CLUSTAL format seed alignment for MF_00468

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CYSZ_PSEAB            ------------------------MPALSGPQYLGEGLKLIMRPGLRLFVLIPLTLNLLV
CYSZ_PSEAE            ------------------------MPALSGPQYLGEGLKLIMRPGLRLFVLIPLTLNLLV
CYSZ_PSEPF            ----------------------MPAPVLSGPQYLREGLKLVLSPGLRLFVLLPLAINLVL
CYSZ_PSEF5            ----------------------MPAPVLSGPQYLREGLKLVLSPGLRLFVLLPLAINLVL
B0KPB0_PSEPG          ----------------------MQAPVLSGPQYLREGLKLVLSPNLRLFVLLPLTVNLLL
C1DNN8_AZOVD          ----------------------------------------MLSPGLRLFVLLPLAVNLLL
Q2SNV9_HAHCH          -----------------------MKLFAKGFNDLLEGFRLIQHPKLRVFVIIPLIINILV
I1YE87_METFJ          -----------------------MTEFFRGARYVLNGFSLINQLGVRRFAYIPILINTLL
D8K610_NITWC          ----------------------MITQVFVGVNHLLRGFKLIHRPGLRAYAYIPLAINTLL
K0C6V8_CYCSP          -------------------MKTNLTSFSHGIGSFIAGFHLIRQPGLRRFVIIPLMINVVL
F2K0Z6_MARM1          ----------------------MLIQPFQAVGAFFKSLPVILSPGMRLFILAPLLANVIL
F6CV80_MARPP          ----------------------MITQPFKAAGAFLKALPLIASKELRLFILAPLLANFLL
Q1QSF2_CHRSD          --------------------------MLHAFTAIGRGTRLVLSPGMRRFVIAPVLVNLVL
CYSZ_PECAS            MSSEKSSFPEKPPSFEKPSHSNTADHTRSGVHYFFAGWRLISLPGIRRFVILPLLMNIVL
A0A0H2W6Y2_YERPE      ---------------------------MSGFSYFAQGWRLISRPGIRRFVILPLLVNILL
CYSZ_ECOLI            ------------------MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILL
CYSZ_ECOSE            ------------------MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILL
CYSZ_ECO7I            ------------------MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILL
CYSZ_ECOL6            ------------------MVSSFTSAPRSGFYYFAQGWKLVLQPGIRRFVILPLLVNILL
CYSZ_SALTY            ------------------MVSSSTTVPRSGVYYFSQGWKLVTLPGIRRFVILPLLVNIVL
CYSZ_SALTI            ------------------MVSSSTTVPRSGVYYFSQGWKLVTLPGIRRFVILPLLVNIVL
B5XVT1_KLEP3          ------------------MVSSSAPTPRSGVYYFSQGWKLIGLPGIRRYVFLPLLVNVLL
A0A0H3F9M5_RAHSY      ------------------MTSSHSTRQQNGVHYFKQGWTLISLPGIRRFVILPLAVNVLL
B2VE38_ERWT9          ---------------MHFMSQHNADSSPGGLHYFSAGWKLIRLPGIRRFVIMPLLVNIIL
Q5E3K9_ALIF1          --------------------MNSFKQSQSGVQYFLKGISLAMTPGLRRFVFIPLLINFLL
CYSZ_VIBCH            --------------------MQISS--RSGFGYFSYGIRLALTPGIRRFVVLPLLANIIL
CYSZ_VIBA3            --------------------MTIESVPRSGFGYFIFGIKIALSPSIRKFVLLPLIANVLL
