA_ADICA      THVKPSAQVVWPIVGQEILN--GDVGGGFQ--GVQITSGFFQLWRASGITSELQLYCTAV
PSAA_CHAVU      IHIKPSAQVVWPIVGQEILN--GDVGGGFQ--GIQITSGFFQIWRASGITSELQLYTTAI
PSAA_HETTR      K--TPGSQLVWSLVGQDILN--QDLGGYFQ--SIRVTSGFFQLWRAEGIVTQVHLKYAAA
PSAA_AMPCA      S-IAPTAQQVSNIANQSVLN------------PIRVTSGFFNLWLAEGITSTYQLKVIAA
                      :* *  : .* ::*             :  :** * :* . * .   .*   . 

PSAA_PROM1      GALLMAAIMLHGGIYHYHKA-APKLDWFRNLESMLNHHIAGLVGLGSIAWAGHCIHIGAP
PSAA_PROMT      GALLMAAIMLHGGIYHYHKA-APKLDWFRNLESMLNHHIAGLVGLGSIAWAGHCIHIGAP
PSAA_PROMA      GGVIMAALMLHGGIYHYHKA-APKLEWFRKIEPMLQHHQIALIGLGSIAWAGHLIHIGAP
PSAA_PROM0      GAVVMAALMLHAGIFHYHKA-APKMEWFQDIESMLNHHIAGLVGLGSLAWAGHCIHIGAP
PSAA_PROMS      GAVVMAALMLHAGIFHYHKA-APKMEWFQDIESMLNHHIAGLVGLGSLAWAGHCIHIGAP
PSAA_PROMP      GAVVMAALMLHAGIFHYHKA-APKMEWFQNIESMLNHHIAGLVGLGSLAWAGHCIHIGAP
PSAA_PROM9      GAVIMAALMLHGGIYHYHKA-APKLEWFQNIESMLNHHIAGLVGLGSLAWAGHCIHIGAP
PSAA_PROM5      GAVVMAALMLHAGIFHYHKA-APKMEWFQDVESMMNHHLAGLLGLGSLAWAGHTIHIGAP
PSAA_PROM3      GALIMAGLVLHGGIFHYHKA-APKLEWFKKIESMLQHHQIGLFGLGSLGWTGHLIHVANP
PSAA_PROMM      GALIMAALVLHGGIFHYHKA-APKLEWFKKIESMLQHHQIGLFGLGSLGWTGHLIHVANP
PSAA_SYNS9      GALVMAGLMLNAGVFHYHKS-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHLIHVSLP
PSAA_SYNPX      GALVMAGLMLNAGVFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHLIHVSAP
PSAA_SYNSC      GALVMAGLMLNAGVFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHVIHVSAP
PSAA_SYNS3      GALVMAGLMLNAGVFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWTGHLLHVSLP
PSAA_SYNJA      GGLVMAGLCLFAGWFHYHKR-APKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVAIP
PSAA_SYNJB      GGLVMAGLCLFAGWFHYHKR-APKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVAIP
PSAA_GLOVI      AMLIIAALFLFAGWFHYHKR-APKLEWFQNVESMLNHHLAGLFGLGSLFWTGHLIHVALP
PSAA_SYNE7      GALVMAGLMLFAGWFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_SYNP6      GALVMAGLMLFAGWFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_NOSS1      GGLVLAGLFLFAGWFHYHKR-APKLEWFQNVESMLNHHLQVLLGCGSLGWAGHLIHVSAP
PSAA_TRIV2      GGLVLAGLFLFAGWFHYHKR-APKLEWFQNVESMLNHHLQVLLGCGSLGWAGHLIHVSAP
PSAA_TRIEI      GGLVMAALMMFAGWFHYHKK-APKLEWFQNVESMMNHHLAGLLGLGCLSWAGHQIHVSLP
PSAA_SYNY3      GGLVMAALMLFAGWFHYHVK-APKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMP
PSAA_THEEB      GGLVMAGLMLFAGWFHYHKR-APKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVSLP
PSAA_TRICV      GGLIMSALMLFAGWFHYHKA-APKLEWFQNAESMMNHHLAGLLGLGCLSWSGHQIHIALP
PSAA_THAPS      GGLAMSAIMLFAGWFHYHKA-APKLEWFQNAESMMNHHLAGLLGLGCLSWSGHQIHIALP
PSAA_PHATC      GGLAMSAIMLFAGWFHYHKA-APKLEWFQNAESMMNHHLAGLLGLGCLSWSGHQIHVALP
PSAA_EMIHU      GGLMMSALMVFAGWFHYHKA-APKLEWFQNVESMMNHHLAGLLGLGCLSWSGHQIHISLP
PSAA_GUITH      AGLLMSGLMIFAGWFHYHKA-APKLEWFQNAESMLNHHLSGLLGLGCLSWAGHQIHVGLP
PSAA_PORPU      GGLGMAALMLFAGWFHYHKA-APKLEWFQNVESMMNHHLAGLLGLGCLGWAGHQIHLSLP
PSAA_PYRYE      GGLAMAALMLFAGWFHYHKA-APKLEWFQNVESMMNHHLAGLLGLGCLGWTGHQIHLSLP
PSAA_GRATL      GGLFMACLMLFAGWFHYHKA-APKLEWFQNVESMMNHHLAGLLGLGCLGWAGHQIHISIP
PSAA_CYAM1      GGLGMAGLMIFAGWFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_CYACA      GGLFMAGLMAFGGWFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_CYAPA      GALVMAALMLFAGWFHYHKA-APKLEWFQNAESMMNHHLAGLFGLGSLSWAGHQIHVSLP
PSAA_EUGGR      TGLIFSAVLFFAGWFHYHKA-APKLEWFQNVESMLNHHLSGLLGLGCLSWAGHQIHVSLP
PSAA_BIGNA      GGLVMAFLMFFAGWFHYHKA-APKLQWFQNAESMLNHHLSGLLGLGSLSWAGHQIHIAIP
PSAA_CHLRE      GGLVMAAAMFFAGWFHYHKA-APKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLP
PSAA_TETOB      GGLVMAAAMFFAGWFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_STIHE      VGLVLAGAMFFAGWFHYHKA-APKLEWFQNVESMLNHHLGGLLGLGSLGWAGHQIHVSLP
PSAA_OLTVI      GGLVMAAAMFFAGWFHYHKA-APKLEWFQNVESMMNHHLAGLLGLGSLAWAGHQIHISLP
PSAA_CHLVU      GGLVMAAAMFFAGWFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLAWAGHQIHVSLP
PSAA_TUPAK      GGLVMAAAMFFAGWFHFHKS-APKLEWFQNVESMLNHHLSGLLGLGSLAWAGHQIHVSLP
PSAA_NEPOL      GGLLLAAAMFFAGWFHYHKA-APKLEWFQNVESMMNHHLGGLLGLGSLGWAGHQIHVSLP
PSAA_OSTTA      GALICAGLMFFAGWWHYHKA-APKLEWFQNVESMMNHHLAGLLGLGSLAWAGHQIHIALP
PSAA_MESVI      GGLIAAGLMFFAGWFHYHKA-APKLEWFQNAESMMNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_CHLAT      GGLVMAGLMLFAGWFHYHKA-APKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_STAPU      GGLVMAALMLFAGWFHYHKA-APKLAWFQNVESMLNHHLAGLLGLGSLGWAGHQVHVSLP
PSAA_ZYGCR      GGLVMATLMLIAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_CHAGL      GGLVLATLTLIGGWYHYHKA-APTLAWFQDVESMLNHHLAGLIGLGSLSWAGHQIHVSLP
PSAA_ANGEV      GALIFAGLMLFAGWFHYHKA-APKLARFQDVESMLNHHLAGLLGLGSLGWAGHQVHVSLP
PSAA_PSINU      GALIFATLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLAWAGHQVHVSLP
PSAA_ANTAG      GGLIFAALMLFAGWFHYHKA-APKLVWFQDVESMLNHHLAGLLGLGSLAWAGHQVHVSLP
PSAA_PHYPA      GGLIFAALMLFAGWFHYHKA-APKLAWFQNVESMLNHHLAGLLGLGSLAWAGHQVHVSLP
PSAA_MARPO      GGLVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_PINKO      GALIFAALMLFAGWFHYHKA-APELAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_PINTH      GALIFAALMLFAGWFHYHKA-APKLAWFQEVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_GOSBA      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_GOSHI      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_HELAN      GALIFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_LACSA      GGLVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_SPIOL      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_NICSY      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_TOBAC      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_NICTO      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_ATRBE      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_SOLBU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_SOLLC      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_SOLTU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_JASNU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_DAUCA      GALIFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_PANGI      GALIFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_BARVE      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_CAPBU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_OLIPU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_CRUWA      GALVCAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_ARATH      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_NASOF      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_LEPVR      GALVFSALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_AETCO      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_LOBMA      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_ARAHI      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_DRANE      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_AETGR      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_POPAL      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_POPTR      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_EUCGG      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_CITSI      GALIFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_OENEH      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_CUCSA      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_LOTJA      GGLVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_SOYBN      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLTGLLGLGSLSWAGHQIHVSLP
PSAA_PHAVU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLTGLLGLGSLSWAGHQIHVSLP
PSAA_PELHO      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_MORIN      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_VITVI      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_COFAR      GALIFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_CALFG      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_LIRTU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_AMBTC      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_DRIGR      GALVFAGLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_AGRST      GALIFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_WHEAT      GALIFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_HORVU      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_ORYNI      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_ORYSA      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_ORYSI      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_ORYSJ      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_SACHY      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_SACOF      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_SORBI      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_MAIZE      GALIFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_PHAAO      GALVFASLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_ACOCL      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLP
PSAA_NANDO      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_PLAOC      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_PIPCE      GALVFAGLMLFAGWFHYHKA-APKLSWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_NYMAL      GALVFAALMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_HUPLU      GGLIFAALMLFAGWFHYHKA-APKLTWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLP
PSAA_ADICA      GALVFAGLMFFAGWFHYHKA-APKLAWFQNVESMLNHHLAGLLGLGSLGWAGHQIHVSLP
PSAA_CHAVU      GGLVMAGLMLFAGWFHYHKA-APKLAWFQDVESMLNHHLAGLLGLGSLAWAGHQIHVSMP
PSAA_HETTR      AALIGSIATLWAAYFHMHISWSSSLRTMGSLSSYNAGQLAILAGLGSISWAGHQIHIALP
PSAA_AMPCA      FGLIASALCFLGSYFHMHSSTSFTRVLNTKLTSLSTHHLVGLLGLGSLAWAGHLIHISLP
                  :  :     .. :* *   :       .  .    :   * * *.: *:** :*:. *

PSAA_PROM1      TAALMDAIDAGKPLIIDGIPIASIADMP-LPHELCNPAIASQIFP----GLAGRTVENFF
PSAA_PROMT      TAALMDAIDAGKPLIIDGIPIASIADMP-LPHELCNPAIASQIFP----GLAGRTVENFF
PSAA_PROMA      VAALLDAIDAGNPLVVDGVSIASAADVTNLAPRLCDPAVASQIFP----SLAGRTVENFF
PSAA_PROM0      TAALLDAIDAGSPLVINGKEIATIADMP-MPHQLCDPQIIGQIFP----GLASGT-GNFF
PSAA_PROMS      TAALLDAIDAGSPLVINGKEIATIADMP-MPHQLCDPQIIGQIFP----GLASGT-GNFF
PSAA_PROMP      TAALLDAIDAGTPLVINGKEIATIADMP-MPHQLCDPQIIAQIFP----GLASGT-GNFF
PSAA_PROM9      TAALLDAIDAGSPLVINGQKIATIADMP-MPHQLCDPQIIGQIFP----GLASGV-GNFF
PSAA_PROM5      TAALLDAIDAGSPLIINGKEIATIADIP-MPHQLCDPQIVGQIFP----GLASGT-GNFF
PSAA_PROM3      TNALLDAIDAGTPMVLDGKTIATAADIP-LPHELYNADLVGQIYP----GLASGI-GNFF
PSAA_PROMM      TNALLDAIDAGTPMVLDGKTIATAADIP-LPHELYNADLVGQIYP----GLASGV-GNFF
PSAA_SYNS9      VTKLMDAIDAGEPLVLNGTTIASAADIP-LPHEFFNQDLLAQLYP----GIGSGI-SAFF
PSAA_SYNPX      VSKLMDAIDAGQPLVLDGKTIATVADIP-LPHEFFNQDLLAQLYP----GIGAGI-GAFF
PSAA_SYNSC      VTKLMDAIDAGQPLVLNGKTIASAADIP-LPHEFFNQDLLAQLYP----GFSAGV-GAFF
PSAA_SYNS3      TTKLMDAIDAGQPLVLNGKTIASVADIP-LPHEFFNQDLIAQLYP----GFGAGI-GAFF
PSAA_SYNJA      INKMLDAGVP-------------AAQIPLPHEFILKPALMKEMFPSVDWGLFSGV-VPFF
PSAA_SYNJB      INKMLDAGVP-------------ADQVPLPHEFILKPALMKEMFPSVDWGIFSGV-VPFF
PSAA_GLOVI      VKAQLDAGIA-------------PAQVNPFAG--LDYGLMGQYFPK-GFGPNGGL-GAFF
PSAA_SYNE7      VNKLLDAIDAGEPLVLNGKTIASAADIPLPHEF-LDVSLISQLFP----GFEAGV-KAFF
PSAA_SYNP6      VNKLLDAIDAGEPLVLNGKTIASAADIPLPHEF-LDVSLISQLFP----GFEAGV-KAFF
PSAA_NOSS1      INKLMDAGVA-------------VKDIPLPHEFILNKSLLIDLFP----GFAAGL-TPFF
PSAA_TRIV2      INKLLDAGVA-------------VKDIPLPHEFILNKSVLIDLFP----GFAAGL-TPFF
PSAA_TRIEI      INKLLDSGVA-------------PEDIPLPHEFLFNKSLMAELYP----SFAKGL-TPFF
PSAA_SYNY3      INKLLDAGVA-------------PKDIPLPHEFILEPSKMAELYP----SFAQGL-TPFF
PSAA_THEEB      INKLLDAGVA-------------AKDIPLPHEFILNPSLMAELYPKVDWGFFSGV-IPFF
PSAA_TRICV      INKLLDAGVA-------------PQEIPLPHEFLINRELMAQLYP----SFNKGL-APFF
PSAA_THAPS      INKLLDAGVS-------------PQEIPLPHEFLINRDLMAQLYP----SFSKGL-APFF
PSAA_PHATC      INKLLDAGVA-------------PQEIPLPHEFLINRELMSQLYP----SFSKGL-APFF
PSAA_EMIHU      INKLLDAGVA-------------PQEIPLPHELLFNQDLMAQLYP----SFKKGL-LPFF
PSAA_GUITH      INKLLDAGVA-------------PQEIPLPHEFLMNRDLMAQLYP----SFNKGL-IPFF
PSAA_PORPU      INKLLDSGVS-------------PQEIPLPHEFLINRELMAQLYP----SFSKGL-VPFF
PSAA_PYRYE      INKLLDSGVS-------------PQEIPLPHEFLINRELMAQLYP----SFSKGL-VPFF
PSAA_GRATL      INKLLDSGVS-------------PQELPLPHEFLVNRELVSQLYP----SFSKGI-IPFF
PSAA_CYAM1      INKLLDAGVA-------------PSSIPLPHEFILNRNLMAELYP----SFQQGL-VPFF
PSAA_CYACA      INKLLDAGVD-------------PKTIPLPHEFILNRELMSQLYP----SFEKGL-WPFF
PSAA_CYAPA      VNKLLDSGVS-------------PQEIPLPHEFILNKDLIAQLYP----SFGQGL-TPFF
PSAA_EUGGR      INKLLDSGVN-------------PAELPLPHDFILDKSLISQLYP----SFSKGL-APFF
PSAA_BIGNA      INKLLDKGVS-------------ASEIPLPHEFLVDKTQMINIFP----SFEKGL-TPFF
PSAA_CHLRE      VNKLLDAGVD-------------PKEIPLPHDLLLNRAIMADLYP----SFAKGI-APFF
PSAA_TETOB      VNKLLDAGVD-------------PKEIPLPHEFLLNRQIMQDLYP----SFAKGL-APFF
PSAA_STIHE      VNKLLDAGVD-------------PKEIPLPHEFFLNKQLMIDLYP----SFAKGL-TPFF
