CLUSTAL format seed alignment for MF_00465

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SPED_ALCBS      MKRPWGKAVVKDPNPKITVHGFNNLTKSLSFNIFDIAYAKTEQHRQEYIEYIDELYNAER
SPED_CHRSD      ------------MTDNLRLHGFNNLTSSLSFNIYDICYAKTEEQRKAYIDYIDELYNAER
SPED_MARHV      ------------METKLQLHGFNNLTKSLSFNIYDICYAQTEEQREAYIDYIDEMYNAER
SPED_HAHCH      ------------MSEKLKLHGFNNLTKSLSFNIYDICYAQSEKHRQEYIAYIDEQYNAER
SPED_HALHL      ---------MVDY-TRIRLHGFNNLTKSLSFNIYDVCYAKTEAQRRAYIEYIDEEYNAER
SPED_ALKEH      ---------MAEHGSRVSLHGFNNLTKSLSFNIYDVCYAKTAEQRHAYIEYIDEVYNAER
SPED_METCA      ------------MDNKLQLHGFNNLTKSLSFNIYDICYAKSEAGQRRYIEYIDEAYSAKR
SPED_PSEAE      ------------MKSKLKLHGFNNLTKTLSFNIYDICYAETPEDLQAYVQYIDEEYDAER
SPED_PSEAB      ------------MKSKLKLHGFNNLTKTLSFNIYDICYAETPEDLQAYVQYIDEEYDAER
SPED_PSEA7      ------------MKSKLKLHGFNNLTKTLSFNIYDICYAETPEDLQAYVQYIDEEYDAER
SPED_PSE14      ------------MKSKLKLHGFNNLTKTLSFNIYDICYAETPQDQQAYVEYINSVYDAER
SPED_PSESM      ------------MKSKLKLHGFNNLTKTLSFNIYDICYAETPQDQQAYVEYINSVYDAER
SPED_PSEU2      ------------MKSKLKLHGFNNLTKTLSFNIYDICYAETPQDQQAYVEYINSVYDAER
SPED_PSEPF      ------------MKSKLKLHGFNNLTKTLSFNIYDICYAETPQDQQAYVEYINQEYNAER
SPED_NITOC      ---------MTRAFNKIKLHGFNNLTKTLSFNVYDICYAQTFQQRREYIEYIDEEYNAER
SPED_SHIF8      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SHISS      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SHIFL      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SHIBS      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECOSM      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECODH      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECO5E      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECOLI      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECOLC      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECOHS      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECO57      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECO24      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SHIB3      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SHIDS      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ECOUT      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTTEERDGYIAYIDELYNANR
SPED_ECOL6      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTTEERDGYIAYIDELYNANR
SPED_ECOL5      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTTEERDGYIAYIDELYNANR
SPED_SALA4      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALTY      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALNS      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALSV      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALPB      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALDC      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALEP      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALPK      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALPA      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALTI      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALG2      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALHS      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALCH      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_SALAR      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_CITK8      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_KLEP3      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_KLEP7      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_CROS8      -------------MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNANR
SPED_ENT38      -------------MKKLKLHGFNNLTKSLSFCIYDICYVKTAEERDGYIAYIDELYNANR
SPED_ERWT9      -----------MKLQKLKLHGFNNLTKSLSFCIYDICYANTEAERDGYIAYIDEQYNANR
SPED_YERPE      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERP3      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERPP      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERPA      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERPN      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERPB      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERPG      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERPY      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERPS      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_YERE8      -------------MSKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYIAYIDEQYNANR
SPED_PECAS      -------------MHKLKLHGFNNLTKSLSFCIYDICYTKTADDRDGYIAYIDEQYNANR
SPED_SERP5      -------------MHKLKLHGFNNLTKSLSFCIYDICYAKTADDRAGYIAYIDEQYNANR
SPED_SODGM      -------------MQKLKLHGFNNLTKSLSFCIYDICYAKTADDRDGYITYIDEQYNANR
