CLUSTAL format seed alignment for MF_00460

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y796_NEIMB            ---------------MLEIEIVYG-LPDRQVLKTMQLAEGTTVRAAALQSGLDGIFE---
RNFH_NEIG1            ---------------MLEIEIVYG-LPDRQVLKTMQLAEGTTVRTAALQSGLDGIFE---
PASI_ECOL6            ------------MPGKIAVEVAYA-LPEKQYLQRVTLQEGATVEEAIRASGLLELRT---
RATB_ECOLI            ------------MPGKIAVEVAYA-LPEKQYLQRVTLQEGATVEEAIRASGLLELRT---
RNFH_ECOLU            ------------MPGKIAVEVAYA-LPEKQYLQRVTLQEGATVEEAIRASGLLELRT---
RNFH_ECO5E            ------------MPGKIAVEVAYA-LPKKQYLQRVTLQEGATVEEAIRASGLLELRT---
RNFH_ESCF3            ------------MPGKIAVEVAYA-LPEKQYLQRVSLQEGATVEEAIRASGLLELRT---
RNFH_CITK8            ------------MSAKIVVEVAYA-LPEKQYLQRVTLQEGATVEEAIRASGLLELRT---
YFJF_SALTY            ------------MPDKLVVEVAYA-LPEKQYLQRVTLEEGATVEEAIRASGLLELRT---
RNFH_KLEP3            ------------MPANIRVEVAYA-LPEKQYLQRVTLDEGATVEQAIIASGLLALRD---
RNFH_CROS8            ------------MPGEIQVEVAYA-LPEKQYLRKVKLPEGASVEEAIIASGLLELRK---
RNFH_ERWT9            ------------MP-DIAIEVVYA-LPEKQYLYNVKVPQGSSVEQAIIASGLLQLRP---
RNFH_YERPB            ------------MP-DIRVEVVYA-LSERQYLRTVSLVVGSTVEDAIKASGLLELRP---
RNFH_SERP5            ------------MS-EIRVEVVYA-LPERQYLRNVTLAEGSSVEQAIVASGLLELRG---
Y3376_PHOLL           ------------MS-DINVEVVYA-LPDRQYLRTVKLAQGSTVEQAIVASGLLTLRN---
C6CIM0_DICC1          ------------MA-DIHVEVVYA-LPERQYLRPLTLEAGSTAEQAIQASGLLALRP---
D2BT22_DICZ5          ------------MP-EIHVEVVYA-LPERQYLRPLTLDAGSTAEQAIQASGLLALRP---
RNFH_SODGM            ------------MP-DIRVEVVYA-LPERQYLRQLVLEEGSTLEQAIHASGLLALRQ---
RNFH_PROMH            ------------MT-KIWVEVAYA-LPDKQYVIPVELTLGDTVEQAIIASNILTICN---
RNFH_MANSM            ------------MA-QINIEITYA-FPEHYYLKKFTLDEGTTVQSAILQSGILQQFT---
RNFH_ACTSZ            ------------ME-QINIEIAYA-YPHNHYLKSFTLDAGTTVQSAILQSGILAQYT---
Y166_PASMU            ------------MA-QIKIEIAYA-YPERYYLKKLTVEEGTMIQTAILQSGILQQFT---
Y395_HAEIN            ------------MN-QINIEIAYA-FPERYYLKSFQVDEGITVQTAITQSGILSQFP---
Y1828_HAEDU           --------MVSESS-QIVVEIIYA-YPDQYFLKKISLDQPTTIQNVILQSGILAKYT---
B0BSR3_ACTPJ          ---------MSDIE-KIEVEVLFA-YPNKHFLKKITLDAPTSVQNVILQSGILEKYT---
Y369_VIBVU            ---------MSIESEMIHVEVVYA-LPQEQRVLTLVVNQQATVEEIIRQSGVLEIYP---
Y646_VIBPA            ---------MSIESDMIHVEVVYA-LPHEQRVFNLVVNNHATVEEIIRQSGVLELYP---
Y850_VIBCH            -----------MSSEMIHVEVVYA-LPHEQRVLKLVVEQSATVEEIIRTSGILQMYP---