PSAA_OLTVI      INKLLDAGVD-------------PKEIPLPHELMLNRELMAQLYP----SFAKGL-APFF
PSAA_CHLVU      INKLLDAGVD-------------PKEIPLPHEFLFNPELMAQLYP----SFAKGL-APFF
PSAA_TUPAK      INKLLDAGVD-------------PHEIPLPHELILNPSLMAQLYP----SFKQGL-APFF
PSAA_NEPOL      VNKLLNAGVD-------------PKEIPLPHEFLLNRDLMAQLYP----SFAKGL-TPFF
PSAA_OSTTA      VNTLLDAGVD-------------PKEIPLPHEFMLNRALMAELYP----SFAKGL-TPFF
PSAA_MESVI      VNQLLDAGVD-------------PKEIPLPHEFVMNRELMAQLYP----SFAKGL-APFF
PSAA_CHLAT      INKLLDAGVD-------------PKEIPLPHEFLVNRDLTAQLFP----SFAKGL-TPFF
PSAA_STAPU      INQLLDAGVD-------------AKEIPLPHEFILNRDLLAQLYP----SFAKGL-TPFF
PSAA_ZYGCR      INQLLDAGVD-------------PKEIPLPHEFLLNRDLLAQLYP----SFSKGL-TPFF
PSAA_CHAGL      INQLLDAGVD-------------PKEIPLPHEFILNRELLAQLYP----SFSKGL-TPFF
PSAA_ANGEV      INQLLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAKGL-TPFF
PSAA_PSINU      INQLLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAKGL-IPFF
PSAA_ANTAG      INELLDAGID-------------PKEIPLPHEFILNRDLLAQLFP----SFAKGL-TPFF
PSAA_PHYPA      INRLLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFSKGL-TPFF
PSAA_MARPO      INQLLDAGVD-------------PKEIPLPHEFILNRDLLAELYP----SFAKGL-TPFF
PSAA_PINKO      INQLLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAKGL-TPFF
PSAA_PINTH      INQLLDAGVD-------------PKEIPLPHEFIFNRDLLAQLYP----SFAKGV-TPFL
PSAA_GOSBA      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_GOSHI      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_HELAN      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_LACSA      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SPIOL      INQFLNAGVD-------------PKEIPLPHELILNRDLLAQLYP----SFAEGA-TPFF
PSAA_NICSY      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_TOBAC      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_NICTO      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_ATRBE      INQFLNAGVD-------------PKEIPLPHEYILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SOLBU      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SOLLC      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SOLTU      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_JASNU      INQFLNAGVD-------------PKEIPLPHEFILNRELLAQLYP----SFAEGA-TPFF
PSAA_DAUCA      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_PANGI      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_BARVE      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_CAPBU      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_OLIPU      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_CRUWA      INQFLNAGVD-------------PKEIPLPHEYILNRDLLAQLYP----SFAEGA-TPFF
PSAA_ARATH      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_NASOF      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_LEPVR      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_AETCO      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_LOBMA      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFSEGA-TPFF
PSAA_ARAHI      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_DRANE      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_AETGR      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_POPAL      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_POPTR      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_EUCGG      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_CITSI      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFSEGA-TPFF
PSAA_OENEH      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_CUCSA      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_LOTJA      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SOYBN      INQFLNAAVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_PHAVU      INQFLNAAVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_PELHO      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFSEGA-TPLF
PSAA_MORIN      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_VITVI      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_COFAR      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_CALFG      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_LIRTU      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_AMBTC      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGS-TPFF
PSAA_DRIGR      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_AGRST      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_WHEAT      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_HORVU      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_ORYNI      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_ORYSA      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_ORYSI      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_ORYSJ      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SACHY      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SACOF      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_SORBI      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_MAIZE      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_PHAAO      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_ACOCL      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_NANDO      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_PLAOC      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_PIPCE      INQFLDAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPLF
PSAA_NYMAL      INQFLNAGVD-------------PKEIPLPHEFILNRDLLAQLYP----SFAEGA-TPFF
PSAA_HUPLU      INQLLDAGVD-------------AKEIPLPHEFILNRDLMTQLYP----SFAKGL-TPFF
PSAA_ADICA      INQLLDAGVD-------------PEEIPLPHELILNRDLLAQTYP----SFAKGL-IPFF
PSAA_CHAVU      INELLDAGVD-------------PKEIPLPHEFILNRDLIAELYP----SFKSGL-IPFF
PSAA_HETTR      INRLLDSGVD-------------PSQLPSPQD-LLFKDLMQVIFP----GFGVGP-AVDF
PSAA_AMPCA      VNILMNAGVA----------------VPSPHSLLSSKAVATIVEQ--------------L
                    ::                    :                                :

PSAA_PROM1      TTNWWAFSDFLTFKGGLNPVTGSLWMTDISHHHLAFGVLAVLGGHLYRT-MFGIGHSLKE
PSAA_PROMT      TTNWWAFSDFLTFKGGLNPVTGSLWMTDISHHHLAFGVLAVLGGHLYRT-MFGIGHSLKE
PSAA_PROMA      TLNWWAFTDILTNKGGLNPVTGSLWMTDISHHHLAFGVFAIFGGHMWRNNVHGVGHSMKE
PSAA_PROM0      SLNWLAFSDFLTFKGGLNPVTGSLWMTDVSHHHLAFGVIAIIGGHMYRT-NYGIGHSMKE
PSAA_PROMS      SLNWLAFSDFLTFKGGLNPVTGSLWMTDVSHHHLAFGVIAIIGGHMYRT-NYGIGHSMKE
PSAA_PROMP      SLNWLAFSDFLTFKGGLNPVTGSLWMTDVSHHHLAFGVIAIIGGHMYRT-NYGIGHSMKE
PSAA_PROM9      SLNWFAFSDFLTFKGGLNPVTGSLWMTDIAHHHLAFGVIAIIGGHLYRT-NYGIGSSMKE
PSAA_PROM5      SLNWFAFSDFLTFKGGLNPVTGSLWMTDIAHHHLAIAVLFIIAGHMYRT-NYGIGHSMKE
PSAA_PROM3      SANWWAFSDFLTNNGGVNPVTGALWSTDVAHHHLAWAVFLMFGGHVYRS-RFGIGHSMKE
PSAA_PROMM      SANWWAFSDFLTNNGGVNPVTGALWSTDVAHHHLAWAVFLMFGGHVYRS-RFGIGHSMKE
PSAA_SYNS9      SGNWAAYGDFLTFKGGLNPVTGSLWMTDIAHHHVAIAVLFIVAGHMYRT-NWGIGHSIKE
PSAA_SYNPX      SGNWAAYSDFLTFKGGLNPVTGSLWMTDIAHHHVAIAVLFIVAGHMYRT-NWGIGHSIKE
PSAA_SYNSC      SGNWAAYSDFLTFKGGLNPVTGSLWMTDIAHHHVAIAVMFIVAGHMYRT-NWGIGHSIKE
PSAA_SYNS3      SGDWAAYSDFLTFKGGINPVTGSMWMSDIAHHHLAIAVLFIVAGHMYRT-NWGIGHSIKE
PSAA_SYNJA      TLDWGKYAEFLTFKGGLDPQTGALWLTDQAHHHLAIAVLFIVAGHMYRT-NWGIGHSIKE
PSAA_SYNJB      TLDWGKYAEFLTFKGGLDPQNGALWLTDQAHHHLAIAVLFIVAGHMYRT-NWGIGHSIKE
PSAA_GLOVI      TLNWGQFTDFLTFKGGLEPATGALYLTDIAHHHLAIATLFIIAGHMYRT-NWGIGHSIKE
PSAA_SYNE7      TLNWSAYADFLTFKGGLNPVTGGLWLTDTAHHHLAIAVLFIVAGHMYRT-NWGIGHSLKE
PSAA_SYNP6      TLNWSAYADFLTFKGGLNPVTGGLWLTDTAHHHLAIAVLFIVAGHMYRT-NWGIGHSLKE
PSAA_NOSS1      TLNWGQYADFLTFKGGLNPVTGGLWMTDIAHHHLAIAVVFIIAGHQYRT-NWGIGHSIKE
PSAA_TRIV2      TLNWGQYADFLTFKGGLNPVTGGLWLTDISHHHLAIAVLFIIAGHQYRT-NWGIGHSIKE
PSAA_TRIEI      TLNWGEYADFLTFKGGLNPVTGGLWLSDTAHHHLALAVLFIVAGHMYRT-NWGIGHSMKE
PSAA_SYNY3      TLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRT-NWGIGHSMKE
PSAA_THEEB      TFNWAAYSDFLTFNGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRT-NWGIGHSLKE
PSAA_TRICV      SGQWGEYSDFLTFKGGLNPVTGGLWLSDIAHHHLALSVLFIFAGHMYRT-NWGIGHSMKE
PSAA_THAPS      GGNWGEYSDFLTFKGGLNPVTGGLWLSDIAHHHLALSVLFIIAGHMYRT-NWGIGHNMKE
PSAA_PHATC      SGHWGEYSDFLTFKGGLNPVTGGLWLSDIAHHHLALAVLFIFAGHMYRT-NWGIGHSMKE
PSAA_EMIHU      TLNWGEYSDFLTFKGGLNPITGSLWLSDTAHHHLALAVLFIFAGHMYRT-NWGIGHSMKE
PSAA_GUITH      SLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHLALAVLFIVAGHMYRT-NWGIGHSMKE
PSAA_PORPU      TLNWAEYSDFLTFKGGLNPVTGGLWLSDTAHHHLALAVLFLAAGHMYRT-NWGIGHSMKE
PSAA_PYRYE      TLNWAEYSDFLTFKGGLNPVTGGLWLSDTAHHHLALAVLFLAAGHMYRT-NWGIGHSMKE
PSAA_GRATL      TLNWNEYSDFLTFKGGLNPITGGLWLTDTAHHHLALAVLFLVAGHMYRT-NWGIGHSMKE
PSAA_CYAM1      TLNWKQYSDILTFKGGLSPVTGGLWLTDVAHHHLAIAVLFLVAGHMYRT-NWGIGHSIKQ
PSAA_CYACA      SLNWGAYSDFLTFRGGLNPITGSLWMSDIAHHHLAISVLFIVAGHMYRT-NWGIGHSIKE
PSAA_CYAPA      TLNWNEYSDFLTFKGGLNPVTGGLWLSDRAHHHLAIAVLFIVAGHMYRT-NWGIGHSMKE
PSAA_EUGGR      TFHWSEYSDFLTFRGGLNNVTGGLWLTDVAHHHLALAVLFILAGHMYKT-NWKIGHDIKG
PSAA_BIGNA      TLNWKEYSDFLTFQGGLDPQTGSLWLTDIAHHHLAIAVLFIVAGHMYKT-NWSIGHRLKE
PSAA_CHLRE      TLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRT-NWGIGHSMKE
PSAA_TETOB      TLQWGEYSDFLTFNGGLNPVTGGLWLSDTAHHHLAIAVLFLVAGHMYRT-NWGIGHSMRE
PSAA_STIHE      TLQWSEYSDFLTFKGGLNEVTGGLNLSDTAHHHLAIAVLFLIAGHMYRT-NWGIGHSIKE
PSAA_OLTVI      TLNWGEYSDFLTFQGGLNPVTGGLWLSDEAHHHLAIAVLFLIAGHQYRT-NWGIGHSMKE
PSAA_CHLVU      TLDWAQYSDFLTFQGGLNPVTGGLWLTDTVHHHLAIAVLFLVAGHQYRT-NWGIGSSLKE
PSAA_TUPAK      TLNWSEYSDFLTFQGGLNPVTGGLWLTDTAHHHLAIAVLFIVAGHMYRT-NWGIGHSMKE
PSAA_NEPOL      TLNWAEYGDFLTFRGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRT-NWGIGHSMKE
PSAA_OSTTA      TFNWTEYSDFLTFRGGLNPVTGGLWLTDMAHHHLAIAVLFLVAGHQYRT-NWGIGHSMKE
PSAA_MESVI      TLNWGEYSDFLTFRGGLNPVTGGLWLTDTVHHHVAIAVLFIVAGHMYRT-NWGIGHSMKE
PSAA_CHLAT      TLNWAEYSDFLTFKGGLNPVTGGLWLTDTAHHHLAIAVLFLVAGHMYRT-NWGIGHSIKE
PSAA_STAPU      TLNWAEYSDFLTFRGGLNPVTGGLWLTDTIHHHLAIAVLFIVAGHMYRT-NWGIGHSMKE
PSAA_ZYGCR      SLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFIVAGHMYRT-NWGIGHSLRE
PSAA_CHAGL      TLNWSEYSDFLTFRGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHQYRT-NWGIGHSLRE
PSAA_ANGEV      TSNWSEYADFLTFRGGLNPVTGGLWLTDTAHHHLAIGVLFLVAGHMYRT-NWGIGHSIKE
PSAA_PSINU      TLNWSEYSDFLTFRGGLNPVTGGLWLTDTVHHHLAIAVLFLVAGHMYRT-NWSIGHSIKE
PSAA_ANTAG      TLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVVFLVAGHMYRT-NWGIGHSIKE
PSAA_PHYPA      TLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFLVAGHMYRT-NFGIGHSMKE
PSAA_MARPO      TLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFLVAGHMYRT-NWGIGHSFKE
PSAA_PINKO      TLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFLIAGHMYKT-NWRIGHNLKD
PSAA_PINTH      TLNWSEYSDFLTFRGGLNPVTGGLWLTDTAHHHLAIAVLFLIAGHMYKT-NWRIGHNLKD
PSAA_GOSBA      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYKT-NWGIGHSLND
PSAA_GOSHI      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYKT-NWGIGHSLKD
PSAA_HELAN      TLNWSKYADFLTFRGGLDPVTGGLWLTDTAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_LACSA      TLNWSKYADFLTFRGGLDPVTGGLWLTDTAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_SPIOL      TLNWSKYADFLTFRGGLDPVTGGLWLTDTAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_NICSY      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_TOBAC      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_NICTO      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_ATRBE      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_SOLBU      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_SOLLC      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_SOLTU      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_JASNU      TLNWSKYAEFLSFHGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_DAUCA      TLDWSKYSDFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYKT-NWGIGHGLKD
PSAA_PANGI      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYKT-NWGIGHGLKD
PSAA_BARVE      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_CAPBU      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_OLIPU      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_CRUWA      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_ARATH      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_NASOF      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_LEPVR      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_AETCO      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_LOBMA      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_ARAHI      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLLAGHMYRT-NWGIGHGLKD
PSAA_DRANE      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_AETGR      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_POPAL      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLVAGHMYRT-NWGIGHGIKD
PSAA_POPTR      TLNWSKYSEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLVAGHMYRT-NWGIGHGIKD