SPED_PHOLL      -------------MHKLKLHGFNNLTKSLSFCIYDICYAKSQADRDSYIAYIDEQYNANR
SPED_BUCAP      -------------MQKLKLYGFNNLTKSLSFCIYDICYANTNDSRNSYISYIDEQYNAIR
SPED_PSET1      ---------MNKPFDKLKLHGFNNLTKSLSFSIYDICYAKTEQQRKEYIEYIDEQYSADR
SPED_STRM5      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEEYNADR
SPED_STRMK      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEEYNADR
SPED_XANCB      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XANCP      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XANC8      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XANAC      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XANC5      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XANOP      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XANOR      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XANOM      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIEYIDEQYDADR
SPED_XYLF2      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIDYIDERYDADR
SPED_XYLFT      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIDYIDERYDADR
SPED_XYLFM      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIDYIDERYDADR
SPED_XYLFA      ---------MVKPLPRLRLQGFNNLTKALSFNIYDVCYARTEEERQRYIDYIDERYDADR
SPED_GEOKA      ----------MNETPRVKLHGFNNLTKSLSFNMYDICYTKTAKEREAYIEYIDDVYNAER
SPED_GEOTN      ----------MNDTPHVKLHGFNNLTKSLSFNMYDICYTKTPKEREAYISYIDDVYNAER
SPED_CLOAB      --------MKVNIDNKIKLHGFNNLTKTLSFNMYDICYAKSAEDREAYISYIDEQYNADR
SPED_DESHY      --------MEVKPLKKLKLYGFNNLTKTLSFNMYDICYAKTPEHRDAYIQYIDEEYNAQR
SPED_HELMI      --------MEIKSIKKLKLYGFNNLTKTLSFNMYDICYAKTPEHRKAYIEYIDEEYNSER
SPED_ALKMQ      --------MDIKSFEKIQLYGFNNLTKTLSFNIYDICYAKAPEQSKAYIAYIDEQYNAER
SPED_CLOBA      --------MMLGLENKLKLYGFNNLTKTLSFNIYDVCYAKSEREQKDYIAYIDEQYNSER
SPED_CLOBB      --------MMLGLENKLKLYGFNNLTKTLSFNIYDVCYAKSEREQKDYIAYIDEQYNSER
SPED_CLOB8      ---------MLGLENKLKLYGFNNLTKTLSFNIYDVCYAKSEREQKDYIAYIDEQYNSER
SPED_ALKOO      ---------MLGLEKKLTLYGFNNLTKTLSFNIYDVCYAKSEKAQKAYIEYIDEQYNSER
SPED_CLOPE      ---------MLGLKEKICLYGFNNLTKTLSFNIYDICYAKTEREKEDYIKYIDEQYNSER
SPED_CLOP1      ---------MLGLKEKICLYGFNNLTKTLSFNIYDICYAKTEREKEDYIKYIDEQYNSER
SPED_CLOPS      ---------MLGLKEKICLYGFNNLTKTLSFNIYDICYAKTEREKEDYIKYIDEQYNSER
                               .: : ******.:*** ::*:.*..:      *: **:. *.: *

SPED_ALCBS      LTEILTNVTNIIGANILNVARQDYEPQGASVTMLIAEHETPP-----------V-GTDWD
SPED_CHRSD      LTQILKDVTNIIGAHVLNISRQDYEPHGASVTILIAEHELDE-----------H-DPEHI
SPED_MARHV      LTQILTDVVKIIGANVLNIARQDYEPHGASVTMLIAEHELSD-----------S-EANN-
SPED_HAHCH      LTQILTDVVEIIGAHILNVSRQDYDPHGASVTMLIAEHEVPP-----------P-ADSS-
SPED_HALHL      LTEILTNVAEIIGANVLNVARQDYDPQGASVTILISEGPVSP-----------EEAEESA
SPED_ALKEH      LTQILTDVADIIGANILNIARQDYEPQGASVTILISEEPVSE-----------AVAEAAD
SPED_METCA      LTQILTDVNAIIGAEILNIARQDYEPQGASVTMLISEGHEAP-----------AAITNS-
SPED_PSEAE      LTQILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTP-----------T--DSQI
SPED_PSEAB      LTQILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTP-----------T--DSQI
SPED_PSEA7      LTQILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTP-----------T--DSQI
SPED_PSE14      LTRILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTP-----------T--ESQI
SPED_PSESM      LTRILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTP-----------T--ESQI
SPED_PSEU2      LTRILTDVVDIIGANILNIARQDYDPQGASVTILISEQPVTP-----------T--ESQI
SPED_PSEPF      LTQILTEVVEIIGANILNIASQNYEPQGASVTILISEEPVTP-----------T--ESQI
SPED_NITOC      LTHILTEVAEIIGANILNVARQNYEPQGASVTMLIAEDETEI-----------H-QQFTN
SPED_SHIF8      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_SHISS      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_SHIFL      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_SHIBS      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECOSM      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECODH      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECO5E      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECOLI      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECOLC      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECOHS      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECO57      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECO24      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_SHIB3      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_SHIDS      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECOUT      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECOL6      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_ECOL5      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDKT
SPED_SALA4      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPID------------PKLIDQT
SPED_SALTY      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPID------------PKLIDQT
SPED_SALNS      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPID------------PKLIDQT
SPED_SALSV      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPID------------PKLIDQT
SPED_SALPB      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPID------------PKLIDQT
SPED_SALDC      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_SALEP      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_SALPK      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_SALPA      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_SALTI      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPID------------PKLIDQT
SPED_SALG2      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_SALHS      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_SALCH      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_SALAR      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPMD------------PKLIDQT
SPED_CITK8      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PQLIDKT
SPED_KLEP3      LTEILTETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_KLEP7      LTEILTETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PKLIDQT
SPED_CROS8      LTEILTETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PQLIDKT
SPED_ENT38      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PQLIDPT
SPED_ERWT9      LTEILSETCSIIGANVLNIARQDYEPQGASVTILVSEEPID------------PRDIDTS
SPED_YERPE      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERP3      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERPP      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERPA      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERPN      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERPB      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERPG      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERPY      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERPS      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_YERE8      LTEILTETCSIIGANILNIARQDYDPQGASVTILVSEEPVD------------PRDVDTS
SPED_PECAS      LTEILTETCSIIGANVLNIARQDYDPQGASVTILVSEEPID------------PRDVDTS
SPED_SERP5      LTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVD------------PNDVDTS
SPED_SODGM      LTEILSETCSMIGANILNIARQDYEPQGASVTILVSEEPVD------------PGSIDTS
SPED_PHOLL      LTEILSETCSIIGANILNIARQDYDPQGASVTILVSEEPMD------------PKDVDNT
SPED_BUCAP      LTKILKKTCSIIGANVLNVFHQDYEPQGASVTILVCEEPIN------------LEKVNIV
SPED_PSET1      LTDILGEVVDIIGANILNVARQDYEPQGASVTILVSEEPVEE-----------QQNYDAD
SPED_STRM5      LTQILTDVAEIIGANILNVARQDYDPQGASVTILISEEPVI----------------DKK
SPED_STRMK      LTQILTDVAEIIGANILNVARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANCB      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANCP      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANC8      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANAC      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANC5      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANOP      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANOR      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XANOM      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XYLF2      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XYLFT      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XYLFM      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_XYLFA      LTQILTDVAEIIGANILNIARQDYDPQGASVTILISEEPVI----------------DKK
SPED_GEOKA      LTNILKRVADMIGAHVLNIAKQDYVPQGASVAMLVSEGPVVE-----------------V
SPED_GEOTN      LTNILKHVADIIGAHVLNIAKQDYVPQGASVTMLVSEGPVVE-----------------V
SPED_CLOAB      LTEILTNVTEIIGANILNIAKQDYDPQGASVTILVCENPIEE-----------ERKEALV
SPED_DESHY      LTSIVTEVARIVGANILNIAKQDYDPQGASVTMLIAEEHLGPENPDD----NPFDPVYTD
SPED_HELMI      LTNILIEVANIIGANILNIAKQDYDPQGASVTMLISEGKVEQDVENGQGNGNAIGSATDC
SPED_ALKMQ      LTKILSNVADITGANILSISKQDYDPQGASVTMLVAEEMTVPT----------LTPESLT
SPED_CLOBA      LTNILCDVTEMIGAHVLNISKQDYDPQGASVTILISEETLAV-----------KEIDKSC
SPED_CLOBB      LTNILCDVTKMIGAHVLNISKQDYDPQGASVTILISEETLAV-----------KEIDKSC
SPED_CLOB8      LTRILCDVTESIGAHVLNISKQDYDPQGASVTILVSEQTLAV-----------KEIDASC
SPED_ALKOO      LTKILCDVTEMIGAHVLNISKQDYEPQGASVNILITEEALPL-----------HLIDESC
SPED_CLOPE      LTKILCDVTEMIGAHVLNISKQDYEPQGASVNVLITEEALPV-----------ALIDPSC
SPED_CLOP1      LTKILCDVTEMIGAHVLNISKQDYEPQGASVNVLITEEALPV-----------ALIDPSC
SPED_CLOPS      LTKILCDVTEMIGAHVLNISKQDYEPQGASVNVLITEEALPV-----------ALIDPSC