CYSZ_HAEIN            ---------------MLNL-----NELKSGFHYFVMGWHFITQKGLRRFVIMPIVLNTVL
CYSZ_HAEIE            ---------------MLNL-----NELKSGFHYFVMGWHYITQKGLRRFVIIPILLNTVL
CYSZ_PASMU            ---------------MLSH-----AELKQGFHYFMMGWHLITQKGLRRFVIMPILLNIVL
B8F312_HAEPS          ---------------MLSFFSSFDSEIKAGFHYFIYGWRLMLQRQLMPFIIFPVIINAVL
F2GBA4_ALTMD          -------------------------MSSGGVHYFFEGFSLIKTKGLKRFVFVPLTINLVL
Q47YH8_COLP3          -------------MPHSAKKTKFPPIDHSGASYFFKGFSLIRQKGIRRFVFIPLTINALL
Q5QUJ8_IDILO          --------------------MQKAAYSNSGLAYIGRGLELIRTKGLRRYVVVPILTNLIL
C4LAQ4_TOLAT          ---------------------MVNIQPLSAFGYLLRGLHLMTQPGIRRYVWFPLLINILL
C5BSZ1_TERTT          -------------------MQYPINSPLSGARYFVEGVRLLLHPKLRAYILIPLLVNIAL
                                                                   :  :   *:  *  :

CYSZ_PSEAB            FALLIGFAMQQFSHWVDLLMPSLP-DWLS---FLQYIVWPLFVLLVLVIVFFTFTMVANI
CYSZ_PSEAE            FALLIGFAMQQFSHWVDLLMPSLP-DWLS---FLQYIVWPLFVLLVLVIVFFTFTMVANI
CYSZ_PSEPF            FVGLIYLAGHQFSLWVDTLMPSLP-EWLS---FLSYILWPLFVVLVALMVFFTFTMLANV
CYSZ_PSEF5            FVGLIYFAGHQFSLWVDALMPSLP-SWLS---FLSYVIWPLFVVLVAFMVFFSFTMLANI
B0KPB0_PSEPG          FGGLIYFAGHQFGLWLDALMPTLP-DWLS---FLSYILWPLFVALLLLMVFFTFTLVANI
C1DNN8_AZOVD          FAGLITFAIRQFEHWVDALMPNLP-QWLS---FLDYLLWPLFVVLVVLIVFFTFTLLATI
Q2SNV9_HAHCH          FVGFIWGMSAYFSGWVDAMVSWLP-DWLS---FLRWLVWLVFAILVGVLVFYTFVFVATL
I1YE87_METFJ          FSVAIWFAISQFDGWMTTMLPTWLPEWLAN--IMMWVLWPLFALLILILVVFTFTILANI
D8K610_NITWC          FSILIWLGAAQFGALIDALLPPWL-EWL------HWLLWPLFAVTMAVIVFFIFSLIANL
K0C6V8_CYCSP          FSVASWLLWNYLSTMVDSMLPSWL-SWL------AWLILPIFMTSILAIVYYCFTLVANI
F2K0Z6_MARM1          MALLYMVALSYFGVVVDYMMGFLP-GWMS---FLNWLFYLVFGSIVAVAFFYSFSMGVNI
F6CV80_MARPP          IGLIYMVAFSYFQDILNWVMGYLP-DWMS---FISWLIDLIFGAIIAVLLFYSFSIGVNI
Q1QSF2_CHRSD          YAATLAYLFTHFGGWLDYWMLKVP-GWLE---WLEWLIWPLLVVSLLLMVFFTFTLVTNL
CYSZ_PECAS            MGGAFWWLFTQLNDWIPQIMSHIPSWLQW----LSYLIWPLAVLSILLVFSYLFSTIANF
A0A0H2W6Y2_YERPE      MGGAFWWLFNRIGDWVPQLMSYIPSWLQW----LSYLLWPLMVISLLLVFSYLFSTLANI
CYSZ_ECOLI            MGGAFWWLFTQLDVWIPTLMSYVPDWLQW----LSYLLWPLAVISVLLVFGYFFSTIANW
CYSZ_ECOSE            MGGAFWWLFTQLDVWIPTLMSYVPDWLQW----LSYLLWPLAVISVLLVFGYFFSTIANW
CYSZ_ECO7I            MGGAFWWLFTQLDVWIPTLMSYVPDWLQW----LSYLLWPLAVISVLLVFGYFFSTIANW
CYSZ_ECOL6            MGGAFWWLFTQLDVWIPTLMSYVPDWLQW----LSYLLWPLAVISVLLVFGYFFSTIANW