PSAA_EUCGG      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_CITSI      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_OENEH      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_CUCSA      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_LOTJA      TLNWAKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGIKD
PSAA_SOYBN      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIIHHHLAIAILFLIAGHMYRT-NWGIGHSIKD
PSAA_PHAVU      TLNWSKYGEFLTFRGGLDPVTGGLWLTDIIHHHLAIAILFLIAGHMYRT-NWGIGHSIKD
PSAA_PELHO      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHDLKE
PSAA_MORIN      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLVAGHMYRT-NWGIGHGIKD
PSAA_VITVI      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_COFAR      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_CALFG      TLNWSKYADFLSFRGGLDPVTGGLWLTDIAHHHLAIAILFLVAGHMYKT-NWGIGHSLKD
PSAA_LIRTU      TLNWSKYAEFLSFRGGLNPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_AMBTC      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAIIFLIAGHMYRT-NWGIGHGLKE
PSAA_DRIGR      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_AGRST      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_WHEAT      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_HORVU      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_ORYNI      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_ORYSA      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_ORYSI      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_ORYSJ      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_SACHY      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_SACOF      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_SORBI      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_MAIZE      TLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_PHAAO      TLNWAKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWAIGHGLKD
PSAA_ACOCL      TLNWSKYAEFLTFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_NANDO      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYRT-NWGIGHGLKD
PSAA_PLAOC      TLNWSKYADFLTFRGGLDPVTGGLWLTDIAHHHLAIAVLFLIAGHMYRT-NWAIGHGLKD
PSAA_PIPCE      TLNWSKYAEFLTFRGGLDPTTGGLWLTDIVHHHLAIAILFLIAGHMYRT-NWGIGHSLKD
PSAA_NYMAL      TLNWSKYAEFLTFRGGLDPVTGGLWLTDIAHHHLAIAILFLIAGHMYKT-NWGIGHDLKD
PSAA_HUPLU      TLNWSEYSDFSTFRGGLNPVTGGLWLTDTVHHHLAIAVLFLIAGHMYRT-NWGIGHSLKE
PSAA_ADICA      TLNWSEYSDFLTFRGGLNPITGGLWLTDTAHHHLAIAVLFLVAGHMYRT-NWGIGHSTKE
PSAA_CHAVU      TLNWSAYSDFLTFRGGLNPVTGGLWLSDTAHHHLAIAVLFLIAGHMYRT-NWGIGHNMKD
PSAA_HETTR      SIYLNQKG--AASEVGLNPSTGSIYLGQIASHHFFVGITCIISGIIALLVKRSKAGSFQD
PSAA_AMPCA      SFSALTSSDGYVWQP----------LVYSAMHHFALALVLIVGSVLGPL----------S
                             .                 **.  .   : ..                

PSAA_PROM1      ILDNHAGDPILFPAPNGHKGIYEFLANSWHAQLGLNLAMIGSLSIIISHHMYAMPPYPYL
PSAA_PROMT      ILDNHAGDPILFPAPNGHKGIYEFLANSWHAQLGLNLAMIGSLSIIISHHMYAMPPYPYL
PSAA_PROMA      IMDVHKGDPILFPAPKGHQGIFEFLSNSWHGQLSINLAMVGSASIVVAHHMYALPPYPYI
PSAA_PROM0      ILDSQQGDPILFPAPKGHQGLFEFMAESRHAQLAVNLAMLGSISILVSHHMYAMPPYPYI
PSAA_PROMS      ILDSQQGDPILFPAPKGHQGLFEFMAESRHAQLSVNLAMLGSISILVSHHMYAMPPYPYI
PSAA_PROMP      ILDSQQGDPILFPAPKGHQGLFEFMAESRHAQLSVNLAMLGSLSILISHHMYAMPPYPYI
PSAA_PROM9      ILEAHQGDPILFPAPKGHQGLFEFMAESRHAQLSVNLACLGSLSILISHHMYAMPPYPYI
PSAA_PROM5      ILDAHQGDPILFPAPRGHQGLFDFMAESRHAQLSVNLALLGSLSIIISHHMYAMPPYPYI
PSAA_PROM3      IMGNVKGDPLLFPAPNGHKGLFEFLSNSWHAQLAVNLACIGSGSIVVAHHMYSLPPYPYL
PSAA_PROMM      IMGNVKGDPLLFPAPNGHKGLFEFLSNSWHAQLAVNLACIGSGSIVVAHHMYSLPPYPYL
PSAA_SYNS9      IHEGQKGDPLLFPAPNGHDGLYEFMTTSWHAQLAVNLAMLGSLSIIVAQHMYAMPPYAYM
PSAA_SYNPX      IHEGQKGDPLLFPAPNGHDGLYEFLTTSWHAQLGLNLAMLGSLSIIVAQHMYAMPPYAYM
PSAA_SYNSC      IHEGQKGDPLLFPATNGHDGLYDFMTNSWHAQLAVNLAIGGSVSIIVAQHMYAMPPYPYQ
PSAA_SYNS3      ILEGQKGDPLLFPATKGHDGLFEFMTTSWHAQLGVNLAMLGSLSIIVAQHMYAMPPYPYM
PSAA_SYNJA      ILEAHKGPFT----GEGHKGLYEVLTSSWHAQLAINLAMVGSLSIIVAQHMYAMNPYPYM
PSAA_SYNJB      ILEAHKGPFT----GEGHKGLYEVLTTSWHAQLAINLAMVGSLSIIVAQHMYAMNPYPYM
PSAA_GLOVI      MLEAHKGPLT----GEGHRGLYEVLTTSWHAQLAINLAMAGSITIIVAHHMYAMNPYPYM
PSAA_SYNE7      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSINLAILGSISIIVAHHMYAMPPYPYL
PSAA_SYNP6      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSINLAILGSISIIVAHHMYAMPPYPYL
PSAA_NOSS1      ILENHKGPFT----GEGHKGLYENLTTSWHAQLATNLAFLGSLTIIIAHHMYAMPPYPYL
PSAA_TRIV2      ILENHKGPFT----GEGHKGLYENLTTSWHAQLATNLAFLGSLTIIIAHHMYAMPPYPYL
PSAA_TRIEI      ILEAHKDPLIIG--GEGHKGLYEALTTSWHAQLAINLAMLGSLSIIVAHHMYAMPPYPYI
PSAA_SYNY3      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQ
PSAA_THEEB      ILEAHKGPFT----GAGHKGLYEVLTTSWHAQLAINLAMMGSLSIIVAQHMYAMPPYPYL
PSAA_TRICV      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYI
PSAA_THAPS      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYL
PSAA_PHATC      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYI
PSAA_EMIHU      ILEAHKGPLT----GEGHKGLYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYI
PSAA_GUITH      ILEAHKGPFT----GEGHKGLYEILITSWHSQLAINLAMMGSLSIIVAHHMYAMPAYPFI
PSAA_PORPU      ILEAHKGPFT----GNGHEGLYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYI
PSAA_PYRYE      ILEAHKGPFT----GNGHEGLYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYI
PSAA_GRATL      ILEAHKGPFT----GEGHKGIYEILTTSWHAQLAINLAMMGSLSIIVAHHMYAMPPYPYI
PSAA_CYAM1      ILEAHKGPLT----GEGHKGLYEILTTSWHANLAINLAMLGSLSIIVAHHMYAMPPYPYL
PSAA_CYACA      ILDAHRGPLT----GSGHRGLYEALTTSWHANLAINLALFGSLSIIVAHHMYAMPPYPYI
PSAA_CYAPA      MLETHKGPFT----GEGHKGLYEIFTNSWHAQLSLNLALFGSLSIIVAHHMYSMPPYPYL
PSAA_EUGGR      LLESHTGPFT----GQGHKGLYEIFTNSWHAQLSLNLAMMGSLSIIVAQHMYSMPPYPYI
PSAA_BIGNA      ILEGHKVLSV----SKGHSGLYEIFTTSWHAQLSLNLAMLGSLSIIVAHHMYAMPPYPYI
PSAA_CHLRE      ILEAHRGPFT----GEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYL
PSAA_TETOB      ILDAHKGPFT----GEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYSMPPYPYL
PSAA_STIHE      ILDAHKGPLT----GEGHKGLYEILTTSWHAQLAINLALFGSLSIVVAHHMYSMPPYPYL
PSAA_OLTVI      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLAMLGSLSIIVAHHMYAMPPYPYL
PSAA_CHLVU      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLALFGSLSIIVSHHMYAMPPYPYL
PSAA_TUPAK      ILDAHKGPFT----GEGHKGLYEILTTSWHAQLAINLALFGSLSIIVAHHQYSMPPYPYL
PSAA_NEPOL      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLALFGSLSIVVAHHMYAMPPYPYL
PSAA_OSTTA      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLALMGSLSIIVSHHMYSMPPYPYL
PSAA_MESVI      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLGLNLALMGSLSIIVAHHMYAMPPYPYL
PSAA_CHLAT      ILEAHKGPFT----GAGHRGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYL
PSAA_STAPU      ILEAHKGPLT----GEGHKGLYEIFTTSWHAQLALNLALMGSLSIIVAHHMYSMPPYPYL
PSAA_ZYGCR      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLATLGSLTIIVAHHMYSMPPYPYL
PSAA_CHAGL      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLALNLALFGSLTIIVAHHMYAMPPYPYL
PSAA_ANGEV      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLALNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_PSINU      ILEAHEGPFT----GEGHKGIFEILTTSWHAQLALNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_ANTAG      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLALNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_PHYPA      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLAMLGSLTIIVAHHMYAMPPYPYL
PSAA_MARPO      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLALNLAMLGSLTIIVAHHMYAMPPYPYL
PSAA_PINKO      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLAINLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_PINTH      LLEAHKGPFT----GEGHKGLYEILTTSWHAQLAVNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_GOSBA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_GOSHI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_HELAN      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYAMPPYPYL
PSAA_LACSA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYAMPPYPYL
PSAA_SPIOL      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLALNLAMLGSLTIVVAHHMYAMPPYPYL
PSAA_NICSY      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_TOBAC      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_NICTO      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_ATRBE      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_SOLBU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_SOLLC      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_SOLTU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_JASNU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_DAUCA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_PANGI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_BARVE      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_CAPBU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_OLIPU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_CRUWA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_ARATH      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_NASOF      ILEAHKGPFT----GQGHKGLYEILTTLWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_LEPVR      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_AETCO      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_LOBMA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_ARAHI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_DRANE      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYAMPPYPYL
PSAA_AETGR      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_POPAL      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYAMPPYPYL
PSAA_POPTR      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYAMPPYPYL
PSAA_EUCGG      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_CITSI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_OENEH      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_CUCSA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSINLAMLGSLTIIVAHHMYAMPPYPYL
PSAA_LOTJA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSINLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_SOYBN      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_PHAVU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_PELHO      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_MORIN      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_VITVI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_COFAR      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_CALFG      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSSTIVVAHHMYSMPPYPYL
PSAA_LIRTU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSSTIVVAHHMYSMPPYPYL
PSAA_AMBTC      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLALNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_DRIGR      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_AGRST      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYAMPPYPYL
PSAA_WHEAT      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_HORVU      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_ORYNI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_ORYSA      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_ORYSI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_ORYSJ      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_SACHY      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_SACOF      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_SORBI      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_MAIZE      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYL
PSAA_PHAAO      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_ACOCL      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLALNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_NANDO      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLALNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_PLAOC      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_PIPCE      ILEAHKGPFT----GQGHKGLYEILTTSWHAQLSLNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_NYMAL      ILEAHKGPFT----GEGHKGLYEILTTSWHAQLALNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_HUPLU      ILEAHKGPFT----GEGHKGLYEIFTTSWHAQLALNLAMLGSLTIVVAHHMYSMPPYPYL
PSAA_ADICA      ILEAHKGPFT----GEGHKGIYEILTSSWHAQLAINLATLGSLTIIVSHHMYAMPPYPYL
PSAA_CHAVU      ILEAHKGPFT----GEGHKGLYEIFTTSWHAQLSLNLAMLGSLTIIVAHHMYSMPPYPYL
PSAA_HETTR      AAA---------------------FNNSWHSRLSINLAIAGSLSITFAHHIYAMPVYPFC
PSAA_AMPCA      TASNPLMSFT--------------VGSSWHLVLGVQLFVTGTASVLYAQMSNAYPVYPYL
                                        .    *  *. :*   *: ::  ::   :   *.: 

PSAA_PROM1      SIDYPTVLGLFTHHMWIGGLFIVGAAAHAGIAMIRDYDPAVHI----------DNVLDRI
PSAA_PROMT      SIDYPTVLGLFTHHMWIGGLFIVGAAAHAGIAMIRDYDPAVHI----------DNVLDRI
PSAA_PROMA      AIDYPTVLGLFTHHMWIGGLFICGAAAHAGIAMIRDYDPAVHI----------DNVLDRI
PSAA_PROM0      ATDYMTVLGLFTHHMWIGGLFIVGAGAHAGIAMVRDYDPAKHI----------DNVLDRI