RNFH_ALISL            ---------------MIHVEVVYA-LPTEQVVFKLAVKADQTVQEIIEQSGVLERYP---
RNFH_TOLAT            ------------MPDQIQIEVVYA-LPMRQTTLTLKINTGSSVEDAIRESGILARHP---
RNFH_PSEA6            -----------MTDKQINLEVAYA-LPDRQALLEVVVEMGHTVEEAIKASGILQRFD---
RNFH_PSEHT            ---------------MIDVEVVFA-LPETATSLTIEVVKGTTVEQAVIQSGIIEKHP---
Y1475_SHEON           ---------MTNEADKFVVDVIYA-LPTQQKVISVSVLPGTSAIDIVRQSNMVSFFP---
A0KZF7_SHESA          ---------MTNEADKFVVDVIYA-LPTQQKVISVSVLPGTSAIDIVRQSNMVSFFP---
Q12PU9_SHEDO          ---------MTSETDKFEVDVVYA-LPHQQKIISVAVEPGTRFIEAVHLSQMVSFFP---
RNFH_LARHH            ----------MATTDDISVEVAYA-LPERQSLVRLKVPAGTTARDAIGLSGLLDQYP---
Y3462_CHRVO           ------------MTEKLSVEVAYA-RPDRQWLVALTLPAGATALDAALASGILEACP---
D7DHI7_METV0          -----------MTDSEMIVEVAYA-LPKEQLIIPIKVTEGITVEQAIKSSGMMAKYP---
G0A3A9_METMM          -----------MANDVIAVEVAYA-TPQRQAIIAVTLPADSTAEQAIRASGILREFP---
RNFH_RHOS1            ----------------MIVGVAYA-KPTVQVWKHVDVPEGTSAREAIERSGLLAQFP---
RNFH_RHOS4            ----------------MIVGVAYA-KPTVQVWKHVDVPEGTSAREAIERSGLLAQFP---
A4WXG8_RHOS5          ----------------MIVGVAYA-KPTVQVWKHVDVPEGATARDAIESSGLLAQFP---
RNFH_MAGSA            ----------------MKIGVVYA-LPSRQSWLSIDVPEGTTVKEAIQKSGILNQFP---
RNFH_AZOVD            ----------------MRVSVVYA-DPAKPLQLSCKVEDGCSVEQAIQQSGVLRCCP---
A0A1G3DP43_9GAMM      ----------------MKISVVYA-APRQPLLFDCRVAEGSSVAEAIEHSGVLRYCP---
RNFH_METCA            ----------------MNVGVCYA-DADRQLWLRMEMPDDSTVEQAIRYSGILERFP---
D3RMP7_ALLVD          ------------MTEYLQISVAYV-GTDGQALRALEVRTGTSVREAIEQCGLLDQFP---
RNFH_PSEAB            -------------MAEIAVEVVYA-LPERQALLRLSVPAGTSAREAVLLSGIAEAFP---
YOM2_PSEAE            -------------MAEIAVEVVYA-LPERQALLRLSVPAGTSAREAVLLSGIAEAFP---
RNFH_PSEA7            -------------MAEIAVEVVYA-LPERQALLRLSVPAGTSAREAVRLSGIAEVFP---
RNFH_PSEMY            -----------MDNPNIAIEVVYA-LADRQKLLRLSVPVGTTVREAALRSGMQQFFP---
RNFH_PSEF5            -----------MAEPMISIEVAYA-AVDRQALIRVQVPQGSTLRAALQASAIGQQFP---
RNFH_PSEPF            -----------MVEPVIEIEVVYA-AVDRQVLRVISVAEGTTVRAALMASGIDAEFP---
RNFH_PSE14            -----------MAEAVIQIEVVYA-SVQRQVLMTLDVPAGSSVRQALALSGMDREFP---
Y4512_PSESM           -----------MAEASIQIEVVYA-TVQRQVLMTVDVPAGSSVRQALALCGMDREFP---
RNFH_PSEU2            -----------MADASIQIEVVYA-SVQRQVLKTVDVPTGSSVRQALALSGIDKEFP---
