CLUSTAL format seed alignment for MF_00469

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YMDE_LACLA       ---------------------------------MTQDYRVLLYYQYVPIEDGETFAQKHL
Y572_OCEIH       -------------------------------MESNQEYQVLLYYQYVTIDDPEAFAEEHL
YBFQ_BACSU       ---------------------------------MEKQYRVLLYYKYVPIEDPEAFREQHL
Y1421_LISIN      ----------------------------------MSDYQVLLYYKYTTIDDPETFAKEHL
Y1384_LISMO      ----------------------------------MSDYQVLLYYKYTTIDDPETFAKEHL
Y2689_STAAM      -----------------------------------MNYQVLLYYKYTTIDDPEQFAQDHL
Y2609_STAAW      -----------------------------------MNYQVLLYYKYTTIDDPEQFAQDHL
Y262_STAES       -----------------------------------MDYRVLLYYKYVTIDDPETFAAEHL
Y915_STRP1       ---------------------------------MSEKIRVLLYYKYVSIENAQEYAAKHL
Y630_STRP3       ---------------------------------MSEKIRVLLYYKYVSIENAQEYAAKHL
Y1504_STRA3      ---------------------------------MSEKIRVLLYYKYVSIENAEEYAAKHL
Y095_STRPN       ---------------------------------MAKDIRVLLYYLYTPIENAEQFAADHL
Y384_NOSS1       -------------------------------MNQENTQIVAAFYKFVSLPDFAEKQEPLL
Y765_SYNY3       -----------------------------------MAYQVTTFYHFTRLNCLAEKQSRWQ
Y4491_AGRFC      ---------------------MTDTTILPR-PEVSGDFLVAALYHFARLPRFESLREQLF
Y2887_RHIME      ---------------------MTDMLTTSRRPETPGQFLVAALYHFVSFPRFADFREPLQ
Y007_BRUME       ---------------------MQGNFSKKIDPMSNLPFTVAALYCFAPLPQYESLREPLA
Y3086_BRUSU      -----------------------------MDPMSNLPFTVAALYCFAPLPQYESLREPLA
Y2992_RHILO      ----------------------------MTPSAPSQPVRVAALYRFARLDAFEALRAPLA
Y1060_CAUVC      ----------------------------------MASYRVAALYRFTRFEDPAAIQGPLA
Y1100_DEIRA      ---------------------------MPEPHPAPQPYTVAALYQFRALPDPAALRAELL
Y2290_SHEON      ----------------------------------MSNVVVCALYKFVSLPHFESLREPLL
Y1259_VIBCH      ----------------------------------MSQYVVCALYKFVELNHYQELRAPLL
Y858_PSEAE       ----------------------------------MTSIVVAALYKFVTLDDYVALREPLL
Y167_RICCN       ---------------------------------MNEKIAILSAYSFVNIEEPANLIPKLL
Y125_RICPR       ---------------------------------MNERITILSAYSFVNIIEPANLIPKLL
Y2109_XANAC      ------------------------------------MMTNTAAYQFVTIRDPQTLAASVL
Y2086_XANCP      ------------------------------------MITNTAAYQFAPIHDPQQLADSVL
Y2609_XYLFA      -----------------------------------MVIINTAAYHFVSITQPQTLADQIR
Y1985_XYLFT      -----------------------------------MVIINTAAYHFVSITQPQTLADQIR
Y2206_RALSO      -----------------------------------MQIVNISAYKFVTLNDRETLRPALL
Y916_CHLMU       ---------------------------------MEKNYYALAYYYFGPVSNPHEEIALHK
Y627_CHLTR       ---------------------------------MEKNYYALAYYYFGPVSNPHEEIALHK
Y734_CHLPN       ---------------------------------MEKKYYALAYYYITRVDNPHEEIALHK
Y2830_COREF      ----------------------------------MSIGKILLYYAFTPLSDPKAVQLWQR
Y2992_CORGL      ----------------------------------MATSKILLYYAFTPLSDPKAVQLWQR
Y365_BUCAI       --------------MSILHNIVSKKELKRRMFFETEPRLTLSFYKYFFIKNTQEYRDRLY
Y353_BUCAP       -------------MMSNLCNRISKKELKKKILMNEESRIVVSFYKYFLIKNTKEYRDRIY
YCEA_ECOLI       --------------MPVLHNRISNDALKAKMLAESEPRTTISFYKYFHIADPKATRDALY
YCEA_ECOL6       --------------MPVLHNRISNDALKAKMLAESEPRTTISFYKYFHIADPKVTRDALY
YCEA_ECO57       --------------MPVLHNRISNDALKAKMLAESEPRTTISFYKYFHIADPKATRDALY
YCEA_SALTI       --------------MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALY
YCEA_SALTY       --------------MPVLHNRISNDELKAKMLAESEPRTTISFYKYFTIASPQQTRDALY
Y2451_YERPE      --------------MPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLY
Y330_BUCBP       --------------MLYLYNKHPRIKLRNAAIFDNINRVTVSFYKYIFIHEPIKFRNSLY
Y065_WIGBR       -------------MSCNIIKKISNK--RYYSINYKKKTKTISFYKYCKIENIDCIQEKLF
Y3128_LEPIN      MANQGDFPKRTETKKRPLHNIYGKEILRKRLEEENFSRTTLSFYRYVILENVQELRDQLY
                                                            *    .           