PSAA_PROMS      ATDYMTVLGLFTHHMWIGGLFIVGAGAHAGIAMVRDYDPAKHI----------DNVLDRI
PSAA_PROMP      ATDYMTVLGLFTHHMWIGGLFIVGAGAHAGIAMVRDYDPAKHI----------DNVLDRI
PSAA_PROM9      ATDYMTVLGLFTHHMWIGALFIVGAGAHAGIAMVRDYDPAKHI----------DNVLDRI
PSAA_PROM5      ATDYMTVLGLFTHHMWIGGLFIVGAGAHAGIAMVRDYDPAKHI----------DNVLDRV
PSAA_PROM3      ATDYPTVLGLFTHHMWIGGLMICGAAAHAGIAVIRDYDVSVHV----------DNVLDRM
PSAA_PROMM      ATDYPTVLGLFTHHMWIGGLMICGAAAHAGIAVIRDYDVSVHV----------DNVLDRM
PSAA_SYNS9      AVDYPTQIGLFTHHIWIGGFLIVGGAAHAAIAMVRDYDPAKHI----------DNVLDRV
PSAA_SYNPX      AVDYPTQIGLFTHHMWIGGFLIVGGAAHAAIAMVRDYDPAKHI----------DNVLDRV
PSAA_SYNSC      AIDYPTQIGLFTHHIWIGGFLIVGAGAHAAIAMVRDYDPAKHI----------DNVLDRV
PSAA_SYNS3      AIDYPTQIGLFTHHMWIGGFLIVGAAAHAAIAMIRDYDPAKHV----------DNVLDRV
PSAA_SYNJA      GIDYATQISLFTHHMWIGGIFIVGGAAHGAIYMVRDYDPAVNR----------NNVLDRV
PSAA_SYNJB      GIDYATQISLFTHHMWIGGFFVVGGAAHGAIYMVRDYDPAVNR----------NNVLDRV
PSAA_GLOVI      GTDYATQISLFTHHMWIGGFLIVGAGAHAAIFMVRDYDPVTNQ----------NNLLDRV
PSAA_SYNE7      ATDYPTMLSLFTHHIWIGGFLIVGAGAHAAIFMVRDYDPAKNV----------DNLLDRV
PSAA_SYNP6      ATDYPTMLSLFTHHIWIGGFLIVGAGAHAAIFMVRDYDPAKNV----------DNLLDRV
PSAA_NOSS1      ATDYATQLCIFTHHIWIGGFLIVGGAAHAAIFMVRDYDPVVNQ----------NNVLDRV
PSAA_TRIV2      ATDYATQLCIFTHHIWIGGFLIVGGAAHAAIFMVRDYDPVVNQ----------NNVLDRV
PSAA_TRIEI      ATDYPTQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNV----------NNVLDRV
PSAA_SYNY3      AIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNV----------NNLLDRM
PSAA_THEEB      ATDYPTQLSLFTHHMWIGGFLVVGGAAHGAIFMVRDYDPAMNQ----------NNVLDRV
PSAA_TRICV      ATDYATQLSLFTHHMWIGGFCVVGGAAHGAIFMVRDYTPANNY----------NNLLDRV
PSAA_THAPS      ATDYATQLSLFTHHMWIGGFCVVGGAAHGAIFMVRDYTPANNY----------NNLLDRV
PSAA_PHATC      ATDYATQLSLFTHHMWIGGFCVTGGAAHAAIFMVRDYTPANNY----------NNLLDRV
PSAA_EMIHU      AVDYPTQLSLFTHHMWIGGFCVCGAAAHGAIFMVRDYSPVQSY----------NNLLDRV
PSAA_GUITH      ATDYPTQLSIFTHHMWIGGFCICGAAAHAGIFMVRDYNPAQNY----------NNLLDRV
PSAA_PORPU      ATDYPTQLSLFTHHMWIGGFCVVGAGAHASIFMVRDYNPAENY----------NNLLDRI
PSAA_PYRYE      ATDYPTQLSLFTHHMWIGGFCIVGAGAHASIFMVRDYNPAENY----------NNLRSSS
PSAA_GRATL      ATDYPTQLSLFTHHMWIGGFCIVGAGAHASIFMVRDYNPAQNY----------NNVLDRV
PSAA_CYAM1      ATDYPTQLSLFTHHMWIGGFCIVGAGAHAAIYMVRDYSPTVNF----------NNVLDRM
PSAA_CYACA      SIDYPTQLSLFTHHTWIGGFCIVGASAHGAIFMIRDYVPSQHY----------NNVLDRL
PSAA_CYAPA      ATDYATSLCLFTHHVWIGGFLIVGAGAHAAIFMVRDYDPAQNY----------NNLLDRV
PSAA_EUGGR      AIDYGTELSLFTHHYWIGGFCIVGAAAHAAIFMVRDYDPALNF----------NNLLDRV
PSAA_BIGNA      SVDYATQLSLFTHHMWIGGFCIVGAGAHASIFMVRDYNPADNY----------NNLLDRI
PSAA_CHLRE      ATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNY----------NNLLDRV
PSAA_TETOB      ATDYGTQLSLFTHHNWIGGFCIVGAGAHAAIFMVRDYDPTNNY----------NNLLDRV
PSAA_STIHE      ATDYATQLSLFTHHCWIGGFCIVGAGAHAAIFMVRDYDPTNNY----------NNLLDRV
PSAA_OLTVI      ATDYGTQLSLFTHHVWIGGFCIVGAGAHAAIFMVRDYDPTNNY----------NNLLDRV
PSAA_CHLVU      ATDYGTQLSLFTHHMWIGGFCIVGAGAHAGIFMVRDYDPTNNY----------NNLLDRV
PSAA_TUPAK      ATDYATQLSLFTHHNWIGGFCIVGAAAHAAIFMIRDYDPTNNY----------NNLLDRV
PSAA_NEPOL      ATDYGTQLSLFTHHMWIGGFCVVGAAAHAAIFMVRDYDPTNNY----------NNLLDRV
PSAA_OSTTA      ATDYGTQLSLFTHHMWIGGFCICGAAAHAAIFMVRDYDPATNY----------NNVLDRV
PSAA_MESVI      ATDYGTQLSLFTHHMWIGGFCIVGGAAHAAIFMVRDYDPTNNY----------NNLLDRV
PSAA_CHLAT      ATDYGTQLSIFTHHTWIGGFCIVGGAAHAAIFMVRDYDPTNNY----------NNLLDRV
PSAA_STAPU      ATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIYLVRDYDPTTQY----------NNLLDRV
PSAA_ZYGCR      ATDYGTQLSLFTHHMWIGGFCVVGAGAHAAIFLVRDYDPTTQY----------NNLLDRV
PSAA_CHAGL      ATDYGTQLSLFTHHMWIGGFLVTGAAAHAAIFLVRDYDPTTQY----------NNLLDRV
PSAA_ANGEV      ATDYGTQLSLFTHHMWIGGFLVVGAAAHAAIFMVRDYDPTTQY----------NNLLDRV
PSAA_PSINU      AIDYGTQLSLFTHHMWIGGFLVVGAAAHAAIFMVRDYDPTTQY----------NNLLDRV
PSAA_ANTAG      AIDYSTQLSLFTHHMWIGGFTIVGAAAHAAIFMVRDYDPTSQY----------NNLLDRV
PSAA_PHYPA      ATDYATQLSLFTHHMWIGGFLVVGAAAHAAIFMVRDYDPTTQY----------NNLLDRV
PSAA_MARPO      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTQY----------NNLLDRV
PSAA_PINKO      AIDYGTQLSLFTHHMWIGGFIIVGAAAHAAIFMVRDYDPTTQY----------NNLLDRV
PSAA_PINTH      ATDYGTQLSLFTHHMWIGGFIIVGAAAHAAIFMVRDYDPTTQY----------NNLLDRV
PSAA_GOSBA      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_GOSHI      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_HELAN      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_LACSA      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SPIOL      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_NICSY      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_TOBAC      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_NICTO      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_ATRBE      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SOLBU      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SOLLC      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SOLTU      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_JASNU      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_DAUCA      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_PANGI      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_BARVE      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_CAPBU      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_OLIPU      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_CRUWA      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_ARATH      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_NASOF      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_LEPVR      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_AETCO      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_LOBMA      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_ARAHI      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_DRANE      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_AETGR      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTNRY----------NDLLDRV
PSAA_POPAL      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_POPTR      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_EUCGG      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_CITSI      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_OENEH      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_CUCSA      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_LOTJA      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SOYBN      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTIRY----------NDLLDRV
PSAA_PHAVU      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTIRY----------NDLLDRV
PSAA_PELHO      ATDYGTQLSLFTHHMWIGAFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_MORIN      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_VITVI      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_COFAR      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_CALFG      AIDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_LIRTU      AIDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_AMBTC      AIDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_DRIGR      AIDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_AGRST      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_WHEAT      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_HORVU      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_ORYNI      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_ORYSA      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_ORYSI      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_ORYSJ      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SACHY      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SACOF      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_SORBI      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_MAIZE      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_PHAAO      AIDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_ACOCL      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_NANDO      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_PLAOC      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_PIPCE      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_NYMAL      ATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRY----------NDLLDRV
PSAA_HUPLU      ATDYGTQLSLFTHHMWIGGFLVVGAAAHAAIFMVRDYDPTTQY----------NNLLDRV
PSAA_ADICA      ATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFVVRDYDPTTQY----------NNLLDRV
PSAA_CHAVU      AIDYGTQLSLFTHHMWIGGFCIVGAAAHAAIFMVRDYDSANQY----------NNLLDRV
PSAA_HETTR      GSDYATVLSLFVHHMWIGGFFIVGAGAHASIFMIRDEGVPAGIPSAKGRLYSVNSIIQQL
PSAA_AMPCA      LTDHPTVVSLFVHHMWIGGFFLVGAFAHLSIGLVRDTLPQSFS---------------VV
                  *: * : :*.** ***.: : *. ** .* ::**                        

PSAA_PROM1      LKARDALISHLNWACMFLGFHSFGLYIHNDVMRALGRPADMFSDTGIQLQPVFAQWIQNI
PSAA_PROMT      LKARDALISHLNWACMFLGFHSFGLYIHNDVMRALGRPADMFSDTGIQLQPVFAQWIQNI
PSAA_PROMA      LKARDAIISHLNWVCMWLGFHSFGLYIHNDVMRALGRPKDMFSDTGIQLQPFLAQWVQNL
PSAA_PROM0      LKARDALISHLNWVCMWLGFHSFGLYIHNDTMRALGRPQDMFSDSAIQLQPIFAQWVQSI
PSAA_PROMS      LKARDALISHLNWVCMWLGFHSFGLYIHNDTMRALGRPQDMFSDSAIQLQPIFAQWVQSI
PSAA_PROMP      LKARDALISHLNWVCMWLGFHSFGLYIHNDTMRALGRPQDMFSDSAIQLQPIFAQWVQSI
PSAA_PROM9      LKARDALISHLNWVCMWLGFHSFGLYIHNDTMRALGRPQDMFSDNAIQLQPIFAQWVQSI
PSAA_PROM5      LKARDALISHLNWVCMWLGFHSFGLYIHNDTMRALGRPQDMFSDKAIQLQPIFAQWIQNI
PSAA_PROM3      FKARDAIISHLNWVCMFLGFHSFGLYIHNDSMRALGRSQDMFSDSAIQLQPVLAQWIQSL
PSAA_PROMM      FKARDAIISHLNWVCMFLGFHSFGLYIHNDSMRALGRSQDMFSDSAIQLQPVLAQWIQSL
PSAA_SYNS9      LKARDAIISHLNWVCIWLGAHSFGLYIHNDTMRALGRPQDMFSDQAISIQPIFAQWIQNA
PSAA_SYNPX      LKARDAIISHLNWVCIWLGAHSFGLYIHNDTMRALGRPQDMFSDSAISIQPIFAQWIQNA
PSAA_SYNSC      LKARDAIISHLNWVCIWLGAHSFGLYIHNDTMRALGRPQDMFSDSAISIQPIFAQWIQNV
PSAA_SYNS3      LKARDAIISHLNWVCIWLGAHSFGLYVHNDTMRALGRPQDMFSDSAISIQPVFAQWIQGI
PSAA_SYNJA      IRHRDAIISHLNWVCLFLGFHAFGFYVHNDTMQALGRPQDMFSDTGIQLQPIFAQWIQSL
PSAA_SYNJB      LRHRDAIISHLNWVCLFLGFHAFGFYVHNDTMQALGRPQDMFSDTGIQLQPIFAQWIQSL
PSAA_GLOVI      LRHRDAIISHLNWVTLFLGFHSFGLYVHNDTMQALGRPRDMFADFAIPLQPVFAQWIQNI
PSAA_SYNE7      LRHRDAIISHLNWVCIWLGFHSFGLYIHNDTMRALGRPQDMFSDSAIQLQPIFAQWIQNI
PSAA_SYNP6      LRHRDAIISHLNWVCIWLGFHSFGLYIHNDTMRALGRPQDMFSDSAIQLQPIFAQWIQNI
PSAA_NOSS1      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPVFAQWVQNL
PSAA_TRIV2      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPVFAQWVQNL
PSAA_TRIEI      IRHRDAIISHLNWVCIFLGFHSFGLYVHNDTLRALGRPQDMFSDTGIQLQPIFAQWVQNL
PSAA_SYNY3      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHL
PSAA_THEEB      LRHRDAIISHLNWVCIFLGFHSFGLYVHNDTMRAFGRPQDMFSDTGIQLQPVFAQWVQNL
PSAA_TRICV      LRHRDAIISHLNWVCIFLGCHSFGLYIHNDTMRALGRPQDMFSDKAIQLQPIFAQWVQNI
PSAA_THAPS      LRHRDAIISHLNWVCIFLGCHAFGFYIHNDTMRALGRPQDMFSDKAIQLQPIFAQWIQNI
PSAA_PHATC      LRHRDSIIAHLNWVCIFLGCHAFGFYIHNDTMRALGRPQDMFSDKAIQLQPIFAQWIQNI
PSAA_EMIHU      LRHRDAIISHLNWVCIFLGTHSFGLYIHNDTMRALGRPQDMFSDKAIQLQPIFAKWVQSL
PSAA_GUITH      IRHRDAIISHLNWICIFLGFHSFGLYIHNDTMRALGRTQDMFSDTAIQLKPVFAQWVQNI
PSAA_PORPU      IRHRDAIVSHLNWVCIFLGFHSFGLYIHNDTMRALGRSQDMFSDTAIQLQPIFAQWVQSI
PSAA_PYRYE      -RHRDAIVSHLNWVCIFLGFHSFGLYIHNDTMRALGRSQDMFSDTAIQLQPIFAQWVQSI
PSAA_GRATL      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRSQDMFSDTAIQLQPIFAQWIQNI
PSAA_CYAM1      IRHRDAIISHLNWVCIFLGMHSFGLYIHNDTMRALGRAQDMFSDTAIQLQPVFAQWIQQI
PSAA_CYACA      IRHRDALISHLNWVCIFLGTHSFGLYIHNDTMRALGRSQDMFSDTAIQLQPIFAQWIQSL
PSAA_CYAPA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDAAIQLQPVFAQWVQGV
PSAA_EUGGR      LLHRDAIISHLNWVCIFLGLHSFGLYIHNDTLSALGRPQDMFSDSAIQLQPVFAQWIQNT
PSAA_BIGNA      ICQRDAIISHLNWACIFLGLHSFGLYIHNDTMSALGRSDDMFSDTAIQLQPIFSQFIQRI
PSAA_CHLRE      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_TETOB      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQKT
PSAA_STIHE      LRHRDAIISHLNWVSIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWVQNT
PSAA_OLTVI      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWVQNT
PSAA_CHLVU      LRHRDAMISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWVQNT
PSAA_TUPAK      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPADMFSDTAIQLQPVFAQWIQKT
PSAA_NEPOL      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIHKT
PSAA_OSTTA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQFVQHT
PSAA_MESVI      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQFVQNR
PSAA_CHLAT      IRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_STAPU      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWVQNT
PSAA_ZYGCR      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_CHAGL      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_ANGEV      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_PSINU      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNT
PSAA_ANTAG      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPEDMFSDTAIQLQPIFAQWVQNT
PSAA_PHYPA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_MARPO      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_PINKO      LRHRDAIVSHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_PINTH      LRHRDAIVSHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_GOSBA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_GOSHI      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_HELAN      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_LACSA      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_SPIOL      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_NICSY      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_TOBAC      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_NICTO      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_ATRBE      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_SOLBU      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_SOLLC      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_SOLTU      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_JASNU      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_DAUCA      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_PANGI      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_BARVE      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_CAPBU      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_OLIPU      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_CRUWA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_ARATH      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_NASOF      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_LEPVR      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_AETCO      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_LOBMA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_ARAHI      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_DRANE      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_AETGR      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQKT
PSAA_POPAL      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_POPTR      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_EUCGG      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_CITSI      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_OENEH      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_CUCSA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_LOTJA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_SOYBN      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_PHAVU      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_PELHO      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_MORIN      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_VITVI      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_COFAR      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_CALFG      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNT
PSAA_LIRTU      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNT
PSAA_AMBTC      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_DRIGR      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNT
PSAA_AGRST      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNI
PSAA_WHEAT      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNI
PSAA_HORVU      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNI
PSAA_ORYNI      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNL
PSAA_ORYSA      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNL
PSAA_ORYSI      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNL
PSAA_ORYSJ      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNL
PSAA_SACHY      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNI
PSAA_SACOF      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNI
PSAA_SORBI      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNI
PSAA_MAIZE      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDAAIQLQPIFAQWIQNI
PSAA_PHAAO      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNT
PSAA_ACOCL      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNT
PSAA_NANDO      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNT
PSAA_PLAOC      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWVQNT
PSAA_PIPCE      LRHRDAIISHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_NYMAL      LRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_HUPLU      LRHRDAIVSHLNWACIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWVQNT
PSAA_ADICA      IRHRDTIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_CHAVU      IRHRDAIISHLNWACIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWIQNT
PSAA_HETTR      LAHRDIIMGHLIYVTIALGMHAFGIYIHNDTLQALGRPEDIFSDNSIQLKPLFAVWVQSL
PSAA_AMPCA      LTQRDIILGHLTWVVAFLGVHSFGLYVHNDTMQALGRPDDMFSDNAISLLPVFARWSTLT
                   ** ::.** :    ** *:**:*:*** : *:**. *:*:* .* : *.:: :    

PSAA_PROM1      HNSAAGSTTLAGANVNLQPGLVSEVFNGS-VSQVG------------GKIGIAPIPLGTA
PSAA_PROMT      HNSAAGSTTLAGANVSLQPGLVSEVFNGS-VSQVG------------GKIGIAPIPLGTA
PSAA_PROMA      QQSAVGTGDLVGAG-NLPGSVLSEVFNGN-VVEVG------------GKVAIAPIPLGTA
PSAA_PROM0      QASAVGTSLLAGTAEALPHKALSEVFNGS-LVEVG------------GKVAIAPIPLGTA
PSAA_PROMS      QASAVGTFLLAGTSEALPHKALSEVFNGS-LVEVG------------GKVAIAPIPLGTA
PSAA_PROMP      QASAVGTSILAGTAEALPHKAISEVFNGS-LVEVG------------GKVAIAPIPLGTA
PSAA_PROM9      QASAVGTSILAGTPEGLPQKALSEVFNGS-LVEVG------------GKVAISPIQLGTA
PSAA_PROM5      QSSGVGTTLLEG-------NGVSQVFNGE-TISVG------------GKVAMTGIPLGTA
PSAA_PROM3      WASSIGTSSVVGTTTGLP-GAVSDVFNGG-VVAVG------------GKVALMAIPLGTA
PSAA_PROMM      WASSIGTSAVVGTTTGLP-GAVSDVFNGS-VVAVG------------GKVALMAIPLGTA
PSAA_SYNS9      HAAAAGSTAPNALA------GVSEVFNGS-VVAVG------------GKVAAAPMPLGTA
PSAA_SYNPX      HAAAAGSTAPNALA------GVSEVFNGS-VVAVG------------GKVAAAPMPLGTA
PSAA_SYNSC      HAAAAGSTAPNALA------GVSEVFNGS-VVAVG------------GKVAAAPMPLGTA
PSAA_SYNS3      HAGAAGSTAPNALA------GVSEVFNGS-TIAVG------------GKVAAAAIPLGTA
PSAA_SYNJA      HTKAIA-STAPYVG------ASVSPIFGGDVVAVG------------GKVSMMPMVLGTA
PSAA_SYNJB      HTSAIA-STAPYVG------ASVSPIFGGDVVAVG------------GKVSMMPMVLGTA
PSAA_GLOVI      HAAAPGGATAPWVG------GTSPTWYTGALSSAATLQANQVLALANDKISISPIHLGTA
PSAA_SYNE7      HALAPGNTAPNALA------SVSQVFGGD-VVAVG------------GKVAAAPIVLGTA
PSAA_SYNP6      HALAPGNTAPNALA------SVSQVFGGD-VVAVG------------GKVAAAPIVLGTA
PSAA_NOSS1      HTLAPGGTAPNALE------PVSYAFGGG-VLAVG------------GKVAMMPIALGTA
PSAA_TRIV2      HTLAPGGTAPNALE------PVSYAFGGG-VLAVG------------GKVAMMPIALGTA
PSAA_TRIEI      HSLAPGNTAPNALA------SVSPIFGGD-VLAVG------------GKVAMMPMTLGTA
PSAA_SYNY3      HTLAPGATAPNALA------TASYAFGGE-TIAVA------------GKVAMMPITLGTA
PSAA_THEEB      HTLAPGGTAPNAAA------TASVAFGGD-VVAVG------------GKVAMMPIVLGTA
PSAA_TRICV      HLLAPGTTAPNALA------TTSYAFGGD-VVEVG------------GKIAMMPIKLGTA
PSAA_THAPS      HLLAPGTTAPNALA------TTSYAFGGD-VIEVG------------GKIAMMPIKLGTA
PSAA_PHATC      HLLAPGTTAPNALA------TTSYAFGGE-VVEVG------------GKIAMMPIQLGTA
PSAA_EMIHU      HTLAPGNTAPNSLA------TASYAFGGD-VVAVN------------GKIAMMPIQLGTA
PSAA_GUITH      HTIAPGNTTPNALA------TASYAFGGD-VISVG------------NKVAMMPISLGTA
PSAA_PORPU      HTLAPGNTAPNALA------TASYAFGGE-VVSVG------------NKVAMMPISLGTA
PSAA_PYRYE      HTLAPGNTAPNALA------TASYAFGGD-IVSVG------------NKVAMMPISLGTA
PSAA_GRATL      HSLAPSNTSPNALA------TASYAFGGD-VIAVN------------NKIAMMPINLGTA
PSAA_CYAM1      HTLAPGNTAVNALA------TASYAFGAD-TVTVG------------SKIAMMPIKLGTA
PSAA_CYACA      HTLAPANTAPNALA------TTSYVFGGE-VVAVA------------NKIAMMPMKLGTA
PSAA_CYAPA      NSAAAGNTAPNALR------NASYAFGGD-IVSVG------------EKVAMMPISLGTA
PSAA_EUGGR      HYLAPTLTAFNLVS------PTTPVWGGD-VVSIS------------GKVAMMPIKLGTA
PSAA_BIGNA      HYMTIESTAPYVSH------GTSPAWGGD-IVAIN------------GKIAMMPISLGTS
PSAA_CHLRE      HFLAPQLTAPNALA------ATSLTWGGD-LVAVG------------GKVAMMPISLGTS
PSAA_TETOB      HFLAPQLTAPTALS------ATSATWGGD-VVAVG------------GKVAMMPISLGTS
PSAA_STIHE      HFMAPQLTAPNALA------ATSATWGGD-VVAVG------------GKVAMMPISLGTA
PSAA_OLTVI      HFLAPQLTAPNALA------ATSVSWGGD-VVAVG------------GKVAMMPIALGTS
PSAA_CHLVU      HFLAPGFTAPNALA------STSPSWGGD-VVAVG------------GKVAMMPISLGTA
PSAA_TUPAK      HFLAPGFTAPNALA------STSPSWGGD-VVAVG------------GKVAMMPISLGTS
PSAA_NEPOL      HALAPGLTAPNALA------STSPSWGGD-VVAVG------------GKVAMMPISLGTA
PSAA_OSTTA      HALAPELTAPTAAG------STSASWGGD-IVAVG------------GKIAMMPISLGTS
PSAA_MESVI      NYLAPGFSAPNALA------SSSAVWGGD-VVAVG------------GKVAMMPIQLGTS
PSAA_CHLAT      HYLAPNLTAPNALA------PTSATWGGD-VVAVG------------GKVAMMPISLGTA
PSAA_STAPU      HAAAPGFSAPNAAA------ATSITWGGSELVAVG------------GKVAMSPIPLGTA
PSAA_ZYGCR      HAAAPGFTAPNAAA------ATSLTWGGSDLVAVG------------GKVAMMPIPLGTA
PSAA_CHAGL      HTLAPTLTAPNAAS------STSITWGGN-LVAVG------------GKVALLPIPLGTA
PSAA_ANGEV      HAFAPSLTAPNATA------STSLTWGGGDLIAVG------------GKVALLPIPLGTA
PSAA_PSINU      HASAPGLTAPNAIA------STSLTWGGDNLIAVG------------GKVALLPIPLGTA
PSAA_ANTAG      HVLAPNLTAPNATA------STSLTWGGGDLVAVG------------GKVALLPISLGTA
PSAA_PHYPA      HALAPSLTAPNATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_MARPO      HALAPNFTAPNALA------STSLTWGGGDVIAVG------------SKVALLPIPLGTA
PSAA_PINKO      HASAPGSTAPGATA------STSLTWGGGDLVTVG------------SKVALLPIPLGTA
PSAA_PINTH      HASAPGSTAPGATA------STSLTWGGGDLVTVG------------SKVALLPIPLGTA
PSAA_GOSBA      HTLAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_GOSHI      HTLAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_HELAN      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_LACSA      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_SPIOL      HALAPSATAPGATA------STSLTWGGSDLVAVG------------GKVALLPIPLGTA
PSAA_NICSY      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_TOBAC      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_NICTO      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_ATRBE      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_SOLBU      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_SOLLC      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_SOLTU      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_JASNU      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_DAUCA      HALAPSATAPGATT------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_PANGI      HALAPGATAPGATT------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_BARVE      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_CAPBU      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_OLIPU      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_CRUWA      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_ARATH      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_NASOF      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_LEPVR      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_AETCO      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_LOBMA      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_ARAHI      HALAPGVTAPGETA------STSLTWGGGELVTVG------------GKVALLPIPLGTA
PSAA_DRANE      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_AETGR      HALAPGVTAPGETA------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_POPAL      HALAPRATAPGATA------STSLTWGGDDLVAVG------------GKVALLPIPLGTA
PSAA_POPTR      HALAPGATAPGATA------STSLTWGGDDLVAVG------------GKVALLPIPLGTA
PSAA_EUCGG      HALAPAATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_CITSI      HALAPGGTAPGATA------STSLTWGGVDLVAVG------------GKVALLPIPLGTA
PSAA_OENEH      HALAPGATAPGATT------STSLAWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_CUCSA      HALAPRITAPGATT------GTSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_LOTJA      HALAPGITAPGATT------GTSLTWGGGDLVAVG------------NKVALLPIPLGTA
PSAA_SOYBN      HALAPGTTAPGATT------STSLTWGGDNLVAVG------------GKVALLPIPLGTA
PSAA_PHAVU      HALAPGTTAPGAAT------STSLTWGGENLVAVG------------GKVALLPIPLGTA
PSAA_PELHO      HALAPGSTAPGATT------GTSLTWGGVDLVAVG------------GKVALLPIPLGTA
PSAA_MORIN      HALAPGATAPGATT------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_VITVI      HALAPSATAPGATT------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_COFAR      HALAPGATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_CALFG      HALAPSATAPGATA------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_LIRTU      HALAPGATAPGATT------STSLTWGGSDLVAVG------------GKVALLPIPLGTA
PSAA_AMBTC      HALAPGATAPGATT------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_DRIGR      HALAPGATAPGATT------STSLTWGGGDLIAVG------------GKVALLPIPLGTA