RNFH_PSEE4            -----------MAETSLRIEVVYA-TPERQWLLACEVPAGTSVSEALRLSGLAEQVP---
RNFH_HAHCH            -----------MDKLKIQVEVAYA-LPEQQKIIPLAVVEGTTAYEAVQMSGITHFFP---
E4PPI0_MARAH          ---------------MMQVEVAYA-RPDRQEIVPVNVPEGTTALEAAKLSGISDIFP---
RNFH_ALCBS            -----------MSETMIHVEVVYA-LPQKQRLIGLDVPDGTSMLDAAKLSGIGEQFA---
Y1303_COXBU           ---------------MISIIIAYA-TPEKQVEIPLTVEESCTLVVAVKRSGILQQFP---
RNFH_COXB1            ---------------MISIIIAYS-TPEKQVEIPLTVEESCTLVVAVKRSGILQQFP---
RNFH_COXBR            ---------------MISIIIAYA-TPEKQVEIPLTVEESCTLVVAVKRSGILQQFP---
RNFH_PSYIN            ------------MNELIEIEVVYG-RPDKQVLLSLSVPVGSTLEDCIKLSGITTHFP---
Y1376_XYLFT           --------------------MLIA-WPDRVHCCEIMLQEGARVVDAVEMAALNGI-----
Y2346_XYLFA           --------------------MLIA-WPDRVHCCEIMLQEGARVVDAVEMAALNGI-----
B2FMX7_STRMK          ---------------MIEVEVVLA-WPQQVLSRRLQLDEGATVADAIAAAALEGS-----
A0A3T0NZN7_BORBO      -----MANDTPAPAGSLRVTVCHA-CPDGAWQRAVTLPAGATVADAVAASGFAAA-----
Q7WA39_BORPA          -----MANDTPAPAGSLRVTVCHA-CPDGAWQRAVTLPAGATVADAVAASGFAAA-----
C5CLX4_VARPS          ---------------MIEVTLCCSPAPREVFEQVLRLAPQATVADAVKASELAQR-----
A1WPQ1_VEREI          MADDTADTADTAIRATLQVTVVLCVAPRQTQEWTLELPIGATLGDAIRASGAARQGASGT
D5WYV7_THIK1          ---------------MVNIAVFYAPERGEPDLRRLALPAGATVGQALQASGMLSA-----
A0A5B2ZK44_9GAMM      ------------MERTQQVWVAFA-VPEQQFLISVPFEEGMTAAQAVQASGLSNQ-----
RNFH_HALHL            ----------MSSEGELGIEVVYA-LPGQQTVLRVELPAGSTAGDALNASGVLER-----
RNFH_PARXL            ------------MSARLSIEVCYA-SAGEQALIAVELPEGATLRQALDASGILRRFP---
RNFH_PARP8            ------------MSAHLTVQVCYA-LPGEQTLIQLQLPPGVTLRQAIDASGVLTRHP---
RNFH_BURM9            ------------MTRMPKVQVCYA-LPERQTLVAVDVPAGASVRDAIAASGVLALHP---
Y1426_RALSO           ----------MANPERIDVMVCLA-TVTPPKLVQVQVSATATVADAVRASGLLEEV----
A0A347CVC0_RALSL      ----------MANPERIDVMVCLA-TVAPPRLVRVQVSAAATVADAVRASGLLEGT----
RNFH_CUPPJ            ----------MAQADMVRISVCYA-RPDSVFLKEFDVLQGTTIAAAIVSSGVQQVCP---
Y253_BUCAI            -------------MKIIKVTVVYA-LPKIQYICQVDIALGSTVKDAILKSNLLNLTNDV-
RNFH_BUCA5            -------------MKIIKVTVVYA-LPKIQYICQVDIALGSTVKDAILESNLLNLTNDV-
Y244_BUCAP            -------------MNIIKVKVVYA-LPDIQYIKEVHIDSNSTVKDAILASNLLNTVKNI-
Y234_BUCBP            ---------------MITITIVYF-TNKIQHVKKIKLNIGTPVHEA-LKILQINIKKN--
                                          :               .                       