CYSZ_SALTY            MGGAFWWLFTQLDAWIPSLMSHVPDWLQW----LSYLLWPIAVISVLLVFGYFFSTLANW
CYSZ_SALTI            MGGAFWWLFTQLDAWIPSLMSHVPDWLQW----LSYLLWPIAVISVLLVFGYFFSTLANW
B5XVT1_KLEP3          MGGAFWWLFTRLDSWIPSLMSHVPDWLQW----LNYLLWPVVVLSILLVFGYFFSTIANW
A0A0H3F9M5_RAHSY      MGGAFWWLFTKLGEWIPAMMSKVPSWLSW----LDYLIWPVAVLSVVLVFSYLFSTLANW
B2VE38_ERWT9          MGGAFIWLFQRLGHWIPELMEMVPGWLQW----LSYLLWPLLVLSIILVFSYFFSTIANW
Q5E3K9_ALIF1          LGGSFIYLFNQIGSWIDQILAQIPSWLDW----LSYLLWPLIVISILAVFSYFFSTLANW
CYSZ_VIBCH            VGGAMYYLFSHLDTWISEWIGQLPSFLSW----LSYVLWPLLALTILATFSYFFSTLANF
CYSZ_VIBA3            VGGALFYIFSNLNTWIEGWIGALPSFLSW----LSYILWPLLVLTVLATFSYFFSTLANF
CYSZ_HAEIN            LCGLFWLFISQISSAIDWVMNFIPDWLSF----LSVILLILSILTILLLFYFTFTTISGF
CYSZ_HAEIE            LCGLFWLFISQISSAIDWVMNFIPDWLGF----LSFILLAFSILTILLLFYFTFTTLSGF
CYSZ_PASMU            LSGLFWLFITQIEKMIGMLMLSIPDWLSW----LSSILLIFAILMILVLFYFVFTTLSGF
B8F312_HAEPS          MISLIWLFFANVGGMLDSLL---PSWLEW----LSFILIPLAFLMILVAFYFAFTTLANF
F2GBA4_ALTMD          FSVAFYFLFGQIEMGIAYVIDLVPEWLGWIKTAISFFLWPLAVISVLLIFALIFGTLANW
Q47YH8_COLP3          FSFAFYFVYSELNTYMENVMAWLPSWLDW----LSVILWPLAVITILVIFSFLFSTVANW
Q5QUJ8_IDILO          FSLAFTWLYGEVDYWLNRFMSWLPDFFQW----LEFILWPLAVITIIALFSFIFSTIMHL
C4LAQ4_TOLAT          FSIGFYLLFQRFDIAMNALTAWLPDWLDW----LTFLLWPLAVLIILFTFSFIFGMVTNW
C5BSZ1_TERTT          FVVLTGALIYYIGVFQDGLHIDVPDWLQVVADFLLHLLSLVLIVLVLIIYAYSFNIITNI
                                 .                        ..  .    :       *      

CYSZ_PSEAB            ISAPFNGFLSEKVEVVVRGRDDFPPFSWAELLAMIPRTMGREMRKLAYFLPRALVLLVLS
CYSZ_PSEAE            ISAPFNGFLSEKVEVVVRGRDDFPPFSWAELLAMIPRTMGREMRKLAYFLPRALVLLVLS
CYSZ_PSEPF            IAAPFNGFLAEKVEVVVRGTDDFPAFSWGELIAMIPRTLAREMRKLGYFLPRAIGLFILS
CYSZ_PSEF5            IAAPFNGFLSEKVETVVRGTDDFPPFSWGELIAMIPRTLAREMRKLGYFLPRAIGLFILS
B0KPB0_PSEPG          IAAPFNGFLAEKVEVVVRGEDTFPAFSWGELLAMVPRTFSREMRKLGYFLPRAIGLFILS
C1DNN8_AZOVD          IAAPFNGFLAEKVEVVVRGEDHFPPFHWRELLDMAPRTFSREWRKLTYLLPRALFLLILS
Q2SNV9_HAHCH          VGAPFYGLLAEQTQKLLTGKEVDEDTPWKQVIMNIPASVWREIKKLLYYLPRALGLLLLS
I1YE87_METFJ          IAAPFNGLLAEAVEKKLTNQ-APPSQTMTQLIADAPRMIWNEIRKLGYLLKWMIPLLIFS
D8K610_NITWC          IGAPFNGPLAKAVEYHLTGQ-EIQ-ESSTTLLREAFSAIWMELNKISYFALRAIPLLLLF
K0C6V8_CYCSP          IAAPFYGQLSKGVEAHLKGQ-PYVEVNADTFLKEMFQMLGLELRKITYYLLRAVPLLILS