PSAA_AGRST      HATAPGVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_WHEAT      HATAPGVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_HORVU      HATAPGVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_ORYNI      HAGAPSVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_ORYSA      HAGAPSVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_ORYSI      HAGAPSVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_ORYSJ      HAGAPSVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_SACHY      HAGAPGVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_SACOF      HAGAPGVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_SORBI      HAGAPGVTAPGATT------STSLTWGGGELVAVG------------GKVALLPIPLGTA
PSAA_MAIZE      HAGAPGVTAPGATT------STSLTWGGGELVAIG------------GKVALLPIPLGTA
PSAA_PHAAO      HALAPNVTAPGATT------STSLIWGGGELVAVG------------GKVALLPIPLGTA
PSAA_ACOCL      HALAPVATAPGATT------GTSLAWGGGELVAVG------------GKVALLPIPLGTA
PSAA_NANDO      HALAPSATAPGATT------STSLTWGGGGLVAVG------------GKVALLPIPLGTA
PSAA_PLAOC      HALAPGATAPGATT------STSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_PIPCE      HALAPSATAPGAIA------STSLTWGGADLVAVG------------GKVALLPIPLGTA
PSAA_NYMAL      HALAPSATAPGATA------GTSLTWGGGDLVAVG------------GKVALLPIPLGTA
PSAA_HUPLU      HAVAPFSTAPNAAA------STSLTWGGIDLVAVG------------GKVALLPIPLGTA
PSAA_ADICA      HALAPGSTAPNATA------GTSLAWGGSDLVAVA------------GKVALAPIPLGTA
PSAA_CHAVU      HVLAPSLTAPQATS------ATSPVWGEG-LITVG------------GKVAMMPIPLGTA
PSAA_HETTR      PSLFLLNTLSGDAA------VTGIPGFGLEVLD--------------GKVVTMTQELGTA
PSAA_AMPCA      ------------------------------LNSTG------------SAVSVLGVELSTA
                                                                 :      *.*:

PSAA_PROM1      DFMIHHIHAFTIHVTLLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROMT      DFMIHHIHAFTIHVTLLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROMA      DLMIHHVHAFTIHVTLLILLKGVLYARSSRLIPDKAQLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROM0      DLMIHHIHAFQIHVTVLILLKGVLYARSSRLIPDKASLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROMS      DLMIHHIHAFQIHVTVLILLKGVLYARSSRLIPDKASLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROMP      DLMIHHIHAFQIHVTVLILLKGVLYARSSRLIPDKASLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROM9      DLMIHHIHAFQIHVTVLILLKGVLYARSSRLIPDKASLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROM5      DLMIHHIHAFQIHVTVLILLKGVLYARSSRLIPDKASLGFRFPCDGPGRGGTCQVSSWDH
PSAA_PROM3      DLMIHHIHAFTIHVTCLILLKGVLFARSSRLVPDKANLGFRFSCDGPGRGGTCQVSSWDH
PSAA_PROMM      DLMIHHIHAFTIHVTCLILLKGVLFARSSRLVPDKANLGFRFSCDGPGRGGTCQVSSWDH
PSAA_SYNS9      DFMVHHIHAFTIHVTVLILLKGVLYARSSRLIPDKANLGFRFSCDGPGRGGTCQVSAWDH
PSAA_SYNPX      DFMVHHIHAFTIHVTVLILLKGVLYARSSRLIPDKANLGFRFSCDGPGRGGTCQVSAWDH
PSAA_SYNSC      DFMVHHIHAFTIHVTVLILLKGVLYARSSRLIPDKANLGFRFSCDGPGRGGTCQVSAWDH
PSAA_SYNS3      DFMVHHIHAFTIHVTVLILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SYNJA      DFMVHHIHAMTIHITVLILLKGVLFARSSRLIPDKAKLGFRFPCDGPGRGGTCQVSGWDH
PSAA_SYNJB      DFMVHHIHAMTIHITVLILLKGVLFARSSRLIPDKGKLGFRFPCDGPGRGGTCQVSGWDH
PSAA_GLOVI      DFMVHHIFALCIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQSSAWDH
PSAA_SYNE7      DFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_SYNP6      DFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_NOSS1      DFLIHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_TRIV2      DFLIHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_TRIEI      DFMVHHIHAFTIHVTALILLKGVLYARNSRLIPDKSELGFRFPCDGPGRGGTCQVSGWDH
PSAA_SYNY3      DFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_THEEB      DFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_TRICV      DFMVHHIHAFTIHVTVLILLKGVLYARSSKLIPDKANLGFRFPCDGPGRGGTCQSSSWDH
PSAA_THAPS      DFMVHHIHAFTIHVTVLILLKGVLYARSSKLIPDKANLGFRFPCDGPGRGGTCQSSSWDH
PSAA_PHATC      DFMVHHIHAFTIHVTVLILLKGVLYARSSKLIPDKANLGFRFPCDGPGRGGTCQSSSWDH
PSAA_EMIHU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_GUITH      DFMVHHIHAFTIHVTVLILLKGVLFSRNSRLIPDKANLGFRFPCDGPGRGGTCQSSAWDS
PSAA_PORPU      DFMVHHIHAFTIHVTVLILVKGFLFSRNSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_PYRYE      DFLVHHIHAFTIHVTVLILVKGFLFSRNSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDH
PSAA_GRATL      DFMVHHIHAFTIHVTVLILVKGFLFSRNSRLIPDKSSLGFRFPCDGPGRGGTCQVSGWDH
PSAA_CYAM1      DFMVHHIHAFTIHVTTLILLKGVLYARNSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CYACA      DFMVHHIHAFTIHVTLLILLKGVLFARNSRLIPDKANLGFRFPCDGPGRGGTCQVSSWDH
PSAA_CYAPA      DFLVHHIHAFTIHVTVLILLKGVLFARNSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_EUGGR      DFLVHHIHAFTIHVTVLILLKGVLFSRSSRLIPDKASLGFRFPCDGPGRGGTCQVSAWDH
PSAA_BIGNA      DFMVHHIHAFTIHVTVLILLKGVLFSRNSRLIPDKSNLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CHLRE      DFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_TETOB      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_STIHE      DFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_OLTVI      DFLVHHIHAFTIHVTVLILLKGVLYSRSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CHLVU      DFMVHHIHAFTIHVTVLILLKGVLYARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_TUPAK      DFLVHHVHAFTIHVTVLILLKGVLYARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_NEPOL      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_OSTTA      DFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_MESVI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CHLAT      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKVNLGFRFPCDGPGRGGTCQVSAWDH
PSAA_STAPU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ZYGCR      DFLVHHIHAFTIHVTVLILLKGVLFSRSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CHAGL      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ANGEV      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PSINU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ANTAG      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PHYPA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_MARPO      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PINKO      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PINTH      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_GOSBA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_GOSHI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_HELAN      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_LACSA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SPIOL      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_NICSY      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_TOBAC      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_NICTO      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ATRBE      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPERGGTCQVSAWDH
PSAA_SOLBU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SOLLC      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SOLTU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_JASNU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_DAUCA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PANGI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_BARVE      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CAPBU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_OLIPU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CRUWA      DFLVHHIHAFTIHVPVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ARATH      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_NASOF      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_LEPVR      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_AETCO      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_LOBMA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ARAHI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_DRANE      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_AETGR      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKASLGFRFPCDGPGRGGTCQVSAWDH
PSAA_POPAL      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_POPTR      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_EUCGG      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CITSI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_OENEH      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CUCSA      DFLVHHIHAFTIHVTVLILLKGVLFSRSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_LOTJA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SOYBN      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PHAVU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PELHO      DFLVHHIHAFTIHVTLLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_MORIN      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_VITVI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_COFAR      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CALFG      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_LIRTU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_AMBTC      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_DRIGR      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_AGRST      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_WHEAT      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_HORVU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ORYNI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ORYSA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ORYSI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ORYSJ      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SACHY      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SACOF      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_SORBI      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_MAIZE      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PHAAO      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ACOCL      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_NANDO      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PLAOC      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_PIPCE      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_NYMAL      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_HUPLU      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_ADICA      DFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_CHAVU      DFLVHHIHAFTIHVTVLILLKGVLFSRSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDH
PSAA_HETTR      DFMVHHIHAFTIHCTLLILMKGVLYSRSSRLVSDKLELGFRYPCDGPGRGGTCQISPWDH
PSAA_AMPCA      DFMVTHIHAFTIHTTVLILVKGFLYARSSRLVNDKYKLDFRYPCDGPGRGGTCQISPWDH
                *::: *:.*: ** . ***:**.*::*.*:*: ** .*.**:.**** ****** * ** 

PSAA_PROM1      VFLGLFWMYNGLSVVIFHFSWKMQSDVWG-----------LTG-------------GNFA
PSAA_PROMT      VFLGLFWMYNGLSVVIFHFSWKMQSDVWG-----------LTG-------------GNFA
PSAA_PROMA      VFLGLFWMYNSLSVVIFHFSWKMQSDVWG-----------LTG-------------GNFA
PSAA_PROM0      VFLALFWMYNCLSIVIFHFSWKMQSDVWG-----------LTG-------------GNFA
PSAA_PROMS      VFLALFWMYNCLSIVIFHFSWKMQSDVWG-----------LTG-------------GNFA
PSAA_PROMP      VFLGLFWMYNCLSIVIFHFSWKMQSDVWG-----------LTG-------------GNFS
PSAA_PROM9      VFLALFWMYNCISIVIFHFSWKMQSDVWG-----------LTG-------------GNFS
PSAA_PROM5      VFLALFWMYNCLSIVIFHFSWKMQSDVWG-----------LTG-------------GNFA
PSAA_PROM3      VFLGLFWMYNSLSMVIFYFSWKMQSDVWGTVN-SDGSVTHLVS-------------GNFA
PSAA_PROMM      VFLGLFWMYNSLSMVIFYFSWKMQSDVWGTVN-SDGSVTHLVS-------------GNFA
PSAA_SYNS9      VFLGLFWMYNSLSIVIFHFSWKMQSDIWGTVN-ADGSVAHITN-------------GNFA
PSAA_SYNPX      VFLGLFWMYNSLSIVIFHFSWKMQSDIWGTVN-ADGSVAHITN-------------GNFA
PSAA_SYNSC      VFLGLFWMYNSLSIVIFHFSWKMQSDIWGTVN-ADGSVAHITN-------------GNFA
PSAA_SYNS3      VFLGLFWMYNSLSVVIFHFSWKMQSDVWGTVN-ADGSVQHITN-------------GNFA
PSAA_SYNJA      VFLGLFWMYNAISIVIFHFSWKMQSDIWGTVN-PDGTIEHITG-------------GNFA
PSAA_SYNJB      VFLGLFWMYNCISIVIFHFSWKMQSDIWGTVN-ADGTIEHITG-------------GNFA
PSAA_GLOVI      VFLGLFWMYNTISVVIFHFSWKMQSDVWGTVDRSTGAVNHIIGNTDVLLGGQTVALSQYA
PSAA_SYNE7      VFLGLFWMYNSLSIVIFHYSWKMQSDVWGSVL-PDGSVAHIAN-------------GNFA
PSAA_SYNP6      VFLGLFWMYNSLSIVIFHYSWKMQSDVWGSVL-PDGSVAHIAN-------------GNFA
PSAA_NOSS1      VFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVD-AAGNVSHITG-------------GNFA
PSAA_TRIV2      VFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVD-AAGNVSHITG-------------GNFA
PSAA_TRIEI      VFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVD-PDGTVSHITY-------------GNFA
PSAA_SYNY3      VFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVS-PDGSVTHVTL-------------GNFA
PSAA_THEEB      VFLGLFWMYNCISVVIFHFSWKMQSDVWGTVA-PDGTVSHITG-------------GNFA
PSAA_TRICV      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIT-PDGNISHITG-------------GNFA
PSAA_THAPS      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIT-PDGAISHITG-------------GNFA
PSAA_PHATC      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-PDGSISHITG-------------GNFA
PSAA_EMIHU      IFLGLFWMYNCISVVIFHFSWKMQSDVWGTIS-EKGKITHITG-------------GNFA