Y796_NEIMB            ----DLNLHSAPLGIFGKAVKDDTP--LRDGDRIEVYRPLLIDPKEARRKRVQNQEE---
RNFH_NEIG1            ----NLNLHSAPLGIFGKAVKDDTP--LRDGDRIEVYRPLLIDPKEARRKRVQNQEE---
PASI_ECOL6            ----DIDLTKNKVGIYSRPAKLSDI--VHDGDRVEIYRPLIADPKELRRQRAEKSANK--
RATB_ECOLI            ----DIDLTKNKVGIYSRPAKLSDS--VHDGDRVEIYRPLIADPKELRRQRAEKSANK--
RNFH_ECOLU            ----DIDLTKNKVGIYSRPAKLSDT--VHDGDRVEIYRPLIADPKELRRQRAEKSANK--
RNFH_ECO5E            ----DIDLTENKVGIYSRPAKLSDS--VHDGDRVEIYRPLIADPKELRRQRAEKSANK--
RNFH_ESCF3            ----DIDLTKNKVGIYSRPTKLSDT--VHDGDRVEIYRPLIADPKELRRQRAEKSANK--
RNFH_CITK8            ----DIDLAKNKVGIYSRPTKLADV--VHDGDRVEIYRPLIADPKELRRQRAEKSANK--
YFJF_SALTY            ----DIDLAKNKVGIYSRPVKLTDT--VQDGDRVEIYRPLIADPKALRRQRAEKSAGR--
RNFH_KLEP3            ----DIDLAKNKLGIYSRPVKLHDE--VHDGDRVEIYRPLIADPKELRRQRAEKSAAK--
RNFH_CROS8            ----DIDLKKNKVGIYSRPVKLADT--LNDGDRVEIYRPLIADPKELRRQRAERAAKK--
RNFH_ERWT9            ----EIDLQENKVGIFSRPVKLHDE--VNGGDRVEIYRPLIADPKDLRRQRAERAAKK--
RNFH_YERPB            ----DIDLEKNKVGIYSRPVKLGDK--LNDGDRVEIYRPLIADPKELRRQRAEQAKK---
RNFH_SERP5            ----DIDLQSNKVGIYSRPAKLADV--LSDGDRVEIYRPLIADPKELRRQRAEKAKK---
Y3376_PHOLL           ----DIDLQKNKLGVYSRPVKLTDI--LEEGDRVEIYRPLLADPKEMRRKRAERAKNNAQ
C6CIM0_DICC1          ----DIDLGVNKIGIFSRPAKLSDV--LNDGDRVEIYRPLLADPKELRRQRAERSKNKAR
D2BT22_DICZ5          ----DIDLSVNKIGIFSRPAKLSDV--LSDGDRVEIYRPLLADPKELRRQRAERSKNKAR
RNFH_SODGM            ----DIDLSVNKVGIFSRPAKLEDT--LSDGDRVEIYRPLLIDPKELRRQRADRTRK---
RNFH_PROMH            ----DIDLTKNKVGIYSRPAKLSDN--VRDGDRVEIYRPLIADPKEMRRKRAEKARQKTE
RNFH_MANSM            ----DIDLRENKIGIFSRPVKLTDS--LNDGDRIEIYRPLLADPKEIRRKRAAQQAKDQE
RNFH_ACTSZ            ----DIDLRKNKIGIFARPVKLTDV--LKNGDRIEIYRPLLADPKEIRRKRAAQQAARQK
Y166_PASMU            ----EIDLRENKVGIFSRPAKLTDQ--LKDGDRIEIYRPLLADPKEIRRKRAEQQAAQAK
Y395_HAEIN            ----EIDLSTNKIGIFSRPIKLTDV--LKEGDRIEIYRPLLADPKEIRRKRAAEQAAAKD
Y1828_HAEDU           ----EIDLRINKVGIFSRPAKLTDY--VAHGDRIEIYRPLVADPKEIRRKRAAEQAQKA-
B0BSR3_ACTPJ          ----EIDLRTNKVGIFSRPVKLTDM--VENGDRIEIYRPLIADPKEIRRKRAAEQNKK--
Y369_VIBVU            ----EIDLGKNKVGVFSRLVKLDAT--VRDKDRIEIYRPLLADPKEIRRKRAEQAKESGA
Y646_VIBPA            ----EIDLAKNKVGVFSRNVKLDAT--VRDKDRIEIYRPLLADPKEIRRKRAEQAKAAGN
Y850_VIBCH            ----EIDLTVNKVGIFSRNVKLDAR--VRDKDRIEIYRPLLADPKEIRRKRAEQAKAAAN
RNFH_ALISL            ----DIDLVVNKVGVFSRNVKLDAT--IRDKDRIEIYRPLLADPKEIRRKRAAQAKKEAA
RNFH_TOLAT            ----EIDLAVNKVGLFGRAVALSTR--LERPTRIEIYRPLLADPKEIRRQRAEKAKLQSL
RNFH_PSEA6            ----DIDLSKSKVGIWNRTCKLSDV--PQDGDRIEIYRPLIADPKEARRRRAEKAKEEGR
RNFH_PSEHT            ----EIDATALTLGVWNRTVKPNQE--LKEGDRIEIYRPLIADPKDARRKRAEKAKEEGR