F2K0Z6_MARM1          IAAPFMAFLAEKVEERETGRQFESTLNMGEVMKIAGRSIQRELQKLFYFLPRLIILLLLS
F6CV80_MARPP          LAAPFMAFLAEKVEEKTTGKVFDESLSASVILAVIGRSLQREMQKVLYFVPRFLLLLVLS
Q1QSF2_CHRSD          IAAPFYGFLAEKVEWRLTGS---PPDDTRSLMRAGVDALGRELVKLRYMLPRMVLLFVLG
CYSZ_PECAS            IAAPFNGLLAEQLEAKLTGQ-TLPDSGILSIAKDVPRIMKREVQKLAYYLPRAIVLLLLY
A0A0H2W6Y2_YERPE      IAAPFNGLLAEQLEASLTGK-PLPDTGIWGIVKDLPRIMAREWRKLAYYLPRALVLLLLY
CYSZ_ECOLI            IAAPFNGLLAEQLEARLTGA-TPPDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILY
CYSZ_ECOSE            IAAPFNGLLAEQLEARLTGA-TPPDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILY
CYSZ_ECO7I            IAAPFNGLLAEQLEARLTGA-TPPDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILY
CYSZ_ECOL6            IAAPFNGLLAEQLEARLTGA-TPPDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILY
CYSZ_SALTY            IAAPFNGLLAEQLEARLTGA-TPPDTGILGIMKDVPRIMKREWQKLAWYLPRAIVLLILY
CYSZ_SALTI            IAAPFNGLLAEQLEARLTGA-TPPDTGILGIMKDVPRIMKREWQKLAWYLPRAIVLLVLY
B5XVT1_KLEP3          IAAPFSGLLAEQLEARLTGA-TPPDVGVFGIMKDIPRIMKREWQKLAWYLPRAIVLLLLY
A0A0H3F9M5_RAHSY      IAAPFSGLLAEQLEARLTGK-TLPDTGIWDIMKDLPRIMKREWQKLAYYLPRALLLFALY
B2VE38_ERWT9          IAAPFCGLLAEQLEGRLTGN-PLPDSGWSGLVKDLPRILKREWQKLAYYLPRALGLLVLY
Q5E3K9_ALIF1          IAAPFNGLLAEHLEAKLTGQ-PAPSGGVLDAVKDLPRIFKREWQKLKYYIPKALGLFILF
CYSZ_VIBCH            IASPFNGLLAEKVEQHLSGE-RIGEEGVWALVKDVPRILSREWRKLLYVLPKALGLFLLL
CYSZ_VIBA3            IAAPFNGLLAEKVEELLSGK-KVNDDGLLDVLKDTPRILAREWRKLVYILPKAIGLFLLL
CYSZ_HAEIN            IAAPFNGLLAEKVEKMLTGE-NINDDGLVDIMRDVPRMLAREWQKLRYSLPKIIALFLLS
CYSZ_HAEIE            IAAPFNGLLAEKVEKMLTGE-NINDDGLADVIKDVPRMLAREWQKLRYSLPKIIALFLLS
CYSZ_PASMU            IAAPFNGLLAEKVEKMLTGE-NLVEGSVWDFMKDIPRMLGREWQKLVYSLPKLIILFLLG
B8F312_HAEPS          IAAPFNALLAEKVEQQLTGK-NLMEMSFHEMLKDVPRMLKREWQKMWYSIPRLVALFLLG
F2GBA4_ALTMD          IAAPFNGVLSEKVERHLTGQ-DLGDEGVMSLIKDIPRTVGRELTKLIWYIPRAIGFLLLF
Q47YH8_COLP3          LAAPFNGLLSEKMEALLSGN-EAPKGSMLDIVKDIPRTLSREWQKLAYYVPRAIGFFIIM
Q5QUJ8_IDILO          IAAPFNGLLAEKVERYESGE-SLGDEGFLGLFKDIPRTLKREMQKLMYYIPRALGFFLLS
C4LAQ4_TOLAT          LAAPFNGMLASRVEQYLV-S-DLHRVDERPLWQEIHHAFRREWQKLKYWLPRMLLCAILF
C5BSZ1_TERTT          IAAPFYGMLAEKAEELLTGT-KIESE---PLVRMIPRVFKRELKKLLYFIIRGILISLIM
                      :.:** . *:.  :                        .  *  *. :     :    : 

CYSZ_PSEAB            -----FVPGVNL-IATPLWILFGIWMMAVQYIDYPADNHKLGWNEMLAWLRSKRWACMGF