YMDE_LACLA       ADCKELGLKGRILVADEGINGTVSGTIEQTNAYMELMKNDP-RFSSTIFKIDEAE-QNAF
Y572_OCEIH       RYCKEIGLKGRILVANEGINGTVSGTIEQTTAYMDHMHNDE-RFHDMTFKIDPHE-GHTF
YBFQ_BACSU       AFCKELGLLGRILVSSEGINGTVSGTVEQTEKYMETMKADP-RFADMVFKIDEAE-GHAF
Y1421_LISIN      AACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDA-RFADMVFKIDAAD-SHAF
Y1384_LISMO      AACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDA-RFADMVFKIDAAD-AHAF
Y2689_STAAM      AFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADE-RFKDMVFKIDEAE-GHAF
Y2609_STAAW      AFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADE-RFKDMVFKIDEAE-GHAF
Y262_STAES       KFCKEHHLKGRILVSTEGINGTLSGTKEDTDKYIEHMHADN-RFADLTFKIDEAE-SHAF
Y915_STRP1       EFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDE-RFADLWFKIDEEN-QQAF
Y630_STRP3       EFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDE-RFADLWFKIDEEN-QQAF
Y1504_STRA3      EFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDE-RFADLWFKIDEEN-QQAF
Y095_STRPN       AFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLP-GMEELWFKIDEEN-EQAF
Y384_NOSS1       AYCLAQNIKGTILLAKEGINGTIAGSRLSIDNVLSYLRSDL-RLQDLEHKESTAD-TPPF
Y765_SYNY3       ELGDRLGLKGTILLAEEGVNATIAGESAAIEEMVKIMAADL-GLTSVPQRHSWAK-TIPF
Y4491_AGRFC      ELCQKNGVKGTLLLAAEGINGTIAGPDAGVQAVLSFLRAQP-EFAALEHKESRAS-HMPF
Y2887_RHIME      AICDANGVKGTLLLAHEGINGTIAGTEEGIAAVLACVRAQP-EFAGLIHKESRAS-AMPF
Y007_BRUME       QLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIP-GLGEPELKYSHAS-EMPF
Y3086_BRUSU      QLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIP-GLGEPELKYSHAS-EMPF
Y2992_RHILO      AFCCGRGIKGTLLLAHEGINGTVAGSEEAIAELIDHIEAID-GLAGLEVKFSSAT-DMPF
Y1060_CAUVC      ALCCSLGVKGTLLLAREGINGTIAGEDAAIEAVLAHIRALP-GCADLTPKTAWAE-RMPF
Y1100_DEIRA      ALGERLELCGTLIVADEGINGTVAGSAAAIAELHAFLLA-S-GFDRLEYKESQAS-EKPF
Y2290_SHEON      SMMEQAEIKGTLLLASEGINGTVAGNQAAIDALLIWLNQQN-GLENITYKLSFDD-EMPF
Y1259_VIBCH      ALMEENHIRGTLLLAQEGINGTVASSRQGIDALLAWLENEP-SLKGTVYKESSAS-EPPF
Y858_PSEAE       QTLLDNGVKGTLLLAEEGINGTVSGSREGIDALFAWLRSDP-RLADIEHKESYCD-EQPF
Y167_RICCN       LIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLT-GPKDVNVKINYSD-VHPF
Y125_RICPR       LVGKKKYIRGTILLANEGFNSSFSGSYENVNIVLKQLIALT-GSKDVNVKINYSP-VHPF
Y2109_XANAC      AQAEQHALKGSVLVAEEGINLFLAGAAEQIGAFYTWLQADT-RFAQMRIKYSESK-HQPF
Y2086_XANCP      ERAQQRALKGSVLVAEEGINLFLAGDAEQIASFYAWLHADA-RFAQMRVKYSHSA-EQPF
Y2609_XYLFA      AHGEIAGLKGTVLIANEGINLFLAGEKEAINAFYAWLCADV-RFAALHVKYSVSA-YKPF
Y1985_XYLFT      AHGEIAGLKGTVLIANEGINLFLAGEKEAINAFYAWLCADV-RFAALHVKYSVSA-YKPF
Y2206_RALSO      AECQARDLKGTVLLAPEGINIFLAGSREAIDGIVGWLRADA-RFADLAPKESLSD-HQPF
Y916_CHLMU       QLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRP-DFATVKFKIHHIK-ENVF
Y627_CHLTR       QLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRP-DFASIKFKIHHIE-ENIF
Y734_CHLPN       KFLEDLDVSCRIYISEQGINGQFSGYEPHAELYMQWLKERP-NFSKIKFKIHHIK-ENIF
Y2830_COREF      DLCESLNLRGRILISEHGINGTVGGDINDCKAYIRKTREYP-GFAKMEFKWSEGG-AEDF
Y2992_CORGL      ELCESLNLRGRILISTHGINGTVGGDIDDCKAYIKKTREYP-GFNRMQFKWSEGG-AEDF
Y365_BUCAI       KTFYKYNVLGRIYVASEGINAQISVPKKYYSILKKFLYNFDIELNNLRINKSLDN-EKSF
Y353_BUCAP       QNFYKYNVLGRVYVSDEGINAQISIPVKFYFFVKNFLYNSDLELNNLFINKSLSNHKKAF