Y1475_SHEON           ----EIELETVKLGVFSNVVKHDQV--ILPGQRVEIYRPLIADPKDVRRRRADKAKDEGR
A0KZF7_SHESA          ----EIDLETVKLGVFSNVVKHDQV--ILPGQRVEIYRPLIADPKDVRRRRADKAKDEGR
Q12PU9_SHEDO          ----EIDLDTVKLGTFSRQVKHDDV--IEPGQRVEIYRPLIADPKDVRRKRAEKAKDEGR
RNFH_LARHH            ----GIDADTMKIGIFSRPVKADTV--LREHDRVEIYRPLIADPKAVRRARAEAGKAMKK
Y3462_CHRVO           ----ELDRTALKLGVFGKAAKPDAA--LREHDRVEIYRPLLADPKEVRRQRAEAGKRMKK
D7DHI7_METV0          ----EIDLAVNKVGIFGKLTKLDAQ--LRHLDRVEIYRSLIADPKEVRKQRVADGKVMKK
G0A3A9_METMM          ----EIDLSVQEIGIFGSACKRDKT--IADGDRVEIYRPLVQDPMEARRNRVRK------
RNFH_RHOS1            ----EIDLEVNKVGIFGAICPLDRT--LAEGDRVEIYRPIHPEAELLEKKR---------
RNFH_RHOS4            ----EIDLAVNKVGIFGAICPLDRT--LAEGDRVEIYRPIHPEAELLEKKR---------
A4WXG8_RHOS5          ----EIDLAVNKVGIFGAICPLDRT--VKEGDRVEIYRPIHPEAELLEKKS---------
RNFH_MAGSA            ----EIDLETQKVGIFGKAAALDAV--VEEGARIEIYRPITVDPKTVKRRAAPEAPAAGG
RNFH_AZOVD            ----DIDLKKQKVGVFGKFVKLDSP--LKDGDRIEIYQRVT---------RVDDDDDDDD
A0A1G3DP43_9GAMM      ----DIDLSKQKVGVYGKFVKLDSP--LKEGDRVEIYQRIT---------RVLDEDDDDD
RNFH_METCA            ----EIDLSVQKVGIFGKLVKLDAP--VKEGDRIEIYRPITADPKTVRRRKIASDDDDDD
D3RMP7_ALLVD          ----EIDLDANKVGIFGKLAKLDQA--VEEGDRIEIYRPLIADPKTARKRRAA-------
RNFH_PSEAB            ----GLDVQGCPLGIFGKLLARPEERVLETGERVEIYRPLIADPKEVRKQRAARARSERE
YOM2_PSEAE            ----GLDVQGCPLGIFGKLLARPEERVLEAGERVEIYRPLIADPKEVRKQRAARARSERE
RNFH_PSEA7            ----ELDIHCCPLGIFGKALANPEERPLEAGERVEIYRPLIADPKEVRKQRAARARAER-
RNFH_PSEMY            ----ELDLHHAPLGIFGKAVAKPEERVLEEGERVEIYRPLIADPKEVRKQRAAKAKTREE
RNFH_PSEF5            ----ELDLAACPVGIFGKQVSDPEQHVIQAGDRIEVYRPLLADPKEVRRLRAAKAAEARK
RNFH_PSEPF            ----ELDLISCPLGIFGKVIADPDARRVQEGDRIEIYRPLLADPKEVRRLRAAKAAEAKA
RNFH_PSE14            ----ELDLAQCAVGIFGKVVADPSTRVLEAGERIEIYRPLLADPMEIRRLRAARAREKRT
Y4512_PSESM           ----ELDLSHCPVGIFGKVVADPAARVLEAGERIEIYRPLLADPMEIRRLRAAKAREKRT
RNFH_PSEU2            ----ELDLSQCAVGIFGKVVTDPAARVLEAGERIEIYRLLVADPMEIRRLRAARAREKRG
RNFH_PSEE4            ----GLDLPGSPVGIFGKVVSEPAVRLVEEGDRLEVYRPLLADPKETRRQRAAKAKAARE
RNFH_HAHCH            ----QIELDSAKMGIFGKSIPEPKSHALREGDRVEIYRPLKIDPKQARLNRAKKG-----
E4PPI0_MARAH          ----EIDPDTIDMGVFGKVIKDPAAHELREGDRVELYRPLKIDPKQARLNRAKKKDQAQ-
RNFH_ALCBS            ----DLDLDKAPMGVFGKVVANPAGHILKPGERVEIYRPLTADPKLNRKRRAKEKASAGK
Y1303_COXBU           ----EINLSQAIVGIHNKRTALDAG--LRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRM
RNFH_COXB1            ----EINLSQAIVGIHNKRTALDAG--LRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRM
RNFH_COXBR            ----EINLSQAIVGIHNKRTALDAG--LRDDDRIEIYRPLTMDPKQARLLRAKRGKIRRM