CYSZ_PSEAE            -----FVPGVNL-IATPLWILFGIWMMAVQYIDYPADNHKLGWNEMLAWLRSKRWACMGF
CYSZ_PSEPF            -----FIPVVNI-VAAPLWLLFGVWMMAIQYIDYPADNHKLGWNEMLAWLRQKRWQSMSF
CYSZ_PSEF5            -----LIPVVNL-IAAPLWLLFGIWMMAIQYIDYPADNHKMSWQDMLAWLRQKRWQSLGF
B0KPB0_PSEPG          -----LIPVVNV-VAAPLWLIFGVWMMAIQYIDYPADNNKMSWQDMLAWLRQKRWQSLGF
C1DNN8_AZOVD          -----FIPVLNL-LAPPLWLLFGVWMMAVQYIDYPADNNKLSWNEMLAWLRARRWQSLSF
Q2SNV9_HAHCH          -----FIPVVNL-VSPLLWAVFSSWIMALEFVDYPADNNKRKIDDVIRFMRERRSRTLGF
I1YE87_METFJ          -----WIPGLNL-IAPLLWLGFSSWTLALDYHDYPLGNHAMGFPAQRALLRRKRGLALGF
D8K610_NITWC          -----LIPGLNF-IAPFLWFAFSAWMFALEYMDYPMGNHKISFPQQRQQLQQHRLLGLGF
K0C6V8_CYCSP          -----VIPGINV-ISLPLWLLFSAWFLTFEYAGYSFENHKILFSDQKRMLNRSRVNTMTF
F2K0Z6_MARM1          -----FVPVINF-VAPVLLLLFSAWMLAVQYMDYSFDNHKLSFREMRETLRTKPLLCWTF
F6CV80_MARPP          -----FIPLVNV-IAPFLLLLFSAWMLALQYMDYAFDNNKVSFYEMRMALRTQPLLCWTF
Q1QSF2_CHRSD          -----FVPGVNM-FMPLLWAAFSAWMLAIQYLDYPMDNNQVSFSDMRRRLRARWWPTLTF
CYSZ_PECAS            -----FIPGIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVGFSTMRQALRRHKVANMQF
A0A0H2W6Y2_YERPE      -----FVPGVGQTVAPVLWFLFSAWMLSIQYCDYPFDNHKVSFQQMRTALRQNKVDNLQF
CYSZ_ECOLI            -----FIPGIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKEMRTALRTRKITNMQF
CYSZ_ECOSE            -----LIPGIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKEMRTALRTRKITNMQF
CYSZ_ECO7I            -----FIPGIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKEMRIALRTRKITNMQF
CYSZ_ECOL6            -----FIPGIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKEMRTALRTRKITNMQF
CYSZ_SALTY            -----FIPGIGQTIAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMRAALRTQKVANMQF
CYSZ_SALTI            -----FIPGIGQTIAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMRAALRTQKVANMQF
B5XVT1_KLEP3          -----FIPGVGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMREALRSRKVMNMQF
A0A0H3F9M5_RAHSY      -----FIPVIGQTVAPVLWFFFSAWMVVIQYCDYPFDNHKVSFADMRRSLGSNKIDNMQF
B2VE38_ERWT9          -----FLPGFGQTVAPVLWFLFSAWMMAIQYCDYPFDNHKVSFRQMRSAMGQNKTMSMQF
Q5E3K9_ALIF1          -----FIPAIGQSIAPVLWFLFTAWMMAIQYCDYPFDNHKVPFETMRDELKTKRGKCLSF
CYSZ_VIBCH            -----LIPALGQTLGPIAWFLFTAWMLAIQYCDYPFDNHKISFHDMRNTLKQNQSKAYGF
CYSZ_VIBA3            -----LIPALGQTVAPFLWFIFTAWMLAIQYADYPFDNHKIKFDDMRNNLKQKQGKSYSF
CYSZ_HAEIN            -----FIPLVGQTIVPVLTFLFTCWMMAIQYCDYPFDNHKVSFDIMKNVLGNQRTQSLTF