YCEA_ECOLI       QLFTALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFDPALEGLRLNIALDDDGKSF
YCEA_ECOL6       QLFTALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFDPALEGLRLNIALDDDGKSF
YCEA_ECO57       QLFTALNVFGRVYLAHEGINAQISVPASNVKTFRAQLYAFDSALDGLRLNIALDDDGKSF
YCEA_SALTI       QVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFDPALDGVRLNIALEDDGKSF
YCEA_SALTY       QVFTALDVFGRVYLAHEGINAQISVPQSKLETFRQQLYTFDPALDGVRLNIALEDDGKSF
Y2451_YERPE      SQFVKLGVFGRVYVAKEGINAQISVPANRYDEFKIALFASHPALDQVRLNVAHEDDGKSF
Y330_BUCBP       RMFFKFNIFGRVYIANEGINAQISIPKKIYHKAINIITTSFAVLKDINVNLALDN-RESF
Y065_WIGBR       EICKKLEILGRIYISYEGINAHISIKKHKIEELKIFIKKTFDYLTDIRFNLYSDNKKQPF
Y3128_LEPIN      AEWEILGVLGRIYIAREGINAQLSIPSHNLDFFRKNLDSRN-QFKDMQFKIAVEDDSKSF
                        :   : :: .*.*  ..                         .         *

YMDE_LACLA       KKMHVRYRPELVNLSLED-----DVNPL--ELTGAYLDPKEFREAMLD------ENTVVI
Y572_OCEIH       KKMHVRPRPELVTLRLED-----DVNPL--ETTGEYLEPKDFYQALQD------ENTVVL
YBFQ_BACSU       KKIFVRHKKELVTLRLED-----DVDPN--ETTGQHLKPAEFYEKMQD------PNTIVI
Y1421_LISIN      KKMHVRPRAEIVSLSLEE-----DVNPL--EITGDYLEPAEFRDALLD------EDTVIL
Y1384_LISMO      KKMHVRPRAEIVSLSLEE-----DVNPL--EVTGTYLEPSEFREALLD------EDTVIL
Y2689_STAAM      KKMHVRPRKEIVALDLED-----DVDPR--HTTGQYLSPVEFRKALED------DDTVII
Y2609_STAAW      KKMHVRPRKEIVALDLED-----DVDPR--HTTGQYLSPVEFRKALED------DDTVII
Y262_STAES       KKMHVRPRREIVALDLEE-----DINPR--EITGKYYSPKEFKAALED------ENTVIL
Y915_STRP1       RKMFVRYKKEIVHLGLEDNNFDSDINPL--ETTGEYLNPKQFKEALLD------EDTVVL
Y630_STRP3       RKMFVRYKKEIVHLGLEDNNFDSDINPL--ETTGEYLNPKQFKEALLD------EDTVVL
Y1504_STRA3      RKMFVRYKKEIVHLGLEDNNFDSDINPL--ETTGEYLNPKQFKEALLD------EDTVVL
Y095_STRPN       KKMFVRYKKEIVHLGLEDNDFDNDINPL--ETTGAYLSPKEFKEALLD------KDTVVL
Y384_NOSS1       ERMKVRLKKEIVTLGLPE------VDPN--EQVGAYVTPEEWNELISD------PEVIVI
Y765_SYNY3       QRMKVKIKPEIVSLGQPQ------VNPE--KQVGTYVSPQQWNQLLQD------PDVVVI
Y4491_AGRFC      VRLKVKLKKEIVTMGVPD------IDPN--RIVGTYVDPRDWNALISD------PDTIVI
Y2887_RHIME      LRMKVRLKKEIVTMGVEN------IDPK--KVVGTYVEPKDWNALISD------PETLVI
Y007_BRUME       HRMKVRLKREIVTMGVEG------IDPL--KSVGTYIAPKDWNALIAD------ENTVVV
Y3086_BRUSU      HRMKVRLKREIVTMGVEG------IDPL--KSVGTYIAPKDWNALIAD------ENTVVV
Y2992_RHILO      HRMKVRLKREIVTMGVED------IDPA--TSAGTYVAPADWNALISE------PGTIVI
Y1060_CAUVC      YRMKVRLKKEIVTLGEPD------LDP---TDAGTYVEPADWNALISD------PDVLVI
Y1100_DEIRA      KRYKVRLKKEIVTLGVP-------VAPR--EQVGTYLDPQAWNDLLAD------PEVIVV
Y2290_SHEON      YRTKVKLKKEIVTMGVEG------IDPL--KVVGTYVKPKDWNALISD------PEVVLV
Y1259_VIBCH      NRTKVKLKKEIVTMGVEG------IDPR--HVVGTYVKPQDWNALISD------PEVLVV
Y858_PSEAE       YRTKVKLKKEIVTLGVPG------VDPN--KQVGQYVEAKDWNALISD------PEVLLI
Y167_RICCN       QKLKVRLKKEIVAMNVDG------LNVD--LFKGEYIEPKDWDEFITQ------QDVIVI
Y125_RICPR       QKLKVRLKREIIAMNVKD------LNVD--VFKGHYIEPKDWDEFITK------QNVILI
Y2109_XANAC      ARLKVKIKREIISFRRDD------ASPL--QGRAPSVTPAVLRKWLRNGQDDRGRPLVLL
Y2086_XANCP      ARLKVKVKPEIISFRRDD------ASPL--QGRAPSVAPAVLRKWMQQGHDDHGRPLVLL
Y2609_XYLFA      ARFKVKVRPEIISFRRGD------ISPL--QGRAPGVSAHTLRDWLRRGCDDNGRRLVML
Y1985_XYLFT      ARFKVKVRPEIISFRRGD------ISPL--QVRAPGVSAHTLRDWLRRGCDDNGRRLVML
Y2206_RALSO      RRLLVRLKKEIITMRYPL------IRPE--DGRAPSLPPATLKRWLDQGHDDDGREVVML