RNFH_PSYIN            ----EIIPSEAMVGIFSRADKLSSI--VKAGDRIEIYRPLTADPKEMRKLRAAKMSKK--
Y1376_XYLFT           --EQ-----AVGYAVFGVLVTSDHV--LNDGDRVELLRPLLIDPKEARRR-----RAVSA
Y2346_XYLFA           --EQ-----AVGYAVFGVLVTSDHV--LNEGDRVELLRPLLIDPKEARRR-----RAVSA
B2FMX7_STRMK          --DR-----CPAVAVHGVLARPQQV--LLEGDRIELLRPLLADPKDNRRR-----RALGG
A0A3T0NZN7_BORBO      --HPGQDPWAHGVGVFGKAQAADAP--LADGDRVEIYRGLSFDPKESRRRRAEHRRALAA
Q7WA39_BORPA          --HRGQDPWAHGVGVFGKAQAADAP--LADGDRVEIYRGLSFDPKESRRRRAEHRRALAA
C5CLX4_VARPS          FPQLDWR-EAMTPGIWGREVGWEQP--LEDGDRVELCRPLAVDPKVARRERFQRQGARGT
A1WPQ1_VEREI          APRDDAGGRPASLGIWGQAVGPDAP--LQHLDRIEIYRPLKVDPKLARRQRFARQGARTA
D5WYV7_THIK1          HPELTWI--DILYGIDGQRVMLQQV--LQDGDRIDLCRPLQVDPMTARRLRAAASKPRR-
A0A5B2ZK44_9GAMM      ----VDLPEPLQLGIFGVKVETDAV--VHAGDRVEVYRPLMINPKDIRRKRAAKNPVGRY
RNFH_HALHL            --HPEIDLTRQSVGVFGQIVGLDTP--LHNGDRVEVYRPLQVDPKEARKRR----AARKA
RNFH_PARXL            ----QIDLDTQKVGVFGKLKPLDAV--LNDHDRVEIYRPLLVDPKVSRQRRVEKTRKAGS
RNFH_PARP8            ----EIDLTKHKTGVYGKLKPLDAV--LADHDRVEIYRPLIVDPKLARQRRVEKSRQEGS
RNFH_BURM9            ----DIDASALKTGIFGKLAPLDAP--VADGDRVEIYRPLIVDPKLARQRRVDKTRREGS
Y1426_RALSO           ----GLSIDACRLGVYGKRKAPDAL--LHAHDRVEITGPLIADPKAARRRRVRRVRATGT
A0A347CVC0_RALSL      ----GLSIDTCRLGVYGKRKTPDAL--LHASDRVEITGPLIADPKAARRRRVRRVRTTGT
RNFH_CUPPJ            ----EIDPSTMRVGIYGKLKTPDTV--VRTGDRVEIYRALTADPKLARRRRVQKTRESGT
Y253_BUCAI            ------SFHHNRIGIYNKTVHLKFK--IKDGDRIEIYRNLTIDPKEWRR--NNVFLSKKL
RNFH_BUCA5            ------SFHHNRIGIYNKTVHLKFK--IKDGDRIEIYRNLTIDPKEWRR--NNIFLSKKL
Y244_BUCAP            ------QFYKNNVGIYNKLVHLNEN--VKNGDRIEIYRNLIIDPKERRRKRSNICLKK--
Y234_BUCBP            ----------NKIGIYGELVSLNHI--LNNKDRLEIYRPLKINPRELRK----QKINRKL
                                   .                  *:::   :                    

Y796_NEIMB            -------------------
RNFH_NEIG1            -------------------
PASI_ECOL6            -------------------
RATB_ECOLI            -------------------
RNFH_ECOLU            -------------------
RNFH_ECO5E            -------------------
RNFH_ESCF3            -------------------
RNFH_CITK8            -------------------
YFJF_SALTY            -------------------
RNFH_KLEP3            -------------------
RNFH_CROS8            -------------------
RNFH_ERWT9            -------------------
RNFH_YERPB            -------------------
RNFH_SERP5            -------------------
Y3376_PHOLL           -------------------
C6CIM0_DICC1          -------------------
D2BT22_DICZ5          -------------------
RNFH_SODGM            -------------------
RNFH_PROMH            -------------------
RNFH_MANSM            EKKKAEKSANKEN------
RNFH_ACTSZ            GKI----------------