CYSZ_HAEIE            -----FIPLVGQTIVPVLTFLFTCWMMAIQYCDYPFDNHKVSFDVMKNALGNQRTQSLTF
CYSZ_PASMU            -----FVPVLGQSVIPIIVTLFTAWMMAIQYCDYPFDNHKVPFFVMKAELAEKRALSLSF
B8F312_HAEPS          -----FIPVLGQTIIPILAFIFGAWLIAIQYCDYPFDNHKIQFQRMRNALAQYRTMNFTF
F2GBA4_ALTMD          I----FLPIIGQ----VLWFLFNAWMMAIQYCDYPYDNHKVDFTRMRLHLGEHKGKALTF
Q47YH8_COLP3          W----LLPVVGQ----ILWFLFIAWMMAIQYKDYPFDNHKVPFAKMKEVLKQNQGISYSF
Q5QUJ8_IDILO          L----VIPVIGQ----VLWYIFVCWMMSIQYLDYPFDNHKLSFPRMRSELHQQRSKTLGF
C4LAQ4_TOLAT          -----FIPVAGQFLAPWIWLLFSAWMMAIQYCDYPYDNHQVAFPDMRRQLTRHRWRHLSF
C5BSZ1_TERTT          LLVGLTVPVVGTFLAPLIGLAWSAWCMTLQYADYPADNHRCSFTAIRRKLAQRSMSSFGF
                            :*  .          :  * . .:: .*.  *:          :         *

CYSZ_PSEAB            GGMTYLALLIPLVNLVMMPAAVAGATLFWVREEGEKALVK--------------------
CYSZ_PSEAE            GGVTYLALLIPLVNLVMMPAAVAGATLFWVREEGERALVK--------------------
CYSZ_PSEPF            GGIVYLVLLIPVVNILMMPAAVAGATLFWVRERGAENLVTQR------------------
CYSZ_PSEF5            GGIVYLALLIPLVNILMMPAAVAGATLFWVRERGVENLPAK-------------------
B0KPB0_PSEPG          GGITYLALMIPGVNVLMMPAAVAGATLFWVRERN--------------------------
C1DNN8_AZOVD          GGITYAALLVPGLNLLVMPAAVAGATLFWVREGGVPVVGKRDREEIEKPS----------
Q2SNV9_HAHCH          GLGVWGSTLIPIVNLVSMQAAVAGGVKFWLEEHGQLPKANPASGAGVAVR----------
I1YE87_METFJ          GMATLGATMIPVVNFLVISAATAGATQLYVEKLKTLPAKPAG------------------
D8K610_NITWC          GGATLFATSIPFVNFFVMPSAVAGATALWVTHLKPRHETQAQPSAFQSPSDQQESSIN--
K0C6V8_CYCSP          GSISLLATTIPVINLFAPAVAVAGATKLFYERGELG------------------------
F2K0Z6_MARM1          GFIVMAGLTIPLLNLFVMPIAVVAATLLWIDQFSDRFELVSVPVAMSNE-----------
F6CV80_MARPP          GGIVMVSLTIPLFNLFVMPIAVVAATLLWVSIFRVENGDFSALLNSHNGMK---------
Q1QSF2_CHRSD          GLGMSLATWVPVLNLVLLPGGVAGAVILWDHYYRHLPAVAR-------------------
CYSZ_PECAS            GALVSLFTLVPFLNLVIMPVAVCGATQLWVDRYRNLSATLPKKSP---------------
A0A0H2W6Y2_YERPE      GALVSLFTMIPFLNLVIMPVAVCGATAMWVDRYRSQFIQLP-------------------
CYSZ_ECOLI            GALTSLFTMIPLLNLFIMPVAVCGATAMWVDCYRDKHAMWR-------------------
CYSZ_ECOSE            GALTSLFTMIPLLNLFIMPVAVCGATAMWVDCYRDKHAMWR-------------------
CYSZ_ECO7I            GALTSLFTMIPLLNLFIMPVAVCGATAMWVDCYRDKHAMWR-------------------
CYSZ_ECOL6            GALTSLFTMIPLLNLFIMPVAVCGATAMWVDCYRDKHAMWR-------------------