Y916_CHLMU       PRVTVKYRKELVALGCSV---DTSKQ-------GKHISPEEWHEKLQE------NRCLVL
Y627_CHLTR       PRVTVKYRKELVALGCSV---DTTKQ-------GKHISPEEWHEKLQE------NRCLVL
Y734_CHLPN       PRITVKYRKELAALGCEV---DLSKQ-------AKHISPQEWHEKLQE------NRCLIL
Y2830_COREF      PKLSVKVRDEIVAFGAPN---EIKVDENGIIGGGVHLKPEEVNQLVEER----GDEVVFF
Y2992_CORGL      PKLSVKVRDEIVAFGAPD---ELKVDENGVVGGGVHLKPQQVNELVEAR----GDEVVFF
Y365_BUCAI       WVLCVKIKKKIVQDGIKE----HFFNPN--N-VGIYIQSEQVNSMLND------KKTIFI
Y353_BUCAP       WVLSVKIKKKIVNDGITN----PLFNFK--K-VGIYIKSRQVNMMLSD------RNVIFI
YCEA_ECOLI       WVLRMKVRDRIVADGIDD----PHFDAS--N-VGEYLQAAEVNAMLDD------PDALFI
YCEA_ECOL6       WVLRMKVRDRIVADGIDD----PHFDAS--N-VGEYLQAAEVNAMLDD------PDALFI
YCEA_ECO57       WVLRMKVRDRIVADGIDD----PHFDAS--N-VGEYLQAAEVNAMLDD------PDALFI
YCEA_SALTI       WVLRMKVRDRIVADGIDD----PSFDAS--N-VGDYLKAADVNAMLDD------PDAVFI
YCEA_SALTY       WVLRMKVRDRIVADGIDD----PTFDAS--N-VGDYLKAADVNAMLDD------PDAVFI
Y2451_YERPE      WVLRLKVRERIVADGIDD----DSFDPA--N-IGHYLKADQVNQMIDD------PDTLFV
Y330_BUCBP       WVLRMKVRKKILFDNLPI----DFFDPN--N-VGTYLSAKDVNNMLEN------KNSVLV
Y065_WIGBR       KKLKIKKKLNILNCGIKD----CSFDIK--N-TGHKLTANDFNAILMK------NDFILV
Y3128_LEPIN      LKLDLKIKKKIVADGLND----DAFDVT--N-VGKHLSAEEFNLHMED------ENSIVV
                     :: : .:                      .    .      :           :..

YMDE_LACLA       DARNDYEFDLGHFRGAIRPEIRSFRELPQWIRD--NKEQFMEK-------RVLTYCTGGI
Y572_OCEIH       DARNDYEYDLGHFRGAIRPDIKTFRDLPDWVQE--NKDMLEGK-------KVVTYCTGGI
YBFQ_BACSU       DARNDYEYDLGHFRGAVRPDIEAFRELPEWIEE--HKDMLEGK-------KILTYCTGGV
Y1421_LISIN      DARNDYEFDIGHFRGAVRPDIQNFRELPGWIED--NRDQLEDK-------KIVTYCTGGI
Y1384_LISMO      DARNDYEFDIGHFRGAVRPDIQNFRELPGWIED--NREQLADK-------KIVTYCTGGI
Y2689_STAAM      DARNDYEFDLGHFRGAIRPDITRFRDLPDWIKE--NKALFTDK-------KVVTYCTGGI
Y2609_STAAW      DARNDYEFDLGHFRGAIRPNITRFRDLPDWIKE--NKALFADK-------KVVTYCTGGI
Y262_STAES       DARNDYEYDLGHFRGAIRPDITRFRDLPEWVRN--NKEQLDGK-------NIVTYCTGGI
Y915_STRP1       DTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRD--NKDKFMEK-------RVVVYCTGGV
Y630_STRP3       DTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRD--NKDKFMEK-------RVVVYCTGGV
Y1504_STRA3      DTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRD--NKDKFMEK-------RVVVYCTGGV
Y095_STRPN       DTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRD--NKEKFMDK-------RVVVYCTGGV
Y384_NOSS1       DTRNDYEVHIGTFQGAQNPQTNSFRDFPEYVRQ--NLDPNQHK-------KVAMFCTGGI
Y765_SYNY3       DTRNDYEVAIGTFQGAVNPCTKKFRQFPDYVKN--NLDQQKNK-------KVAMFCTGGI
Y4491_AGRFC      DTRNDYETAIGVFKGAVDPQTKTFREFPDWVKN--NPGLHNKP-------KIAMYCTGGI
Y2887_RHIME      DTRNDYETAIGLFQGAVDPKTKTFREFPEWVRN--NSGLHNKP-------KIAMYCTGGI
Y007_BRUME       DKRNDYEYAIGTFEGAIDPQTRTFREFPEWVKQ--NRDRLEGK-------KIAMFCTGGI
Y3086_BRUSU      DTRNDYEYAIGTFEGAIDPQTRTFREFPEWVKQ--NRDRLEGK-------KIAMFCTGGI
Y2992_RHILO      DTRNTYEVSIGTFKGAVDPATASFREFPAWVEA--HRAELEGR-------KVAMFCTGGI
Y1060_CAUVC      DTRNAYEVAVGRFEGAIDPQTASFADFPAWFRD--WRKSVEAQRGPEAPLKVAMYCTGGI
Y1100_DEIRA      DTRNRYEVKAGTFQGAVDPEIDSFREFPAWVDE--HLAGAEGK-------KIAMFCTGGI
Y2290_SHEON      DTRNDYEVQIGTFKNAINPVTETFREFPEYVKQ--NLDPAKHK-------KVAMFCTGGI