                ** *:  .    **.:*.:  *:* *:**** :*: *                       

SPED_ALCBS      EEGPG--------PLPETVVAHLDKSHVTVHTYPESHPDNGISTFRVDVDVSTCGVISPL
SPED_CHRSD      EPGPG--------PLPQTVLGHLDKSHVTVHTYPESHPDNGISTFRLDIDVSTCGMISPL
SPED_MARHV      EESPG--------PLPDTIVAHLDKSHVTVHTYPESHPHDGVSTFRADIDVSTCGLISPL
SPED_HAHCH      EESPG--------PLPDAVVAHLDKSHVTVHTYPESHPDNGISTFRADIDVSTCGLISPL
SPED_HALHL      EARPG--------PLPDDVVAHLDKSHITVHTYPEMHPDKGVSTFRADIDVSTCGVISPL
SPED_ALKEH      QVGPG--------PLPETVLGHLDKSHITVHTYPESHPDHGVSTFRADIDVSTCGVISPL
SPED_METCA      -ESPG--------PMPEAVVAHLNKSHITVHTYPESHPHAGISTFRADIDVSTCGRISPL
SPED_PSEAE      EESPG--------PLPDTILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPL
SPED_PSEAB      EESPG--------PLPDTILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPL
SPED_PSEA7      EESPG--------PLPDTILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPL
SPED_PSE14      EESPG--------PLPETILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPL
SPED_PSESM      EESPG--------PLPETILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPL
SPED_PSEU2      EESPG--------PLPETILAHLDKSHITVHTYPEIHPVDGIATFRVDIDVSTCGVISPL
SPED_PSEPF      EESPG--------PLPEIILAHLDKSHITVHTYPEIHPDAGIATFRVDIDVSTCGVISPL
SPED_NITOC      AEEPG--------PLPESLVCHLDKSHLTVHTYPESHPENGISTFRADIDVSTCGRVSPL
SPED_SHIF8      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SHISS      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SHIFL      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SHIBS      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECOSM      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECODH      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECO5E      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECOLI      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECOLC      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECOHS      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECO57      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECO24      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SHIB3      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SHIDS      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECOUT      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECOL6      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ECOL5      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALA4      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALTY      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALNS      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALSV      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALPB      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALDC      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALEP      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALPK      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALPA      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALTI      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALG2      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALHS      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALCH      KHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SALAR      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_CITK8      EHPG---------PLPEAVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_KLEP3      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_KLEP7      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_CROS8      EHPG---------PLPETVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_ENT38      EHPG---------PLPEAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_ERWT9      EHPG---------PLPNSVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_YERPE      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERP3      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERPP      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERPA      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERPN      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERPB      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERPG      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERPY      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERPS      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEAGLCTFRADIEVSTCGVISPL
SPED_YERE8      EHPG---------PLPSAVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_PECAS      EHPG---------PLPNSVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SERP5      EHPG---------PLSKTVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_SODGM      EHPG---------PLPESVVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPL
SPED_PHOLL      ENPG---------PLPDSVVAHLDKSHICVHTYPESHPGGGICTFRADIEVSTCGVISPL
SPED_BUCAP      NKSNK--------IISSSVLAHLDKSHICVHTYPESHPQSGICTFRADIEVSTCGIISPL
SPED_PSET1      EAPG---------PLPDSVVAHLDKSHICVHTYPEAHPDDGICTFRADIEVSTCGIISPL
SPED_STRM5      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_STRMK      LAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANCB      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANCP      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANC8      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANAC      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANC5      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANOP      QAGRE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANOR      QAGRE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XANOM      QAGRE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XYLF2      QAGKE--------LISDAVVTHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XYLFT      QAGKE--------LISDAVVTHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XYLFM      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_XYLFA      QAGKE--------LISDAVVAHMDKSHITVHTYPETHPQEGIATFRADIDVATCGVISPL
SPED_GEOKA      PEDDG--------PLPEAVVLSLDKSHITVHTYPEYHPNDGISTFRADIDVVTCGEISPL
SPED_GEOTN      PQAEA--------PLPEAVVLSLDKSHITVHTYPEYHPSDGISTFRADIDVVTCGEISPL
SPED_CLOAB      KETPG--------PLPEIVLAHLDKSHITVHTYPEYHPDEGICTFRADIDVSTCGMISPL
SPED_DESHY      KEGP----------LPDAVVAHLDKSHITVHTYPESHPHGGISTFRADIDVSTCGQISPL
SPED_HELMI      DNGDGKAGEDCALLIPNAVAAHLDKSHITVHTYPESHPDKGISTFRADIDVSTCGMISPL
SPED_ALKMQ      GESPGPLPGNK--PSPGSIVTHLDKSHVTVHTYPETHPLDGISTFRADIDVSTCGHISPI
SPED_CLOBA      NLGQI-----DILKTRDTIVGHLDKSHVTVHTYPEYHPDNSIATFRVDIDVSTCGEVSPV
SPED_CLOBB      NLGQI-----DILNTRDTIVGHLDKSHVTVHTYPEYHPDNSIATFRVDIDVSTCGEVSPL
SPED_CLOB8      NKGEI-----DILKTRDTVVGHLDKSHVTVHTYPEYHPDNSIATFRVDIDVATCGEVSPL
SPED_ALKOO      NKGE------GIAAQRDTIHAHLDKSHVTVHTYPEYHPDNAISTFRVDIDVSTCGMISPL
SPED_CLOPE      NKGEL-----SYLELRDSVVGHLDKSHLTVHTYPEFHPNNDIISFRVDIDVSTCGKISPL
SPED_CLOP1      NKGEL-----SYLELRDSVVGHLDKSHLTVHTYPEFHPNNDIISFRVDIDVSTCGKISPL
SPED_CLOPS      NKGEL-----SYLELRDSVVGHLDKSHLTVHTYPEFHPNNDIISFRVDIDVSTCGKISPL
                                  :   ::***: ****** **   : :** *::* *** :**:

SPED_ALCBS      RALNYLIHSFDSDIVTVDYRVRGMTRDLDGTKHYIDHDINSIQNFLTEDTQNAYQMIDVN
SPED_CHRSD      KALNYLIHSFDSDIVTTDYRVRGFTRDVDGRKLFIDHDITSIQDYLAEDTKRAYQMVDVN
SPED_MARHV      KVLNYLIHSFDSDVVTVDYRVRGFTRDVDGTKHYIDHDINSIQNYLTEDTQNAYQMIDVN
SPED_HAHCH      KALNYLIHSFDSDIVTIDYRVRGFTRDIDGAKLYIDHDINSIQNFLSEDTQEAYQMIDVN
SPED_HALHL      TALNYLIHSFDSDIVTMDYRVRGFTRDVEGHKHFIDHEINSIQNYLSEDTKERYQTLDVN
SPED_ALKEH      KALNYLIHSFDSDIVTMDYRVRGFTRDVRGRKHFIDHDINSIQNYLADDTKERYHTIDVN
SPED_METCA      KALNYLIHSFESDIVIMDYRVRGFTRDISGQKHYIDHDITSIQNYISDATADRYQMIDVN
SPED_PSEAE      KALNYLIHQFDSDIVTVDYRVRGFTRDIEGRKHFIDHEINSIQNYLSDDTREAYQMTDVN
SPED_PSEAB      KALNYLIHQFDSDIVTVDYRVRGFTRDIEGRKHFIDHEINSIQNYLSDDTREAYQMTDVN
SPED_PSEA7      KALNYLIHQFDSDIVTVDYRVRGFTRDIEGRKHFIDHEINSIQNYLSDDTREAYQMTDVN
SPED_PSE14      KALNYLIHKFESDIVTVDYRVRGFTRDVEGKKHFIDHEINSIQNYLSEDTRNGYQMTDVN
SPED_PSESM      KALNYLIHKFESDIVTVDYRVRGFTRDVEGKKHFIDHEINSIQNYLSEDTRNGYQMTDVN
SPED_PSEU2      KALNYLIHKFESDIVTVDYRVRGFTRDVEGKKHFIDHEINSIQNYLSEDTRNGYQMTDVN
SPED_PSEPF      KALNFLIHQFDSDIVTVDYRVRGFTRDVEGNKHFIDHEINSIQNYLSEDTRDAYQMTDVN
SPED_NITOC      RALNYLIHSLESDIVTMDYRVRGFTRNVYGGKHFIDHAINSIQNFIAEDTKGRYHMIDVN
SPED_SHIF8      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_SHISS      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_SHIFL      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_SHIBS      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECOSM      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECODH      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECO5E      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECOLI      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECOLC      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECOHS      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECO57      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_ECO24      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_SHIB3      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVN
SPED_SHIDS      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDGMKALYDMVDVN
SPED_ECOUT      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSEDMKALYDMVDVN
SPED_ECOL6      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSEDMKALYDMVDVN
SPED_ECOL5      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSEDMKALYDMVDVN
SPED_SALA4      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALTY      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALNS      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALSV      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALPB      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALDC      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALEP      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALPK      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALPA      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALTI      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALG2      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALHS      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALCH      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_SALAR      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVN
SPED_CITK8      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSDDMKSLYDMVDVN
SPED_KLEP3      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDIKSLYDMVDVN
SPED_KLEP7      KALNYLIHQLESDIVTIDYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKSLYDMVDVN
SPED_CROS8      KALNYLIHQLESDIVTIDYRVRGFTRDVNGMKHFIDHEINSIQNFMSDDIKSLYDMMDVN
SPED_ENT38      NALNYLIHQLESDIVTIDYRVRGFTRDINGMKYFIDHEINSIQNFMSEDMKGLYDMMDVN
SPED_ERWT9      KALNYLIHQLESDIVTIDYRVRGFTRDVNGVKHFIDHEINSIQNFMSEDMKSMYDMMDVN
SPED_YERPE      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERP3      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERPP      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERPA      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERPN      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERPB      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERPG      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERPY      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERPS      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_YERE8      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHFIDHKINSIQNFMSDDMKSLYHMMDVN
SPED_PECAS      KALNYLIHQLESDIVTIDYRVRGFTRDINGVKHFIDHQINSVQNFMSEDMKSLYHMMDVN
SPED_SERP5      KALNYLIHQLESDIVTMDYRVRGFTRDVNGVKHYIDHEINSIQNFMSDDMKALYHMMDVN
SPED_SODGM      KALNYLIHQLESDIVTMDYRVRGFTRDINGVKHYIDHEINSIQNFMSKDMKALYHMMDVN
SPED_PHOLL      KALNYLIHKLESDIVTMDYRVRGFTRDVNGMKHYIDHEISSIQNYMTEEVQSQYYMMDVN
SPED_BUCAP      NALNYLIHQLESDIVTIEYRVRGFTRDIHGIKHFIDHKINSIQNFMSHDIKSMYEMFDVN
SPED_PSET1      KALNFLIHSLESDVVTIDYRVRGFTRDINGVKHYIDHAISSIQNFMTEDTKEAYQMMDVN
SPED_STRM5      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQNFLAKNIKSRYEMFDVN
SPED_STRMK      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHFIDHKINSIQNFLAKNIKSRYEMFDVN
SPED_XANCB      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQHFLAKNVKSRYEMFDVN
SPED_XANCP      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQHFLAKNVKSRYEMFDVN
SPED_XANC8      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQHFLAKNVKSRYEMFDVN
SPED_XANAC      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQQFLAKNVKSRYEMFDVN
SPED_XANC5      KALNYLIESLESDIVIMDYRVRGFTRDVKGRKHYIDHKINSIQQFLAKNVKSRYEMFDVN
SPED_XANOP      KALNYLIETLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQHFLAKNVKSRYEMIDVN
SPED_XANOR      KALNYLIETLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQHFLAKNVKSRYEMIDVN
SPED_XANOM      KALNYLIETLESDIVIMDYRVRGFTRDVKGKKHYIDHKINSIQHFLAKNVKSRYEMIDVN
SPED_XYLF2      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHFIDHKINSIQNFLSKSIKSRYEMFDVN
SPED_XYLFT      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHFIDHKINSIQNFLSKSIKSRYEMFDVN
SPED_XYLFM      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHFIDHKINSIQNFLSKSIKSRYEMFDVN
SPED_XYLFA      KALNYLIESLESDIVIMDYRVRGFTRDVKGKKHFIDHKINSIQNFLSKSIKSRYEMFDVN
SPED_GEOKA      KALDYLIHSFDADIMIIDYRVRGFTRDIHGYKLFIDHDITSIQDYIPEHIREKYDMIDVN
SPED_GEOTN      KALDYLIQSFEADIMIIDYRVRGFTRDIHGYKLFIDHDITSIQNYIPEDIREKYDMIDVN
SPED_CLOAB      RALNYLVHSFEADIMTMDYRVRGFTRDITGRKLFIDHKINSIQNYIPSNIKTKYNMIDVN
SPED_DESHY      KALNFLIESFAPDIIVADYRVRGFTRDVDGKKVFIDHKINSIQNYVDRKYRDLYQMIDVT
SPED_HELMI      KALNYLINSFSSDIVIADYRVRGFTRDVSGKKYFIDHKINSIQNYIAKETRELYQMIDVN
SPED_ALKMQ      KALNYLIHSFESDIVTIDYRVRGFTRDINGQKYFIDHDINSIQNYIAKDILNLYHAIDVN
SPED_CLOBA      NALNYLIGSFDSDIITIDYRVRGFTRDIDGKKLFIDHKITSIQDYIDENTLKKYDAVDIN
SPED_CLOBB      NALNYLIGSFDSDIITIDYRVRGFTRDVDGKKLFIDHKITSIQDYIDENTLKRYDAMDIN
SPED_CLOB8      NALNYLIGSFDSDIITIDYRVRGFTRDVDGKKLFIDHKITSIQDYIDENTLKRYDAMDIN
SPED_ALKOO      NALDYLIGSFDSDIITIDYRVRGFTRDVEGKKFYIDHNITSIQDYIDDETLKKYDAIDVN
SPED_CLOPE      NALDYLIGSFDSDVITIDYRVRGFTRDVDGRKCYIDHDIKSIQDYIDGETLKKYDAMDVN
SPED_CLOP1      NALDYLIGSFDSDVITIDYRVRGFTRDVDGRKCYIDHDIKSIQDYIDGETLKKYDAMDVN