CYSZ_SALTY            GALTSLFTMIPVLNLFIMPVAVCGATAMWVDCWRAKHALWK-------------------
CYSZ_SALTI            GALTSLFTMIPVLNLFIMPVAVCGATAMWVDCWRAKHALWK-------------------
B5XVT1_KLEP3          GALTSLFTMIPVLNLVILPVAICGATAMWVDCYRDKHAVWK-------------------
A0A0H3F9M5_RAHSY      GSLVSLFTMIPLLNLVILPVAVCGATAMWCDRYRNIYVKSDVYNNSIDVNSSRK------
B2VE38_ERWT9          GALVSLFTMIPLLNLVIMPVAVCGATAMWVDRYRSELRLTSPSRAL--------------
Q5E3K9_ALIF1          GSLVTLFTMTPILNLFVMPIAVCGATAMWVDVYRDTHKNR--------------------
CYSZ_VIBCH            GMLVAFFTSIPIVNLFIVPVAVCGATAMWVMEFKIQHSPLRQ------------------
CYSZ_VIBA3            GALVSVFTTIPVLNLIVMPVAVCGATAMWVAEFKDQALRSRL------------------
CYSZ_HAEIN            GGLVTCCTFVPVINLLIMPVAVCGATLMWVENYRNDLGFNMNKSFSSQTGLDVRSENTGI
CYSZ_HAEIE            GGLVTCCTFVPVINLLIMPVAVCGATLMWVENYRNGLRFNMNRPFSSQTGLDVHSENTGI
CYSZ_PASMU            GGLVMLCTFIPLVNLVVIPVAVCGATAMWVTHFRDHLAMKPLN----QEGVSRVS-TVSI
B8F312_HAEPS          GALVSIFTMLPFINLVVMPVAVCGATAMWVNEYKRALHD---------------------
F2GBA4_ALTMD          GMMVNVFSLIPVVNFIIMPVAICGATSMWVRELKHTLNK---------------------
Q47YH8_COLP3          GITVAVFSMIPIVNLVVMPVAICGATALWVDHYQEKV-----------------------
Q5QUJ8_IDILO          GFGVTVLTMIPLINLIIMPLAVCGATSLWVDHYRRSALS---------------------
C4LAQ4_TOLAT          GGLVMLLGSIPLLNLFLMPMAICASTAMWVDDQKAQ------------------------
C5BSZ1_TERTT          GGMITACSVIPVLNIIAMPAAVTGGTIYWLNELRDCPCKY--------------------
                      *         * .*..    .  ...  :                               

CYSZ_PSEAB            --
CYSZ_PSEAE            --
CYSZ_PSEPF            --
CYSZ_PSEF5            --
B0KPB0_PSEPG          --
C1DNN8_AZOVD          --
Q2SNV9_HAHCH          --
I1YE87_METFJ          --
D8K610_NITWC          --
K0C6V8_CYCSP          --
F2K0Z6_MARM1          --
F6CV80_MARPP          --
Q1QSF2_CHRSD          --
CYSZ_PECAS            --
A0A0H2W6Y2_YERPE      --
CYSZ_ECOLI            --
CYSZ_ECOSE            --
CYSZ_ECO7I            --
CYSZ_ECOL6            --
CYSZ_SALTY            --
CYSZ_SALTI            --
B5XVT1_KLEP3          --
A0A0H3F9M5_RAHSY      --
B2VE38_ERWT9          --
Q5E3K9_ALIF1          --
CYSZ_VIBCH            --
CYSZ_VIBA3            --
CYSZ_HAEIN            VK
CYSZ_HAEIE            VK
CYSZ_PASMU            VK
B8F312_HAEPS          --
F2GBA4_ALTMD          --
Q47YH8_COLP3          --
Q5QUJ8_IDILO          --
C4LAQ4_TOLAT          --
C5BSZ1_TERTT          --