Y1259_VIBCH      DTRNDYEVQLGTFKNALNPKTETFREFPHYVQE--NLDPQKHK-------KVAMFCTGGI
Y858_PSEAE       DTRNDYEVAIGTFEGAVDPKTRSFREFPEYIKA--HYDPARHK-------KVAMFCTGGI
Y167_RICCN       DTRNDYEVEVGTFKSAINPNTKTFKQFPAWVQQ--NQELLKGK-------KIAMVCTGGI
Y125_RICPR       DTRNEYEIDIGTFKSAINPRTETFKQFPAWVQQ--NHALLQGK-------KIAMFCTGGI
Y2109_XANAC      DTRNAQEVRYGTFQGALTLPIDKFTDLPGALEP--HRAALADA-------TVVSFCTGGI
Y2086_XANCP      DTRNAQEVAYGTFQGALTLPIDKFTELPEALQP--HRAALADA-------TVVSFCTGGI
Y2609_XYLFA      DARNQQEIAYGTFSGAMTLPITKFTGFPGALAH--YRDLLSDA-------TVVSFCTGGI
Y1985_XYLFT      DARNQQEIAYGTFSGAMTLPITKFTGFPGALAH--YRDLLSDA-------TVVSFCTGGI
Y2206_RALSO      DTRNGFEVAVGTFRDAVEYGIRKFTEFPPAIAA--HKDDFAGK-------TVVSFCTGGI
Y916_CHLMU       DVRNNYEWKIGHFENAVLPDIETFREFPAYADRLAQEHAPETT-------PVMMYCTGGI
Y627_CHLTR       DVRNNYEWKIGHFENAVLPDIETFREFPDYADRLAKEHDPAKT-------PVMMYCTGGI
Y734_CHLPN       DVRNNYEWKIGHFDNATLPDIQTFREFPEYAEKLAQECDPETT-------PVMMYCTGGI
Y2830_COREF      DGRNAMEAQIGKFRDAVVPDVNTTHDFIKEIES-GKYDDLKDK-------PVVTYCTGGI
Y2992_CORGL      DGRNAMEAQIGKFKDAVVPDVETTHDFIAEIES-GKYDDLKDK-------PVVTYCTGGI
Y365_BUCAI       DMRNSYEYAIGHFENAIEIKSITFREQLKKVIQ--LMAYAKNK-------KIVMYCTGGI
Y353_BUCAP       DMRNSYEYEIGHFPNAIEIKSQTFREQLKKVIQ--IMHYAKNK-------KIVMYCTGGI
YCEA_ECOLI       DMRNHYEYEVGHFENALEIPADTFREQLPKAVE--MMQAHKDK-------KIVMYCTGGI
YCEA_ECOL6       DMRNHYEYEVGHFENALEIPADTFREQLPKAVE--MMQAHKDK-------KIVMYCTGGI
YCEA_ECO57       DMRNHYEYEVGHFENALEIPADTFREQLPKAVE--MMQAHKDK-------KIVMYCTGGI
YCEA_SALTI       DMRNHYEYEVGHFENALEIPADTFREQLPKAVE--MLREHADK-------KIVMYCTGGI
YCEA_SALTY       DMRNHYEYEVGHFENALEIPADTFREQLPKAVE--MLREHADK-------KIVMYCTGGI
Y2451_YERPE      DMRNHYEYEVGHFENAIEVPSDTFREQLPMAVD--MLQHDKEK-------NIVMYCTGGI
Y330_BUCBP       DMRNHYEYKIGHFDSAINVPVNTFREQLFHIVD--FLKHYKNR-------DIIMYCTGGI
Y065_WIGBR       DMRNSYEYEIGHFENALKISSKTFRQQLKLLIN--NLKFYKSK-------NIIMYCTGGI
Y3128_LEPIN      DVRNHYESEIGHFENAILPQSDTFREELRILLE--LLNGKENH-------KILMYCTGGI
                 * **  *   * * .*                                   :   ****:

YMDE_LACLA       RCEKFSGWLVREGFKDVGQLHGGIATYGKDPEVQ--GDLWDGQMYVFDSRIAVPINQKEH
Y572_OCEIH       RCEKFSGWLVKEGFEDVAQLHGGIVTYGQDPEVQ--GDLWDGQLYVFDERISVPVNRKEH
YBFQ_BACSU       RCEKFSGWLVKQGFEDVAQLDGGIVTYGKDPEVQ--GKLWDGQCYVFDERISVPVNRVEH
Y1421_LISIN      RCEKFSGWLKTAGFEDVSQLHGGIATYGKNEETK--GELWDGQMYVFDERIAVPINQVNP
Y1384_LISMO      RCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETK--GELWDGQMYVFDERIAVPINQVNP
Y2689_STAAM      RCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETK--GQYWDGKMYVFDDRISVDINQVEK
Y2609_STAAW      RCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETK--GEYWDGKMYVFDDRISVNINQVEK
Y262_STAES       RCEKFSGWLVKEGFENVGQLHGGIATYGKDPETK--GQYWDGKMYVFDERISVDVNQIDK
Y915_STRP1       RCEKFSGWMVREGFKDVGQLHGGIATYGKDPEVQ--GELWDGAMYVFDDRISVPINHVNP
Y630_STRP3       RCEKFSGWMVREGFKDVGQLHGGIATYGKDPEVQ--GELWDGAMYVFDDRISVPINHVNP
Y1504_STRA3      RCEKFSGWMVREGFKDVGQLHGGIATYGKDPEVQ--GELWDGAMYVFDDRISVPINHVNP
Y095_STRPN       RCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ--GELWDGKMYVFDERIAVDVNHVNP
Y384_NOSS1       RCEKASSFMLSQGFAEVYHLKGGILKYLEQIPPE--ESLWQGECFVFDERIAVVHGLE--
Y765_SYNY3       RCEKASAYLLEEGFAEVYHLRGGILHYLETIAPE--ESLWQGECFVFDERVAVQEGLK--