SPED_CLOPS      NALDYLIGSFDSDVITIDYRVRGFTRDVDGRKCYIDHDIKSIQDYIDEETLKKYDAMDVN
                 .*::*:  : .*::  :*****:**:: * * :*** *.*:*.::       *   *:.

SPED_ALCBS      VYQENIFHTKMLLKDFDIDNYLFGAGRDEFAQTELDQIEERMKTEMLEIFYSRNLG----
SPED_CHRSD      VYQENMFHTKMLLKDFDLDNYLFGSTRRDLTFEEARDIEDRLRKEMLEIFYSRNLD----
SPED_MARHV      VYQENLFHTKMMLKEFNLDNYVFGVNAGDLDPAEAQSIEDRLRREMLEIFYSRNVE----
SPED_HAHCH      VYQENLFHTKMILKEFNLDNYLFGTGVSELNANEASNIRERLQKEMLEIFYSRNMPY---
SPED_HALHL      VYQENIFHTKMILREFDLDNYLFGESSADLDEEEANTIRRHLRREMMEIFAGRNLPANQE
SPED_ALKEH      VFQENLFHTKMMVRELDLENYLFGESAGNLEPAERREIERQLRREMTEIFAGRNLAPDQE
SPED_METCA      VYQEKIFHTKMILKDFNLDNYLFETDKDQLVPEERAHVQKQLQREMAEIFYGRNYKLRR-
SPED_PSEAE      VYQENLFHTKMLLKDFELENYLFGDATRTLSAEQREQVTERLKHEMLEIFYARNMPR---
SPED_PSEAB      VYQENLFHTKMLLKDFELENYLFGDATRTLSTEQREQVTERLKHEMLEIFYARNMPR---
SPED_PSEA7      VYQENLFHTKMLLKDFELENYLFGDATRNLSAEQREQVTERLRHEMLEIFYARNMPH---
SPED_PSE14      VYQENLFHTKMLLKQFELDNYLFGDATSNLSAEQREQVTAKVKHEMLEIFYGRNVAV---
SPED_PSESM      VYQENLFHTKMLLKQFELDNYLFGDATSNLSAEQREQVTAKVKHEMLEIFYGRNVAV---
SPED_PSEU2      VYQENLFHTKMLLKQFELDNYLFGDATSNLSPEQREQVTAKVKHEMLEIFYGRNVAV---
SPED_PSEPF      VYQENLFHTKMLLKNFELDNYLFGDATSNLSSEQRAQVTERVKHEMLEIFYARNMPS---
SPED_NITOC      IYQENIFHTKMMLKDFELDDYLFGGNACDLASQEQQAIADRVKNEMLEIFYGKNIPHPDI
SPED_SHIF8      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_SHISS      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_SHIFL      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_SHIBS      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECOSM      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECODH      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECO5E      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECOLI      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECOLC      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECOHS      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECO57      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECO24      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_SHIB3      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_SHIDS      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECOUT      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECOL6      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_ECOL5      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV--
SPED_SALA4      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALTY      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALNS      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALSV      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALPB      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALDC      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQQITAALWKEMREIYYGRNISAV--
SPED_SALEP      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQQITAALWKEMREIYYGRNISAV--
SPED_SALPK      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQQITAALWKEMREIYYGRNISAV--
SPED_SALPA      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQQITAALWKEMREIYYGRNISAV--
SPED_SALTI      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQQITAALWKEMREIYYGRNISAV--
SPED_SALG2      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALHS      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALCH      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV--
SPED_SALAR      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNMPAV--
SPED_CITK8      VYQENIFHTKMLLKEFDLKHYMFHTKPEDLTETERKEITAALWKEMREIYYGRNIPAV--
SPED_KLEP3      VYQENIFHTKMLLKEFDLKHYMFHTRPEELTAEERKVITDLLWKEMREIYYGRNIPAV--
SPED_KLEP7      VYQENIFHTKMLLKEFDLKHYMFHTRPEELTAEERKVITDLLWKEMREIYYGRNIPAV--
SPED_CROS8      VYQENIFHTKMLLKEFDLKHYMFHTRPEELTEEERKVITDQLWKEMREIYYGRNIPSV--
SPED_ENT38      VYQENIFHTKMLLKEFDLKHYMFHTQPEDLSEEERKVITDLLWKEMREIYYGRNIPAV--
SPED_ERWT9      VYQENMFHTKMLLKEFDLKHYLFNTKPEDLSAQEHKRITDLLWKEMREIYYGRNIPAIG-
SPED_YERPE      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERP3      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERPP      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERPA      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERPN      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERPB      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERPG      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERPY      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITRLLYKEMQEIYYGRNVPEV--
SPED_YERPS      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEEKEQITCLLYKEMQEIYYGRNVPEV--
SPED_YERE8      VYQENIFHTKMMLKDFDLKHYLFNAKPEELSAEERERITHLLYKEMQEIYYGRNVPEV--