PSAA_GUITH      VFLGLFWMYNCISVVIFHFSWKMQSDVWGTVQ-NDGTVTHITG-------------GNFA
PSAA_PORPU      VFLGLFWMYNSLSVAIFHFSWKMQSDVWGSVS-PSGNVSHITG-------------GNFA
PSAA_PYRYE      VFLGLFWMYNSLSVAIFHFSWKMQSDVWGSVS-PSGNVSHITG-------------GNFA
PSAA_GRATL      VFLGLFWMYNSLSIAIFHFSWKMQSDVWGSVT-PAGTVSHITG-------------GNFA
PSAA_CYAM1      VFLGLFWMYNALSIVIFHFSWKMQSDVWGTVT-SNGAISHITG-------------GNFA
PSAA_CYACA      VFLGLFWMYNCISVVIFHFSWKMQSDVWGTVS-QNSLVSHVVG-------------GNFS
PSAA_CYAPA      VFLGLFWMYNSLSVVLFHFSWKMQSDVWGNVT-ADGAVSHITG-------------NNFA
PSAA_EUGGR      VFLGLFWMYNSISVAIFHFSWKMQSDVWGTV--LANKVSHITG-------------GNFS
PSAA_BIGNA      VFLGLFWMYNSLSIVIFHFSWKLQSDVWGNV--NSSVVSHITR-------------GNFA
PSAA_CHLRE      VFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVT-ASG-VSHITG-------------GNFA
PSAA_TETOB      VFLGLFWMYNSLSIAIFHFSWKMQSDVWGTVT-ANG-VSHITG-------------GNFA
PSAA_STIHE      VFLGLFWMYNSLSIVIFHFSWKMQSDVFGTVV-NNT-VSHITA-------------GNFA
PSAA_OLTVI      VFLGLFWMYNSLSIVIFHFSWKMQSDVWGSVT-ASG-VTHITG-------------GNFA
PSAA_CHLVU      VFLGLFWMYNSISIVIFHFSWKMQSDVWGTVS-ANG-VSHITG-------------GNFA
PSAA_TUPAK      VFLGLFWMYNAISVVIFHFSWKMQSDVWGTVN-ASG-ISHITG-------------GNFA
PSAA_NEPOL      VFLGLFWMYNSISVVIFHFSWKMQSDVWGNVT-AQG-VSHITG-------------GNFA
PSAA_OSTTA      VFLGLFWMYNSISIVIFHFSWKMQSDVWGSVT-GNG-VSHITG-------------GNFA
PSAA_MESVI      VFLGLFWMYNCLSIVIFHFSWKMQSDVWGSVT-AQG-VSHITG-------------GNFA
PSAA_CHLAT      VFLGLFWMYNSLSIAIFHFSWKMQSDVWGSVT-AKG-VSHITG-------------GNFA
PSAA_STAPU      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTVS-QNG-VSHITG-------------GNFA
PSAA_ZYGCR      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSVT-AKG-VSHITG-------------GNFA
PSAA_CHAGL      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTVT-SNG-VSNITG-------------GNFA
PSAA_ANGEV      VFLGLFWMYNSISIVIFHFSWKMQSDVWGSIS-DQGVVSHITG-------------GNFA
PSAA_PSINU      VFLGLFWMYNSISIVIFHFSWKMQSDVWGSIN-DQGVINHITG-------------GNFA
PSAA_ANTAG      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSLS-NQGVVTHITG-------------GNFA
PSAA_PHYPA      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_MARPO      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-EQGVVTHITG-------------GNFA
PSAA_PINKO      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_PINTH      VFLGLFWMYNAISVVIFHFSWKMQSDVWGNIS-DQGVVTHITG-------------GNFA
PSAA_GOSBA      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_GOSHI      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_HELAN      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_LACSA      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_SPIOL      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_NICSY      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_TOBAC      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_NICTO      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_ATRBE      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_SOLBU      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_SOLLC      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_SOLTU      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_JASNU      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSLS-DQGVVTHITG-------------GNFA
PSAA_DAUCA      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_PANGI      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_BARVE      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_CAPBU      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_OLIPU      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_CRUWA      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_ARATH      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_NASOF      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_LEPVR      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_AETCO      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_LOBMA      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_ARAHI      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_DRANE      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_AETGR      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_POPAL      VFLGLFWMYNAISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_POPTR      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_EUCGG      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_CITSI      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_OENEH      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_CUCSA      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSVS-DQGVVTHITG-------------GNFA
PSAA_LOTJA      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_SOYBN      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGIVNHITG-------------GNFA
PSAA_PHAVU      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGIVTHITG-------------GNFA
PSAA_PELHO      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-EQGVVTHITG-------------GNFA
PSAA_MORIN      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_VITVI      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGVLTHITG-------------GNFA
PSAA_COFAR      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_CALFG      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_LIRTU      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_AMBTC      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-NQGVVTHITG-------------GNFA
PSAA_DRIGR      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_AGRST      VFLGLFWMYNAISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_WHEAT      VFLGLFWMYNAISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_HORVU      VFLGLFWMYNAISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_ORYNI      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_ORYSA      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_ORYSI      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_ORYSJ      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_SACHY      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGIVTHITG-------------GNFA
PSAA_SACOF      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGIVTHITG-------------GNFA
PSAA_SORBI      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGIVTHITG-------------GNFA
PSAA_MAIZE      VFLGLFWMYNSISVVIFHFSWKMQSDVWGTIS-DQGIVTHITG-------------GNFA
PSAA_PHAAO      VFLGLFWMYNAISVVIFHFSWKMQSDVWGTIS-DQGVVTHITG-------------GNFA
PSAA_ACOCL      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_NANDO      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIN-DQGVVTHITG-------------GNFA
PSAA_PLAOC      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_PIPCE      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_NYMAL      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSIS-DQGVVTHITG-------------GNFA
PSAA_HUPLU      VFLGLFWMYNAISVVIFHFSWKMQSDVWGSVS-DQKIVTHITG-------------GNFA
PSAA_ADICA      VFLGLFWMYNSISVVIFHFSWKMQSDVWGSVS-EQGAVSHITG-------------GNFA
PSAA_CHAVU      IFLGLFWMYNSLSIAIFHFSWKMQSDVWGNVT-PQG-ISHITG-------------GNFA
PSAA_HETTR      VFLGVFWMYNSLSIVIFHFFWKMQSDVWGVYDVSTQKIVHLTG-------------GDFS
PSAA_AMPCA      VFLGLFWMYNSISVVIFHFFWEYQSNLASIKASAGGSIRALAS--------------DFE
                :**.:***** :*:.:*:: *: **:: .           :                :: 

PSAA_PROM1      QSSITINGWLRDFLWAQSSQVLTSYGQPISMYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PROMT      QSSITINGWLRDFLWAQSSQVLTSYGQPISMYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PROMA      QSSITINGWLRDFLWAQSSQVLTSYGQPISMYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PROM0      QSSITINGWLRDFLWAQASQVLTSYGQSISMYGLMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_PROMS      QSSITINGWLRDFLWAQASQVLTSYGQSISMYGLMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_PROMP      QSAITINGWLRDFLWAQSSQVLTSYGSAISMYGLMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_PROM9      QSAITINGWLRDFLWAQSSQVLTSYGEAISMYGLMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_PROM5      QSAITINGWLRDFLWAQAAQVLTSYGQSISMYGLMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_PROM3      QSAITVNGWFRDFLWAQSSQVLTSYGTGLSGYGLLFLGGHFVWAFSLMFLFSGRGYWQEL
PSAA_PROMM      QSAITVNGWFRDFLWAQSSQVLTSYGTGLSGYGLLFLGGHFVWAFSLMFLFSGRGYWQEL
PSAA_SYNS9      QSAITINGWLRDYLWAQAVQVINSYGSSTSAYGIMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_SYNPX      QSAITINGWLRDYLWAQAVQVINSYGSNTSAYGIMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_SYNSC      QSAITINGWLRDYLWAQAVQVINSYGSNTAAYGIMFLGAHFVFAFSLMFLFSGRGYWQEL
PSAA_SYNS3      NSAITINGWLRDFLWAQAAQVINSYGSNTSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SYNJA      TSAININGWLRDFLWAQSVQVINSYGSELSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SYNJB      ASAININGWLRDFLWAQSVQVINSYGSALSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_GLOVI      ASSININGWLRDFLWAQSSAVINSYGGPLSAYGLMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_SYNE7      QSALTINGWLRDFLWAQASQVITSYGSSTSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SYNP6      QSALTINGWLRDFLWAQASQVITSYGSSTSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_NOSS1      QSAITINGWLRDFLWAQASQVINSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_TRIV2      QSAITINGWLRDFLWAQASQVINSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_TRIEI      QSAVTINGWLRDFLWAQASNVITSYGSELSAYGLLFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_SYNY3      QSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQEL
PSAA_THEEB      QSAITINGWLRDFLWAQASQVIGSYGSALSAYGLLFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_TRICV      QSSITINGWLRDFLWSQASQVIQSYGSASSAYGLIFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_THAPS      QSSITINGWLRDFLWSQASQVIQSYGSASSAYGLIFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_PHATC      KGAITINGWLRDFLWSQASQVIQSYGSAASAYGLIFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_EMIHU      NSALTINGWLRDFLWSQASQVIQSYGSALSAYGIIFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_GUITH      QSSITINGWLRDFLWAEASQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_PORPU      QSAITINGWLRDFLWAQASQVIQSYGSALSAYGLIFLAAHFVWAFSLMFLFSGRGYWQEL
PSAA_PYRYE      QSAITINGWLRDFLWAQASQVIQSYGSALSAYGLIFLAAHFVWAFSLMFLFSGRGYWQEL
PSAA_GRATL      QSAITINGWLRDFLWAQASQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CYAM1      QSAITINGWLRDFLWAQASQVIQSYGSSLSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CYACA      QSAITINGWLRDFLWAQASQVIQSYGSSISAYGLMFLAAHFIWAFSLMFLFSGRGYWQEL
PSAA_CYAPA      QSSITINGWLRDFLWAQASQVIQSYGSALSAYGLMFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_EUGGR      QGSLTINGWLRDFLWAQSSQVIQSYGSPLSAYGLMFLGAHFVWAFTLMFLFSGRGYWQEL
PSAA_BIGNA      QSANTINGWLRDFLWSQSSQVIQSYGSSLSAYGLIFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CHLRE      QSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_TETOB      QSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_STIHE      QSANTINGWLRDFLWSQSSQVIQSYGSALSAYGLIFLGAHFILLTGMLDIFSGRGYWQEL
PSAA_OLTVI      ASANTINGWLRDFLWAQSSQVIQSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CHLVU      QSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_TUPAK      QSANTINGWLRDFLWAQSSQVIQSYGSSLSAYGLIFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_NEPOL      LSSNTINGWLRDFLWAQASQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_OSTTA      QSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_MESVI      QSANTINGWLRDFLWAQASQVIQSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CHLAT      QSSITINGWLRDFLWAQASQVIQSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_STAPU      QGATTINGWLRDFLWAQASQVIQSYGSSLSAYGLVFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ZYGCR      QSATTINGWLRDFLWAQASQVIQSYGSSLSAYGLVFLGAHFIWAFSLMFLFSGRGYWQEL