Y4491_AGRFC      RCEKATAFMKEQGFDEVYHLKGGILKYLEEVPEE--ESLWEGACFVFDERVSVVHGLA--
Y2887_RHIME      RCEKATAFMKEQGFEEVYHLKGGILKYLEEIPPE--ESLWEGACFVFDERVSVTHGLQ--
Y007_BRUME       RCEKATAFVKGLGFDDVYHLKGGILKYLEEVPRE--QSMWNGECFVFDERVAVGHGLA--
Y3086_BRUSU      RCEKATAFVKGLGFDDVYHLKGGILKYLEEVPRE--QSVWNGECFVFDERVAVGHGLA--
Y2992_RHILO      RCEKATAYVKSLGFEDVFHLKGGILKYLEEVPAE--QSLWQGECFVFDERVSVSHGLA--
Y1060_CAUVC      RCEKSTAFLKAEGVEQVFHLKGGVLDYLEQIPQP--ESLWRGECFVFDERVSVGHGLV--
Y1100_DEIRA      RCEKSTSLLLQKGFQDVYHLKGGILKYLEDVPQA--QSRWDGECFVFDGRVTVGHGLQ--
Y2290_SHEON      RCEKSTAYLKEQGFEEVYHLEGGILKYLEEVNKA--ESLWEGECFVFDNRVAVDHDLK--
Y1259_VIBCH      RCEKSTAYLKEQGFEEVYHLEGGILKYLEEVPQE--QSLWEGDCYVFDGRVAVGHGLA--
Y858_PSEAE       RCEKASSYMLGAGFEEVFHLKGGILKYLEEVPQE--QSLWRGDCFVFDNRVTVRHDLS--
Y167_RICCN       RCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNK--NNLWQGECFVFDDRRAVTDDLS--
Y125_RICPR       RCEKSTSLLKSIGYNEVYHLKGGILQYLEDTHNK--NNLWQGKCFVFDDRRAVADDLY--
Y2109_XANAC      RCEKAALWMQADGMDNVLQLEGGILGYFEEVGGE--G--YDGRCFVFDERVALDPELN--
Y2086_XANCP      RCEKAALWMHAEGMDNVLQLEGGILGYFEDVGGE--G--YDGRCFVFDERVALDAELR--
Y2609_XYLFA      RCEKAVLWMRVDGMDNVLQLEGGILGYFEQVGGE--G--YDGRCFVFDKRVALDPQLR--
Y1985_XYLFT      RCEKAVLWMRADGMDNVLQLEGGILGYFEQVGGE--G--YDGRCFVFDKRVALDPQLR--
Y2206_RALSO      RCEKAAIHMQEIGLQHVYQLEGGILKYFEEVGAD--H--YDGDCFVFDHRTALNAELL--
Y916_CHLMU       RCELYSALLLEKGFKEVYQLDGGVIAYGLKMGT---G-KWKGKLFVFDDRMAVPINEADP
Y627_CHLTR       RCELYSALLLEKGFKEVYQLDGGVIAYGLKMGT---G-KWRGKLFVFDDRMAMPIDEADP
Y734_CHLPN       RCELYSPVLLEKGFKEVYQLDGGVIAYGQQVGT---G-KWLGKLFVFDDRLAIPIDESDP
Y2830_COREF      RCEILSSLMINRGFQEVYQIDGGIVRYGEKFGNQ--G-LWEGSLYVFDKRMHMEFGE---
Y2992_CORGL      RCEILSSLMINRGFKEVYQIDGGIVRYGEQFGNK--G-LWEGSLYVFDKRMHMEFGE---
Y365_BUCAI       RCEKATSWMLFNGFKHVYHLEGGIIGYVHDARKNGLPVLFKGKSFVFDNRMSEKISDE--
Y353_BUCAP       RCEKASAWMHFNGFKYVYHLKNGILGYVHDANKNGLPILFQGSNFVFDNRMSEKISDK--
YCEA_ECOLI       RCEKASAWMKHNGFNKVWHIEGGIIEYARKAREQGLPVRFIGKNFVFDERMGERISDE--
YCEA_ECOL6       RCEKASAWMKHNGFNKVWHIEGGIIEYARKARDQGLPVRFIGKNFVFDERMGERISDE--
YCEA_ECO57       RCEKASAWMKHNGFNKVWHIEGGIIEYARKAREQGLPVRFIGKNFVFDERMGERISDE--
YCEA_SALTI       RCEKASAWMKHNGFNKVWHIEGGIIEYARRAREQGLPVRFIGKNFVFDERMGERISDE--
YCEA_SALTY       RCEKASAWMKHNGFNKVWHIEGGIIEYARRARAQGLPVRFIGKNFVFDERMGERISDE--
Y2451_YERPE      RCEKASAYMLHNGFKNVYHVEGGIIEYARKAKEQGLPLKFIGKNFVFDERMGERISDD--
Y330_BUCBP       RCEKATAWIKYNGFKNVYQIKGGIIKYVRDARIENLLVKFRGKNFVFDERMSEVVSKD--
Y065_WIGBR       RCEAASAWMMHNGFKYVSFLDGGIIEYVNFIKKNNYPMKFLGKIFVFDDRLYEKVTSD--
Y3128_LEPIN      RCEKASAWLKHHGYKDVNQLHGGIISYAHEVSQKGLESKFKGKNFVFDGRLQEAIGNE--
                 ***     :   *   *  : .*:  *            : *  :*** *          

YMDE_LACLA       VIVGRDWFDGSPCERYINCGNPECNRQMLASEE---NEAKYLGACSHECRVHPNNRYIKA
Y572_OCEIH       VIVGKDYFDGEPCERYVNCANPECNKQILASEE---NEHKYLRGCTHECRVTPRNLYVKE
YBFQ_BACSU       VIVGKDYFTGEPCERYVNCANPSCNKKMICTPE---NEYKYMRSCSHECRTNPRNLYVKE
Y1421_LISIN      TIVGKDYFDGTPCERYINCANPYCNKQILASLE---NEKKYLRSCSHECRVHPANLYTK-
Y1384_LISMO      TIVGKDYFDGTPCERYINCANPYCNKQILASVE---NEKKYLRSCSHDCRVHPANLYTK-
Y2689_STAAM      TIIGKDWFDGKPCERYINCANPECNKQILVSEE---NETKYLGACSYECAKHERNRYVQA
Y2609_STAAW      TIIGKDWFDGKPCERYINCANPECNKQILVSEE---NETKYLGACSYECAKHERNRYVQA