Y166_PASMU            KK-----------------
Y395_HAEIN            KEKGA--------------
Y1828_HAEDU           -------------------
B0BSR3_ACTPJ          -------------------
Y369_VIBVU            ADPVTGGKPSPLRKAD---
Y646_VIBPA            ADPVTGGKPNALRK-----
Y850_VIBCH            QS-----------------
RNFH_ALISL            KK-----------------
RNFH_TOLAT            K------------------
RNFH_PSEA6            ANKVTGGRA----------
RNFH_PSEHT            ANKVTGGRPIER-------
Y1475_SHEON           ANKVTGGRVS---------
A0KZF7_SHESA          ANKVTGGRVS---------
Q12PU9_SHEDO          INKITGAKVS---------
RNFH_LARHH            GGGDGDTP-----------
Y3462_CHRVO           GG-----------------
D7DHI7_METV0          GGGDATPEA----------
G0A3A9_METMM          -------------------
RNFH_RHOS1            -------------------
RNFH_RHOS4            -------------------
A4WXG8_RHOS5          -------------------
RNFH_MAGSA            TES----------------
RNFH_AZOVD            D------------------
A0A1G3DP43_9GAMM      D------------------
RNFH_METCA            D------------------
D3RMP7_ALLVD          -------------------
RNFH_PSEAB            GG-----------------
YOM2_PSEAE            GG-----------------
RNFH_PSEA7            GD-----------------
RNFH_PSEMY            GEEPA--------------
RNFH_PSEF5            RES----------------
RNFH_PSEPF            RNQ----------------
RNFH_PSE14            LPG----------------
Y4512_PSESM           LPG----------------
RNFH_PSEU2            LPG----------------
RNFH_PSEE4            R------------------
RNFH_HAHCH            -------------------
E4PPI0_MARAH          -------------------
RNFH_ALCBS            ASN----------------
Y1303_COXBU           VRGEAG-------------
RNFH_COXB1            VRGEAG-------------
RNFH_COXBR            VRGEAG-------------
RNFH_PSYIN            -------------------
Y1376_XYLFT           -------------------
Y2346_XYLFA           -------------------
B2FMX7_STRMK          -------------------
A0A3T0NZN7_BORBO      RGGKARPAGLL--------
Q7WA39_BORPA          RGGKARPAGLL--------
C5CLX4_VARPS          GLFANRRKGGKAGY-----
A1WPQ1_VEREI          GLFARQR-SGKPG------
D5WYV7_THIK1          -------------------
A0A5B2ZK44_9GAMM      IKGNRFKQSAQ--------
RNFH_HALHL            S------------------
RNFH_PARXL            IEGRRWQNKDSR-------
RNFH_PARP8            VEGRKWLPKDSR-------
RNFH_BURM9            IEGRKWLPKDSR-------
Y1426_RALSO           REGLKWLRNEAPPEDDVAG
A0A347CVC0_RALSL      REGQKWLRNEAPPEDDVTE
RNFH_CUPPJ            REGQKWLRGGA--------
Y253_BUCAI            KKIY---------------
RNFH_BUCA5            KKIY---------------
Y244_BUCAP            -------------------
Y234_BUCBP            K------------------