PSAA_CHAGL      QSANTINGWLRDFLWAQASQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ANGEV      QSATTINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PSINU      QSSTTINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ANTAG      QSSITINGWLRDFLWAQAAQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PHYPA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_MARPO      QSAITINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PINKO      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PINTH      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_GOSBA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_GOSHI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_HELAN      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_LACSA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SPIOL      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_NICSY      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_TOBAC      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_NICTO      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ATRBE      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SOLBU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SOLLC      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SOLTU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_JASNU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_DAUCA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PANGI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_BARVE      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CAPBU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_OLIPU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CRUWA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ARATH      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_NASOF      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_LEPVR      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_AETCO      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_LOBMA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ARAHI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_DRANE      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_AETGR      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_POPAL      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_POPTR      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_EUCGG      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CITSI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_OENEH      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CUCSA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_LOTJA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SOYBN      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PHAVU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PELHO      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_MORIN      QSSTTINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_VITVI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_COFAR      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CALFG      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_LIRTU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_AMBTC      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_DRIGR      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_AGRST      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_WHEAT      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_HORVU      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ORYNI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ORYSA      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ORYSI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ORYSJ      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SACHY      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SACOF      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_SORBI      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_MAIZE      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PHAAO      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ACOCL      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_NANDO      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PLAOC      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_PIPCE      QSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_NYMAL      QSSITINGWLRDFLWAQSSQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_HUPLU      QSSITINGWLRDFLWAQASQVIQSHGSSLSAYGLPFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_ADICA      QSSTTINGWLRDFLWAQASQVIQSYGSSLSAYGLLFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_CHAVU      QSSITINGWLRDFLWAQASQVIQSYGSPLSAYGLIFLGAHFVWAFSLMFLFSGRGYWQEL
PSAA_HETTR      VNSITINGWLRNFLWSQAAEVIQSYGSGLSGYGLIFLGAHFTWAFSLMFLWSGRGYWQEL
PSAA_AMPCA      LNSINTNGWLRNFLWSGAAQVIQSYGSPLAAYGLTFPASHFVWALSLMFLFSGRGYWQEL
                 .: . ***:*::**: :  *: *:*   : **: * ..**     :: ::*********

PSAA_PROM1      FESIIWAHNKLNLAPTIQPRALSITQGRAVGAAHFLLGGIATTWAFFHARLIGLG--
PSAA_PROMT      FESIIWAHNKLNLAPTIQPRALSITQGRAVGAAHFLLGGIATTWAFFHARLIGLG--
PSAA_PROMA      FESIIWAHNKLKVAPTIQPRALSITQGRAVGVAHFLLGGIATTWAFFHARLIGLG--
PSAA_PROM0      FESIVWAHNKLKVAPTIQPRALSITQGRAVGVTHFLVGGIATTWAFFHARLFGLG--
PSAA_PROMS      FESIVWAHNKLKVAPTIQPRALSITQGRAVGVTHFLVGGIATTWAFFHARLFGLG--
PSAA_PROMP      FESIVWAHNKLKVAPTIQPRALSITQGRAVGVTHFLVGGIATTWAFFHARLFGLG--
PSAA_PROM9      FESIVWAHNKLKVAPTIQPRALSITQGRAVGVAHFLLGGIATTWAFFHARLFGLG--
PSAA_PROM5      FESIVWAHNKLKVAPTIQPRALSITQGRAVGVTHFLVGGIATTWAFFHARLFGIG--
PSAA_PROM3      FESIIWAHNKLKLAPTIQPRALSITQGRAVGVTHFLFGGIVTTWAFFHARLLGLG--
PSAA_PROMM      FESIIWAHNKLKLAPTIQPRALSITQGRAVGVTHFLFGGIVTTWAFFHARLLGLG--
PSAA_SYNS9      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFHAHILVVG--
PSAA_SYNPX      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFHAHILVVG--
PSAA_SYNSC      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFHAHILVVG--
PSAA_SYNS3      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFHAHILVVG--
PSAA_SYNJA      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARFAALG--
PSAA_SYNJB      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARFGALG--
PSAA_GLOVI      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFLARFLALP--
PSAA_SYNE7      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWSFFLARIIAVG--
PSAA_SYNP6      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWSFFLARIIAVG--
PSAA_NOSS1      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFHAHILSVG--
PSAA_TRIV2      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFHAHILSVG--
PSAA_TRIEI      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIVTTWAFFLARIIAVG--
PSAA_SYNY3      IESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG--
PSAA_THEEB      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFLARIISVG--
PSAA_TRICV      IESIVWAHNKLNFAPAIQPRALSITQGRAVGLAHYLLGGIGTTWSFFLARAISIT--
PSAA_THAPS      IESIVWAHNKLNFAPTIQPRALSITQGRAVGLAHYLLGGIGTTWAFFLARAISIT--
PSAA_PHATC      IESIVWAHNKLNFAPAIQPRALSITQGRAVGLAHYLLGGIGTTWAFFLARAVSIS--
PSAA_EMIHU      IESVVWAHNKLKLAPAIQPRALSITQGRAVGLAHYLLGGIGTTWSFFLARIISVG--
PSAA_GUITH      IESIVWAHNKLHFAPAIQPRALSITQGRAVGLAHYLLGGIGTTWAFFLARIISVG--
PSAA_PORPU      IESIVWAHNKIKVAPAIQPRALSITQGRAVGVAHYLLGGIGTTWAFFLARIISVG--
PSAA_PYRYE      IESIVWAHNKIKVAPAIQPRALSITQGRAVGVAHYLLGGIGTTWAFFLARIISVG--
PSAA_GRATL      IESIVWAHNKVKVAPSIQPRALSITQGRAVGVAHYLLGGIGTTWAFFLARIISVG--
PSAA_CYAM1      IESIVWAHNKLKVAPAIAPRALSITQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_CYACA      IESIVWAHSKLKIAPTIQPRALSITQGRAVGAAHYLLGGIATTWAFFLSRAISIG--
PSAA_CYAPA      IESIVWAHNKLKFAPSIQPRALSITQGRAVGVAHYLLGGIATTWSFFHARIISVG--
PSAA_EUGGR      IESIVWAHNKLKVAPNIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG--
PSAA_BIGNA      IESIVWAHNKLKVAPAIAPRALSITQGRAVGVAHYLLGGIGTTWSFFLARIISVN--
PSAA_CHLRE      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG--
PSAA_TETOB      IESIIWAHSKLKVAPSIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG--
PSAA_STIHE      IESILWSHAKLKVAPTIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG--
PSAA_OLTVI      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG--
PSAA_CHLVU      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARILAVG--
PSAA_TUPAK      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG--
PSAA_NEPOL      IESIVWAHNKLKVAPSIQPRALSITQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_OSTTA      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIIAVG--
PSAA_MESVI      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_CHLAT      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_STAPU      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFLARIISVG--
PSAA_ZYGCR      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_CHAGL      IESIVWAHNKLKVAPAIQPRALSIIQGRAVGVAHYLLGGIATTWAFFLARIISVG--
PSAA_ANGEV      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIATTWAFFLARIISVG--
PSAA_PSINU      IESIIWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_ANTAG      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_PHYPA      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIATTWAFFLARIISVG--
PSAA_MARPO      IESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_PINKO      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIVTTWAFFLARIIAVG--
PSAA_PINTH      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIVTTWAFFLARIIAIG--
PSAA_GOSBA      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_GOSHI      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_HELAN      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_LACSA      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_SPIOL      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_NICSY      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_TOBAC      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_NICTO      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ATRBE      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIITVG--
PSAA_SOLBU      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_SOLLC      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_SOLTU      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_JASNU      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_DAUCA      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_PANGI      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_BARVE      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_CAPBU      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_OLIPU      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_CRUWA      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ARATH      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_NASOF      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_LEPVR      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_AETCO      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_LOBMA      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ARAHI      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_DRANE      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_AETGR      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_POPAL      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_POPTR      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_EUCGG      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_CITSI      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_OENEH      IESIVWAHNKLKVAPATQPRALSIVQGRTVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_CUCSA      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_LOTJA      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_SOYBN      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_PHAVU      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_PELHO      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_MORIN      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_VITVI      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_COFAR      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_CALFG      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_LIRTU      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_AMBTC      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_DRIGR      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_AGRST      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_WHEAT      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_HORVU      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ORYNI      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ORYSA      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ORYSI      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ORYSJ      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_SACHY      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_SACOF      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_SORBI      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_MAIZE      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_PHAAO      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_ACOCL      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_NANDO      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_PLAOC      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_PIPCE      IESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG--
PSAA_NYMAL      IESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIISVG--
PSAA_HUPLU      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIATTWAFFLARIIAVG--
PSAA_ADICA      IESIVWAHNKLKVAPVTQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIVAVG--
PSAA_CHAVU      IESIVWAHNKLKVAPAIQPRALSIVQGRAVGVAHYLLGGIATTWAFFLARIISVA--
PSAA_HETTR      IESILWAHHKLKIVPNIQPRALSITQGRAVGLVHYMLGGIGTTWAFFLARVVALSIS
PSAA_AMPCA      IESVLWAHHKLYVVPHIQPRALSITSGRAVGFTHYLLGGIGSTWSFFLARIVATAG-
                :**::*:* *: ..*   ****** .**:** .*::.*** :**:** ::