Y262_STAES       TVIGKEHFDGTPCERYINCANPECNKQILVSEE---NEEKYLGACSYDCAKHERNRYVAR
Y915_STRP1       TVISKDYFDGTPCERYVNCANPFCNKQIFASEE---NETKYVRGCSPECRAHERNRYVQE
Y630_STRP3       TVVSKDYFDGTPCERYVNCANPFCNKQIFASEE---NETKYVRGCSPECRAHERNRYVQE
Y1504_STRA3      TVISKDYFDGTPCERYVNCANPFCNKQIFASEE---NEAKYVRGCSPECRAHERNRYVQE
Y095_STRPN       TIVGKDWFDGTPCERYVNCGNPFCNRRILTSEE---NEDKYLRGCSHECRVHPRNRYVSK
Y384_NOSS1       ---------PGTHELCFCCGHPLAEEDKASLQY---EEGISCPHCFDSLTEDKRMRQQEK
Y765_SYNY3       ---------VGSHALCDHCGYPLRVGDLAEIRY---AVR-HCPQCGLTVAVSNEL-----
Y4491_AGRFC      ---------EGDHQLCHACRNPITPDVRLSPKF---EEGVSCPSCYDERSEDDRQRFRDR
Y2887_RHIME      ---------EGEHTLCHACRQPLTPEDLQSPLH---EEGVSCIHCHDTRTEEDRERYRQR
Y007_BRUME       ---------ESDVELCRACRRPLTPQDKLSQFF---EEGVSCAGCYAER-----------
Y3086_BRUSU      ---------ESDVELCRACRRPLTPQDKLSQFF---EEGVSCAGCYAERTPEDRARYAER
Y2992_RHILO      ---------EGDAELCRACRHPLTASELTSPRY---AAGVSCPHCFDARTDEDRQRYAER
Y1060_CAUVC      ---------KGDHVLCRGCRMPVSPQDQASPLY---VEGVACPACHDQRNEEQKARAAER
Y1100_DEIRA      ---------EGDAVMCHSCGWPLTAQERAHPQF---EEGVSCEHCFDETTDVQKAAFRER
Y2290_SHEON      ---------KGQYDQCNACRMPITEAEKLTPDY---VQGVSCPHCIDKISEEQRKRFVER
Y1259_VIBCH      ---------ESDYQICNACRLPITEEDKQSEQY---EQGVSCPRCFGTHSEEQLERFRER
Y858_PSEAE       ---------EGEYDQCHACRNPVSLEDRQSEHY---VPGISCPHCWDSLSEKTRAGARER
Y167_RICCN       ---------PVERHWLQR------------------------------------------
Y125_RICPR       ---------PAEGYWLHR------------------------------------------
Y2109_XANAC      ---------PLVDADRTA------------------------------------------
Y2086_XANCP      ---------PLVDGAACADAGKI-------------------------------------
Y2609_XYLFA      ---------PLNDMRVVASFARSEIS----------------------------------
Y1985_XYLFT      ---------PLYDMRVVASFARSEIS----------------------------------
Y2206_RALSO      ---------PAGPKQCFACRAVVTPEEQQSADY---IPGQRCPHCADHQARAAT------
Y916_CHLMU       --------NVSPISKCSLCDIESDTYYNCANTD-CNNLFLCCESCITSQKGCCSEECSQA
Y627_CHLTR       --------NVSPIARCSLCNTDSDTYYNCANTD-CNNLFICCESCIATHKGCCSEECSQA
Y734_CHLPN       --------DVAPIAECCHCQTPSDAYYNCANTD-CNALFLCCDECIHQHQGCCGEECSQS
Y2830_COREF      --------DYKRLGHCIHCDTPTNKFEHCVNEDECRQLVLMCPDCYANVETRHCGQD-DC
Y2992_CORGL      --------DYKEVGHCIHCDTPTNKFEHCLNEDDCRELVLMCPDCFANVETRHCKRE-RC
Y365_BUCAI       -----------VISYCKQCG-KSSDVYINCKYSSCHLLFIQCENCSVKFHSCCSLECMKK
Y353_BUCAP       -----------IISFCKQCD-KPSDRYVNCNFNLCHLLFIQCKDCTIKFKKCCSKYCMQH
YCEA_ECOLI       -----------IIAHCHQCG-APCDSHTNCKNDGCHLLFIQCPVCAEKYKGCCSEICCEE
YCEA_ECOL6       -----------IIAHCHQCG-APCDSHTNCKNDGCHLLFIQCPVCAEKYKGCCSEICCEE
YCEA_ECO57       -----------IIAHCHQCG-APCDSHTNCKNDGCHLLFIQCPVCAEKYKGCCSEICCEE
YCEA_SALTI       -----------VIAHCHQCG-VSCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEE
YCEA_SALTY       -----------VIAHCHQCG-ASCDSHTNCKNDGCHLLFIQCPQCASKFNGCCSEQCCEE
Y2451_YERPE      -----------VIAHCHQCG-TPCDAHTNCKNDGCHLLFIQCPVCAAKFEGCCSQICQEE
Y330_BUCBP       -----------VLSKCDQCE-NLCDTYVNCFNSRCHNLFIQCNFCRKKFHNCCSEHCFKT
Y065_WIGBR       -----------VLSLCHQCKIQPCDNYINCKNKKCNSLFIQCIYCNKTLNEFCSNFCNEY
Y3128_LEPIN      -----------VISSCHQCG-AKCDRHVNCENPGCHVLFIQCPSCSEKFEGCCTLECQNV
                                                                             