SPED_PECAS      VYQENIFHTKMLLKDFDLKHYLFNVNPEELSAAERKRITDLLYHEMQEIYYGRNLPVL--
SPED_SERP5      VYQENIFHTKMLLKDFDLKHYLFNAKPDALSAAERKEITDLLWKEMQEIYYGRNIPHL--
SPED_SODGM      VYQENIFHTKIMLKDFDLKHYLFNARPDDLSAEERKAITDLLYKEMQEIYYGRNLPVL--
SPED_PHOLL      IYQENLFHTKMMLKRFDLNDYLFNATPEQLSEAEKQEITHLLKKEIQEIYYGRNLPTV--
SPED_BUCAP      IYQENIFHTRMLLKEFNLKNYLFNINVKDLSKKEHSYIIDLLWKEMREIYHGKNISMIKK
SPED_PSET1      VYQENLFHTKMMLKETDLNTYLFGLSTDDLSDEEEEEIRSKLTREMQEIFYGRNLPDLD-
SPED_STRM5      VYQENIFHTKMHLKDFDLDQYLFEEKAKNLSFKERMKIEALLKREIEELFHGRNLSE---
SPED_STRMK      VYQENIFHTKMHLKDFDLDQYLFEEKAKNLSFKERMKIEALLKREIEELFHGRNLSE---
SPED_XANCB      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XANCP      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XANC8      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XANAC      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XANC5      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XANOP      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XANOR      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XANOM      VYQENIFHTKMHLKDFDLDQYLFEERAKNLSFKERMKIETLLKREIEELFHGRNLSE---
SPED_XYLF2      VYQENIFHTKMHLKDFDLDQYLFEEKARNLSFKERMKIEALLKLEIEELFHGRNLAE---
SPED_XYLFT      VYQENIFHTKMHLKDFDLDQYLFEEKARNLSFKERMKIEALLKLEIEELFHGRNLAE---
SPED_XYLFM      VYQENIFHTKMHLKDFDLDQYLFEEKARNLSFKERMKIEALLKLEIEELFHGRNLAE---
SPED_XYLFA      VYQENIFHTKMHLKDFDLDQYLFEEKARNLSFKERMKIEALLKLEIEELFHGRNLAE---
SPED_GEOKA      IYQENIFHTKCKLKQFDLDNYLFGYAKEDLSEQEANETTAKLRREMDEIFYGKNMPNTV-
SPED_GEOTN      IYQENIFHTKCKLRQFDLDNYLFGHTKDALSKQEVEETTAKLKREMDEIFYGKNMPSGF-
SPED_CLOAB      VYQENIFHTKCRLKQFDLDNYLFGYTKKDLYPKERKKITHKLKKEMDEIFYGKNFDEVYY
SPED_DESHY      VFQEYIFHTKMILKDFDLDNYLFGTAKKELSINDKRKIKQRLKKEMAEIFYGKNMPRM--
SPED_HELMI      VYQDNIFHTKMLLKEFDLDNYLFGTAKKELLPGEKKKIKQRLKKEMYEIFSGRNIPKV--
SPED_ALKMQ      VYQENIFHTKMTLKDFKLNNYLFGVSEEELSDHESASIKDQLRDEMQEIFYGRNVTKV--
SPED_CLOBA      VYQSNIFHTKMLIKEIELQNYLFNRDVYEIKPKQRLEIENNLRKEMIEIFSGTNIY----
SPED_CLOBB      VYQSNIFHTKMLIKEIELQNYLFNRDVYEIKPKQRLEIENNLRKEMIEIFSGTNIY----
SPED_CLOB8      VYQSNIFHTKMLIKEIELQNYLFNRDVYEIKPKQRLEIENNLRREMIEIFSGTNIY----
SPED_ALKOO      VYQSNIFHTKMLIKEIELQNYLFNKDVNELLPKQRLEITNNLRKEMIEIFSGMNIY----
SPED_CLOPE      VYQSNIFHTKMMLKDIVLNNYLFNSDPYELSPNDRREIRDRISKEMIEIYGGVNIY----
SPED_CLOP1      VYQSNIFHTKMMLKDIVLNNYLFNSDPYELSPNDRREIRDRISKEMIEIYGGVNIY----
SPED_CLOPS      VYQSNIFHTKMMLKDIGLNNYLFNSDPYELSPNDRREIRDRISKEMIEIYGGVNIY----
                ::*. :***:  ::   :. *:*      :   :       :  *: *:: . *      

SPED_ALCBS      -----
SPED_CHRSD      -----
SPED_MARHV      -----
SPED_HAHCH      -----
SPED_HALHL      V----
SPED_ALKEH      V----
SPED_METCA      -----
SPED_PSEAE      -----
SPED_PSEAB      -----
SPED_PSEA7      -----
SPED_PSE14      -----
SPED_PSESM      -----
SPED_PSEU2      -----
SPED_PSEPF      -----
SPED_NITOC      ESSRR
SPED_SHIF8      -----
SPED_SHISS      -----
SPED_SHIFL      -----
SPED_SHIBS      -----
SPED_ECOSM      -----
SPED_ECODH      -----
SPED_ECO5E      -----
SPED_ECOLI      -----
SPED_ECOLC      -----
SPED_ECOHS      -----
SPED_ECO57      -----
SPED_ECO24      -----
SPED_SHIB3      -----
SPED_SHIDS      -----
SPED_ECOUT      -----
SPED_ECOL6      -----
SPED_ECOL5      -----
SPED_SALA4      -----
SPED_SALTY      -----
SPED_SALNS      -----
SPED_SALSV      -----
SPED_SALPB      -----
SPED_SALDC      -----
SPED_SALEP      -----
SPED_SALPK      -----
SPED_SALPA      -----
SPED_SALTI      -----
SPED_SALG2      -----
SPED_SALHS      -----
SPED_SALCH      -----
SPED_SALAR      -----
SPED_CITK8      -----
SPED_KLEP3      -----
SPED_KLEP7      -----
SPED_CROS8      -----
SPED_ENT38      -----
SPED_ERWT9      -----
SPED_YERPE      -----
SPED_YERP3      -----
SPED_YERPP      -----
SPED_YERPA      -----
SPED_YERPN      -----
SPED_YERPB      -----
SPED_YERPG      -----
SPED_YERPY      -----
SPED_YERPS      -----
SPED_YERE8      -----
SPED_PECAS      -----
SPED_SERP5      -----
SPED_SODGM      -----
SPED_PHOLL      -----
SPED_BUCAP      I----
SPED_PSET1      -----
SPED_STRM5      -----
SPED_STRMK      -----
SPED_XANCB      -----
SPED_XANCP      -----
SPED_XANC8      -----
SPED_XANAC      -----
SPED_XANC5      -----
SPED_XANOP      -----
SPED_XANOR      -----
SPED_XANOM      -----
SPED_XYLF2      -----
SPED_XYLFT      -----
SPED_XYLFM      -----
SPED_XYLFA      -----
SPED_GEOKA      -----
SPED_GEOTN      -----
SPED_CLOAB      K----
SPED_DESHY      -----
SPED_HELMI      -----
SPED_ALKMQ      -----
SPED_CLOBA      -----
SPED_CLOBB      -----
SPED_CLOB8      -----
SPED_ALKOO      -----
SPED_CLOPE      -----
SPED_CLOP1      -----
SPED_CLOPS      -----