YMDE_LACLA       HQLSNQEVQERLALLEKDLAS----------------------------
Y572_OCEIH       HELTGTQVEERLLAIGESLTQEV--------------------------
YBFQ_BACSU       HNMTEEEVNARLAAIETEDHAAAE-------------------------
Y1421_LISIN      -ELSKEEFTERLQAIDETLPETVQ-------------------------
Y1384_LISMO      -NLSKEEFTERLQAINESSPEMVQ-------------------------
Y2689_STAAM      NNISDNEWQQRLTNFDDLHQHA---------------------------
Y2609_STAAW      NNISDNEWQQRLTNFDDLHQHA---------------------------
Y262_STAES       HHISNEEWQRRLNNFKDVPEHTHA-------------------------
Y915_STRP1       NGLSRQEWAERLEAIGESLPEFVGA------------------------
Y630_STRP3       NGLSRQEWAERLEAIGESLPEFVGA------------------------
Y1504_STRA3      NGLSRQEWAERLEAIGESLPQVANV------------------------
Y095_STRPN       NELTQAEVIERLAAIGESLDQAATV------------------------
Y384_NOSS1       WRQYQLKNSHSLGNSKLGVAD----------------------------
Y765_SYNY3       -------------------------------------------------
Y4491_AGRFC      QQQIELAKTRGER-HLGR-------------------------------
Y2887_RHIME      QRQIMLAKKRGAR-HLGS-------------------------------
Y007_BRUME       QKQVKLAEKRGANKHIGS-------------------------------
Y3086_BRUSU      QKQVKLAEKRGANKHIGS-------------------------------
Y2992_RHILO      QRQVELAQARGKRPHIGS-------------------------------
Y1060_CAUVC      HRQVLHCEALGVD-HVGATLPTKID------------------------
Y1100_DEIRA      QRMYEAGHLT---------------------------------------
Y2290_SHEON      ERQVNLAKSRNEA-HIGSDVNHVIEARRQKKEALRKQSAEKNKAKQANA
Y1259_VIBCH      EKQVQLAKLRGES-HIGEESAALIEKRR--AEKLARKAAQRGQKG----
Y858_PSEAE       QKQIELARQRNQP-HPLG--------RD-----P-RQSTLEN-------
Y167_RICCN       -------------------------------------------------
Y125_RICPR       -------------------------------------------------
Y2109_XANAC      -------------------------------------------------
Y2086_XANCP      -------------------------------------------------
Y2609_XYLFA      -------------------------------------------------
Y1985_XYLFT      -------------------------------------------------
Y2206_RALSO      -------------------------------------------------
Y916_CHLMU       PRIRTFSAERGNKPFRRKHLCPTIEQTR---CCLREKDNQPA-------
Y627_CHLTR       PRIRAFSAERGNKPFRRKHLCPTIEQS----CCLKEQENQPA-------
Y734_CHLPN       PRVRKFDSSRGNKPFRRAHLCEISENSESASCCLI--------------
Y2830_COREF      VEIAADLAARGVDPLVTQ-------------------------------
Y2992_CORGL      AAIAADFAEQGIDPLVTS-------------------------------
Y365_BUCAI       YKFYMLNNDLKKISY----------------------------------
Y353_BUCAP       L------------------------------------------------
YCEA_ECOLI       SALPPEEQRRRRAGRENGNKIFNKSRGRLNTTLCIPDPTE---------
YCEA_ECOL6       SALPPDEQRRRRAGRENGNKIFNKSRGRLNTTLGIPDPTE---------
YCEA_ECO57       SALPPEEQRRRRAGRENGNKIFNKSRGRLNTTLGIPDPTE---------
YCEA_SALTI       LALPEEEQRRRRAGRENGNKIFNKSRGRLNSKLSIPDPAE---------
YCEA_SALTY       LALPEEEQRRRRAGRENGNKIFNKSRGRLNSKLSIPDPAE---------
Y2451_YERPE      LKLPQEEQRSRRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK----
Y330_BUCBP       LLK----------------------------------------------
Y065_WIGBR       YQSKN--------------------------------------------
Y3128_LEPIN      LHLPKEKQKEIRKGKLNENRFFSKSKIRPKISELYHGILFKSSK-----